F443833
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 437 | 276 | 433 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300044719|Ga0466971_0031188|Ga0466971_0031188_1121_1765 |
| Length | 214 |
| Sequence | MGVLAAASALTDDVAPGAVRCLDGLTPTSIRRGFMRRSTTFMLAAMLASVPVLAALPDGSKAPDINTEASLAGKTFKFSLADALKKGPVVLYFYPAAFTPGCTVEAHEFAEATPKFKELGATVIGVSHDPIDKLQKFSVSECRNKFAVASDGDGSIMKAYDAVLAAKPEYANRTSYVIAPSGEVIYSYTDLNPGKHVENTMSAVKKWQDEHKKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 2 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 3 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 4 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 140 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 145 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 149 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 180 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 181 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 182 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 235 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 236 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 237 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 238 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 239 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 240 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 241 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 259 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 260 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 261 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 262 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 263 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 264 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 265 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 266 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 268 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 269 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 270 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 271 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 273 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 274 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.4 |
| Metatranscriptomes | 0.69 |
| Isolates | 0.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.76 |
| Nodule | 0 |
| Rhizoplane | 3.66 |
| Rhizosphere | 75.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10012581 | 3300001990 | Bacteria | 2758 |
| 2 | JGI24735J21928_10019252 | 3300002067 | Bacteria | 2099 |
| 3 | JGI24738J21930_10005044 | 3300002075 | Bacteria | 3191 |
| 4 | JGI25151J46595_10090150 | 3300003187 | Bacteria | 856 |
| 5 | JGI25406J46586_10160383 | 3300003203 | Bacteria | 656 |
| 6 | rootL2_10043958 | 3300003322 | Bacteria | 3032 |
| 7 | Ga0055542_1005864 | 3300003762 | Bacteria | 2698 |
| 8 | Ga0055536_1001904 | 3300003781 | Bacteria | 12099 |
| 9 | Ga0055536_1003233 | 3300003781 | Bacteria | 8830 |
| 10 | Ga0055536_1009211 | 3300003781 | Bacteria | 4120 |
| 11 | Ga0055534_1014513 | 3300003784 | Bacteria | 1472 |
| 12 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 13 | Ga0055530_10037304 | 3300003791 | Bacteria | 1217 |
| 14 | Ga0055531_10000627 | 3300003794 | Bacteria | 30500 |
| 15 | Ga0055531_10009084 | 3300003794 | Bacteria | 5127 |
| 16 | Ga0065703_1023663 | 3300005272 | Bacteria | 684 |
| 17 | Ga0070658_10159494 | 3300005327 | Bacteria | 1892 |
| 18 | Ga0070666_10032933 | 3300005335 | Bacteria | 3426 |
| 19 | Ga0068868_100094180 | 3300005338 | Bacteria | 2416 |
| 20 | Ga0070689_100139232 | 3300005340 | Bacteria | 1951 |
| 21 | Ga0070661_100757837 | 3300005344 | Bacteria | 794 |
| 22 | Ga0070661_101131711 | 3300005344 | Bacteria | 653 |
| 23 | Ga0070671_100016624 | 3300005355 | Bacteria | 5947 |
| 24 | Ga0070671_100133508 | 3300005355 | Bacteria | 2092 |
| 25 | Ga0070671_100504646 | 3300005355 | Bacteria | 1041 |
| 26 | Ga0070674_100107637 | 3300005356 | Bacteria | 2041 |
| 27 | Ga0070674_100832081 | 3300005356 | Bacteria | 799 |
| 28 | Ga0070667_100017540 | 3300005367 | Bacteria | 5934 |
| 29 | Ga0070667_100033950 | 3300005367 | Bacteria | 4268 |
| 30 | Ga0070709_10091314 | 3300005434 | Bacteria | 2009 |
| 31 | Ga0070713_100030365 | 3300005436 | Bacteria | 4291 |
| 32 | Ga0070713_100332302 | 3300005436 | Bacteria | 1406 |
| 33 | Ga0070710_10047610 | 3300005437 | Bacteria | 2392 |
| 34 | Ga0070711_100077960 | 3300005439 | Bacteria | 2353 |
| 35 | Ga0070705_100854789 | 3300005440 | Bacteria | 728 |
| 36 | Ga0070663_100117285 | 3300005455 | Bacteria | 2007 |
| 37 | Ga0070678_100264186 | 3300005456 | Bacteria | 1449 |
| 38 | Ga0070662_100437498 | 3300005457 | Bacteria | 1084 |
| 39 | Ga0070681_10232327 | 3300005458 | Unclassified | 1758 |
| 40 | Ga0068867_100113160 | 3300005459 | Bacteria | 2087 |
| 41 | Ga0068853_100027582 | 3300005539 | Bacteria | 4771 |
| 42 | Ga0068853_100086669 | 3300005539 | Bacteria | 2746 |
| 43 | Ga0068853_101155659 | 3300005539 | Bacteria | 747 |
| 44 | Ga0070672_100418074 | 3300005543 | Bacteria | 1151 |
| 45 | Ga0070686_100137952 | 3300005544 | Bacteria | 1694 |
| 46 | Ga0070695_100246058 | 3300005545 | Bacteria | 1299 |
| 47 | Ga0070665_100004651 | 3300005548 | Bacteria | 14331 |
| 48 | Ga0070665_100016873 | 3300005548 | Bacteria | 7321 |
| 49 | Ga0070665_100128705 | 3300005548 | Bacteria | 2534 |
| 50 | Ga0070665_100161955 | 3300005548 | Bacteria | 2239 |
| 51 | Ga0070665_100239004 | 3300005548 | Bacteria | 1817 |
| 52 | Ga0070665_100254504 | 3300005548 | Bacteria | 1757 |
| 53 | Ga0070704_100726936 | 3300005549 | Bacteria | 882 |
| 54 | Ga0068855_100086401 | 3300005563 | Bacteria | 3627 |
| 55 | Ga0068854_101198159 | 3300005578 | Bacteria | 680 |
| 56 | Ga0068856_100017668 | 3300005614 | Bacteria | 6914 |
| 57 | Ga0068856_100171262 | 3300005614 | Bacteria | 2183 |
| 58 | Ga0068856_100535614 | 3300005614 | Bacteria | 1192 |
| 59 | Ga0070702_100224311 | 3300005615 | Bacteria | 1259 |
| 60 | Ga0068852_100000043 | 3300005616 | Bacteria | 89867 |
| 61 | Ga0068852_100353237 | 3300005616 | Bacteria | 1436 |
| 62 | Ga0068852_100445809 | 3300005616 | Bacteria | 1280 |
| 63 | Ga0068852_101739922 | 3300005616 | Bacteria | 646 |
| 64 | Ga0068864_100249239 | 3300005618 | Bacteria | 1648 |
| 65 | Ga0068864_101443426 | 3300005618 | Bacteria | 690 |
| 66 | Ga0068866_10005524 | 3300005718 | Bacteria | 5221 |
| 67 | Ga0068866_10728098 | 3300005718 | Bacteria | 683 |
| 68 | Ga0068861_100141959 | 3300005719 | Bacteria | 1961 |
| 69 | Ga0068851_10112024 | 3300005834 | Bacteria | 1458 |
| 70 | Ga0068863_100026269 | 3300005841 | Bacteria | 5555 |
| 71 | Ga0068863_100043924 | 3300005841 | Bacteria | 4242 |
| 72 | Ga0068858_100007974 | 3300005842 | Bacteria | 10206 |
| 73 | Ga0068858_100072202 | 3300005842 | Bacteria | 3202 |
| 74 | Ga0068858_100919485 | 3300005842 | Bacteria | 856 |
| 75 | Ga0068858_101202277 | 3300005842 | Bacteria | 745 |
| 76 | Ga0068860_100001431 | 3300005843 | Bacteria | 25836 |
| 77 | Ga0068860_100103586 | 3300005843 | Bacteria | 2716 |
| 78 | Ga0068860_101341719 | 3300005843 | Bacteria | 736 |
| 79 | Ga0068862_100000331 | 3300005844 | Bacteria | 51655 |
| 80 | Ga0068862_100124111 | 3300005844 | Bacteria | 2279 |
| 81 | Ga0068862_101195058 | 3300005844 | Bacteria | 759 |
| 82 | Ga0081455_10000192 | 3300005937 | Bacteria | 77713 |
| 83 | Ga0081455_10256268 | 3300005937 | Bacteria | 1276 |
| 84 | Ga0081539_10005075 | 3300005985 | Bacteria | 13800 |
| 85 | Ga0075365_10318740 | 3300006038 | Bacteria | 1095 |
| 86 | Ga0070715_10004901 | 3300006163 | Bacteria | 4436 |
| 87 | Ga0070716_100007651 | 3300006173 | Bacteria | 5330 |
| 88 | Ga0070716_100227401 | 3300006173 | Bacteria | 1257 |
| 89 | Ga0070716_100504869 | 3300006173 | Bacteria | 893 |
| 90 | Ga0070712_100222347 | 3300006175 | Bacteria | 1495 |
| 91 | Ga0070712_100880829 | 3300006175 | Bacteria | 771 |
| 92 | Ga0097621_100018904 | 3300006237 | Bacteria | 5277 |
| 93 | Ga0068871_100066860 | 3300006358 | Bacteria | 2947 |
| 94 | Ga0068871_100135141 | 3300006358 | Bacteria | 2094 |
| 95 | Ga0068871_100715444 | 3300006358 | Bacteria | 918 |
| 96 | Ga0075430_100023719 | 3300006846 | Bacteria | 5225 |
| 97 | Ga0075434_101086810 | 3300006871 | Bacteria | 813 |
| 98 | Ga0068865_100086529 | 3300006881 | Bacteria | 2263 |
| 99 | Ga0105240_10009404 | 3300009093 | Bacteria | 13842 |
| 100 | Ga0111539_10291853 | 3300009094 | Bacteria | 1898 |
| 101 | Ga0111539_10763053 | 3300009094 | Bacteria | 1126 |
| 102 | Ga0105245_10120438 | 3300009098 | Bacteria | 2451 |
| 103 | Ga0105245_10328770 | 3300009098 | Bacteria | 1508 |
| 104 | Ga0105247_10061019 | 3300009101 | Bacteria | 2337 |
| 105 | Ga0105241_10276114 | 3300009174 | Bacteria | 1433 |
| 106 | Ga0105241_10444229 | 3300009174 | Bacteria | 1146 |
| 107 | Ga0105242_10000748 | 3300009176 | Bacteria | 25302 |
| 108 | Ga0105242_10330154 | 3300009176 | Unclassified | 1402 |
| 109 | Ga0105242_10581905 | 3300009176 | Bacteria | 1078 |
| 110 | Ga0105248_10008783 | 3300009177 | Bacteria | 11095 |
| 111 | Ga0105248_10802666 | 3300009177 | Bacteria | 1062 |
| 112 | Ga0105237_10053793 | 3300009545 | Bacteria | 4037 |
| 113 | Ga0105237_10114676 | 3300009545 | Bacteria | 2687 |
| 114 | Ga0105238_10176397 | 3300009551 | Bacteria | 2114 |
| 115 | Ga0105238_10194190 | 3300009551 | Bacteria | 2006 |
| 116 | Ga0105238_10358245 | 3300009551 | Bacteria | 1448 |
| 117 | Ga0105249_10000127 | 3300009553 | Bacteria | 102392 |
| 118 | Ga0105249_10116139 | 3300009553 | Bacteria | 2536 |
| 119 | Ga0105249_10199886 | 3300009553 | Bacteria | 1955 |
| 120 | Ga0105239_10398332 | 3300010375 | Bacteria | 1558 |
| 121 | Ga0157326_1002628 | 3300012513 | Bacteria | 1914 |
| 122 | Ga0157371_10404094 | 3300013102 | Bacteria | 1000 |
| 123 | Ga0157374_10001676 | 3300013296 | Bacteria | 18563 |
| 124 | Ga0157374_10417748 | 3300013296 | Bacteria | 1340 |
| 125 | Ga0157378_10003178 | 3300013297 | Bacteria | 14586 |
| 126 | Ga0157378_10451047 | 3300013297 | Bacteria | 1276 |
| 127 | Ga0163162_10032619 | 3300013306 | Bacteria | 5173 |
| 128 | Ga0163162_11454394 | 3300013306 | Bacteria | 780 |
| 129 | Ga0157372_10002811 | 3300013307 | Bacteria | 18801 |
| 130 | Ga0157372_10024184 | 3300013307 | Bacteria | 6594 |
| 131 | Ga0157372_10024571 | 3300013307 | Bacteria | 6548 |
| 132 | Ga0157372_10028716 | 3300013307 | Bacteria | 6072 |
| 133 | Ga0157372_10039230 | 3300013307 | Bacteria | 5227 |
| 134 | Ga0157372_10750732 | 3300013307 | Bacteria | 1135 |
| 135 | Ga0157375_10132411 | 3300013308 | Bacteria | 2614 |
| 136 | Ga0157375_10576043 | 3300013308 | Bacteria | 1286 |
| 137 | Ga0163163_10334076 | 3300014325 | Bacteria | 1570 |
| 138 | Ga0163163_12116865 | 3300014325 | Bacteria | 622 |
| 139 | Ga0157379_10083066 | 3300014968 | Bacteria | 2871 |
| 140 | Ga0157379_10212263 | 3300014968 | Bacteria | 1752 |
| 141 | Ga0157379_10347294 | 3300014968 | Bacteria | 1358 |
| 142 | Ga0157376_10155784 | 3300014969 | Bacteria | 2065 |
| 143 | Ga0157376_10561206 | 3300014969 | Bacteria | 1131 |
| 144 | Ga0213874_10002426 | 3300021377 | Bacteria | 4014 |
| 145 | Ga0213876_10074196 | 3300021384 | Bacteria | 1797 |
| 146 | Ga0209148_1000074 | 3300025254 | Bacteria | 314356 |
| 147 | Ga0209675_1000808 | 3300025291 | Bacteria | 20627 |
| 148 | Ga0209676_1000221 | 3300025292 | Bacteria | 124715 |
| 149 | Ga0209676_1000453 | 3300025292 | Bacteria | 69137 |
| 150 | Ga0209676_1001788 | 3300025292 | Bacteria | 18043 |
| 151 | Ga0209025_1008523 | 3300025294 | Bacteria | 7365 |
| 152 | Ga0209025_1062868 | 3300025294 | Bacteria | 1374 |
| 153 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 154 | Ga0209050_1000822 | 3300025298 | Bacteria | 43254 |
| 155 | Ga0209050_1026115 | 3300025298 | Bacteria | 1963 |
| 156 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 157 | Ga0209257_1000487 | 3300025304 | Bacteria | 71315 |
| 158 | Ga0207656_10069283 | 3300025321 | Bacteria | 1565 |
| 159 | Ga0207692_10027207 | 3300025898 | Bacteria | 2692 |
| 160 | Ga0207710_10004351 | 3300025900 | Bacteria | 6193 |
| 161 | Ga0207680_10467379 | 3300025903 | Bacteria | 896 |
| 162 | Ga0207647_10000756 | 3300025904 | Bacteria | 25295 |
| 163 | Ga0207647_10109662 | 3300025904 | Bacteria | 1632 |
| 164 | Ga0207685_10002232 | 3300025905 | Bacteria | 4386 |
| 165 | Ga0207699_10822433 | 3300025906 | Bacteria | 683 |
| 166 | Ga0207705_10414318 | 3300025909 | Bacteria | 1043 |
| 167 | Ga0207654_10541977 | 3300025911 | Bacteria | 826 |
| 168 | Ga0207707_10017766 | 3300025912 | Bacteria | 6202 |
| 169 | Ga0207695_10027047 | 3300025913 | Bacteria | 6391 |
| 170 | Ga0207695_10122541 | 3300025913 | Bacteria | 2566 |
| 171 | Ga0207671_10143978 | 3300025914 | Bacteria | 1838 |
| 172 | Ga0207671_10339979 | 3300025914 | Bacteria | 1189 |
| 173 | Ga0207693_10001300 | 3300025915 | Bacteria | 22186 |
| 174 | Ga0207693_10704953 | 3300025915 | Bacteria | 782 |
| 175 | Ga0207663_10129186 | 3300025916 | Bacteria | 1743 |
| 176 | Ga0207649_10710965 | 3300025920 | Bacteria | 780 |
| 177 | Ga0207652_10190705 | 3300025921 | Unclassified | 1844 |
| 178 | Ga0207694_10257307 | 3300025924 | Unclassified | 1429 |
| 179 | Ga0207659_10221041 | 3300025926 | Bacteria | 1523 |
| 180 | Ga0207700_10028195 | 3300025928 | Bacteria | 3944 |
| 181 | Ga0207644_10247234 | 3300025931 | Bacteria | 1422 |
| 182 | Ga0207644_10532257 | 3300025931 | Bacteria | 971 |
| 183 | Ga0207706_10029402 | 3300025933 | Bacteria | 4904 |
| 184 | Ga0207706_10242875 | 3300025933 | Bacteria | 1574 |
| 185 | Ga0207686_10403057 | 3300025934 | Bacteria | 1042 |
| 186 | Ga0207670_10003322 | 3300025936 | Bacteria | 8528 |
| 187 | Ga0207670_10068665 | 3300025936 | Bacteria | 2443 |
| 188 | Ga0207665_10000795 | 3300025939 | Bacteria | 21329 |
| 189 | Ga0207665_10091896 | 3300025939 | Bacteria | 2105 |
| 190 | Ga0207711_10104669 | 3300025941 | Bacteria | 2508 |
| 191 | Ga0207661_10147348 | 3300025944 | Bacteria | 2032 |
| 192 | Ga0207661_10171992 | 3300025944 | Bacteria | 1886 |
| 193 | Ga0207667_10317890 | 3300025949 | Bacteria | 1590 |
| 194 | Ga0207667_11228247 | 3300025949 | Bacteria | 728 |
| 195 | Ga0207651_10666322 | 3300025960 | Bacteria | 914 |
| 196 | Ga0207712_10000150 | 3300025961 | Bacteria | 72311 |
| 197 | Ga0207712_10347573 | 3300025961 | Bacteria | 1232 |
| 198 | Ga0207712_10368553 | 3300025961 | Bacteria | 1199 |
| 199 | Ga0207712_10448338 | 3300025961 | Unclassified | 1094 |
| 200 | Ga0207658_10128912 | 3300025986 | Bacteria | 2029 |
| 201 | Ga0207677_10452893 | 3300026023 | Bacteria | 1100 |
| 202 | Ga0207703_10035384 | 3300026035 | Bacteria | 3968 |
| 203 | Ga0207703_10195520 | 3300026035 | Bacteria | 1794 |
| 204 | Ga0207703_11405395 | 3300026035 | Bacteria | 671 |
| 205 | Ga0207639_10203778 | 3300026041 | Bacteria | 1698 |
| 206 | Ga0207678_10064523 | 3300026067 | Bacteria | 3146 |
| 207 | Ga0207702_10024793 | 3300026078 | Bacteria | 4976 |
| 208 | Ga0207702_10152031 | 3300026078 | Bacteria | 2106 |
| 209 | Ga0207641_10001051 | 3300026088 | Bacteria | 27868 |
| 210 | Ga0207641_10088780 | 3300026088 | Bacteria | 2700 |
| 211 | Ga0207641_10221287 | 3300026088 | Bacteria | 1755 |
| 212 | Ga0207648_10325984 | 3300026089 | Bacteria | 1381 |
| 213 | Ga0207674_10027840 | 3300026116 | Bacteria | 5972 |
| 214 | Ga0207674_11061223 | 3300026116 | Bacteria | 779 |
| 215 | Ga0207675_100030282 | 3300026118 | Bacteria | 5040 |
| 216 | Ga0207675_100182176 | 3300026118 | Bacteria | 2012 |
| 217 | Ga0207683_10002715 | 3300026121 | Bacteria | 15449 |
| 218 | Ga0207683_10352161 | 3300026121 | Bacteria | 1351 |
| 219 | Ga0207698_10030305 | 3300026142 | Bacteria | 3888 |
| 220 | Ga0207428_10063836 | 3300027907 | Bacteria | 2908 |
| 221 | Ga0268266_10006042 | 3300028379 | Bacteria | 11159 |
| 222 | Ga0268266_10098467 | 3300028379 | Bacteria | 2573 |
| 223 | Ga0268266_10165965 | 3300028379 | Bacteria | 2000 |
| 224 | Ga0268266_10310897 | 3300028379 | Bacteria | 1472 |
| 225 | Ga0268266_10333118 | 3300028379 | Bacteria | 1423 |
| 226 | Ga0268265_10001409 | 3300028380 | Bacteria | 20352 |
| 227 | Ga0268265_10027152 | 3300028380 | Bacteria | 4082 |
| 228 | Ga0268265_10091484 | 3300028380 | Bacteria | 2433 |
| 229 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 230 | Ga0268264_10000504 | 3300028381 | Bacteria | 50665 |
| 231 | Ga0268264_10011159 | 3300028381 | Bacteria | 7421 |
| 232 | Ga0265337_1010647 | 3300028556 | Bacteria | 3209 |
| 233 | Ga0265334_10038186 | 3300028573 | Bacteria | 1890 |
| 234 | Ga0265334_10045809 | 3300028573 | Bacteria | 1693 |
| 235 | Ga0307515_10322375 | 3300028794 | Bacteria | 1210 |
| 236 | Ga0265338_10000356 | 3300028800 | Bacteria | 82744 |
| 237 | Ga0265338_10098414 | 3300028800 | Bacteria | 2393 |
| 238 | Ga0265338_10535443 | 3300028800 | Bacteria | 821 |
| 239 | Ga0265324_10059029 | 3300029957 | Bacteria | 1312 |
| 240 | Ga0307511_10000165 | 3300030521 | Bacteria | 64541 |
| 241 | Ga0307511_10005693 | 3300030521 | Bacteria | 12634 |
| 242 | Ga0265770_1000527 | 3300030878 | Bacteria | 5346 |
| 243 | Ga0265770_1014942 | 3300030878 | Bacteria | 1177 |
| 244 | Ga0265760_10000709 | 3300031090 | Bacteria | 9490 |
| 245 | Ga0265332_10004917 | 3300031238 | Bacteria | 6213 |
| 246 | Ga0265325_10001375 | 3300031241 | Bacteria | 17182 |
| 247 | Ga0265340_10140023 | 3300031247 | Bacteria | 1107 |
| 248 | Ga0265339_10004601 | 3300031249 | Bacteria | 9389 |
| 249 | Ga0265339_10115303 | 3300031249 | Bacteria | 1386 |
| 250 | Ga0265331_10006116 | 3300031250 | Bacteria | 7163 |
| 251 | Ga0265331_10143564 | 3300031250 | Bacteria | 1085 |
| 252 | Ga0265327_10003173 | 3300031251 | Bacteria | 16090 |
| 253 | Ga0265316_10014203 | 3300031344 | Bacteria | 7024 |
| 254 | Ga0307509_10000005 | 3300031507 | Bacteria | 435959 |
| 255 | Ga0307408_100426972 | 3300031548 | Bacteria | 1144 |
| 256 | Ga0265313_10000215 | 3300031595 | Bacteria | 62030 |
| 257 | Ga0265342_10014049 | 3300031712 | Bacteria | 5329 |
| 258 | Ga0307406_10710436 | 3300031901 | Bacteria | 840 |
| 259 | Ga0307412_10004515 | 3300031911 | Bacteria | 7754 |
| 260 | Ga0307412_10031801 | 3300031911 | Bacteria | 3337 |
| 261 | Ga0307412_10248443 | 3300031911 | Bacteria | 1380 |
| 262 | Ga0307416_100140489 | 3300032002 | Bacteria | 2194 |
| 263 | Ga0307414_10005170 | 3300032004 | Bacteria | 7163 |
| 264 | Ga0307414_10007589 | 3300032004 | Bacteria | 6100 |
| 265 | Ga0307414_10051855 | 3300032004 | Bacteria | 2851 |
| 266 | Ga0307414_10106918 | 3300032004 | Bacteria | 2119 |
| 267 | Ga0307414_10226598 | 3300032004 | Bacteria | 1538 |
| 268 | Ga0307510_10131016 | 3300033180 | Bacteria | 2181 |
| 269 | Ga0373932_0050715 | 3300035112 | Bacteria | 1231 |
| 270 | Ga0373936_0053896 | 3300035113 | Bacteria | 1631 |
| 271 | Ga0373936_0201078 | 3300035113 | Bacteria | 879 |
| 272 | Ga0373941_0040823 | 3300035115 | Bacteria | 1433 |
| 273 | Ga0373954_0024416 | 3300035118 | Bacteria | 2756 |
| 274 | Ga0373957_0115703 | 3300035120 | Bacteria | 1083 |
| 275 | Ga0373946_0015993 | 3300035171 | Bacteria | 2854 |
| 276 | Ga0373931_0259618 | 3300035691 | Bacteria | 1059 |
| 277 | Ga0373927_0635686 | 3300035695 | Bacteria | 705 |
| 278 | Ga0316582_0050739 | 3300036647 | Bacteria | 2630 |
| 279 | Ga0373925_0086535 | 3300037068 | Bacteria | 2391 |
| 280 | Ga0373925_0922106 | 3300037068 | Bacteria | 720 |
| 281 | Ga0395905_0012524 | 3300037471 | Bacteria | 8162 |
| 282 | Ga0395905_0911834 | 3300037471 | Unclassified | 782 |
| 283 | Ga0436364_0123985 | 3300037853 | Bacteria | 1859 |
| 284 | Ga0436364_1297790 | 3300037853 | Bacteria | 1090 |
| 285 | Ga0436365_0027294 | 3300039437 | Bacteria | 3973 |
| 286 | Ga0436365_0114693 | 3300039437 | Bacteria | 1792 |
| 287 | Ga0436365_0240348 | 3300039437 | Bacteria | 1174 |
| 288 | Ga0436360_0650621 | 3300039438 | Bacteria | 2094 |
| 289 | Ga0436360_0683286 | 3300039438 | Bacteria | 1210 |
| 290 | Ga0436360_0781012 | 3300039438 | Bacteria | 2345 |
| 291 | Ga0436361_0094519 | 3300039447 | Bacteria | 1002 |
| 292 | Ga0436361_0445108 | 3300039447 | Bacteria | 1256 |
| 293 | Ga0436361_1002072 | 3300039447 | Bacteria | 879 |
| 294 | Ga0436361_1061351 | 3300039447 | Bacteria | 3403 |
| 295 | Ga0436363_0423907 | 3300039450 | Bacteria | 1512 |
| 296 | Ga0436363_0928702 | 3300039450 | Bacteria | 16814 |
| 297 | Ga0436363_0951177 | 3300039450 | Bacteria | 9774 |
| 298 | Ga0436363_1015046 | 3300039450 | Unclassified | 878 |
| 299 | Ga0451797_1364172 | 3300041453 | Bacteria | 627 |
| 300 | Ga0439448_0001045 | 3300042005 | Bacteria | 6928 |
| 301 | Ga0439455_0000109 | 3300042012 | Bacteria | 8273 |
| 302 | Ga0439458_0000632 | 3300042157 | Bacteria | 9121 |
| 303 | Ga0451577_0548557 | 3300042876 | Bacteria | 1049 |
| 304 | Ga0466972_0004177 | 3300044658 | Bacteria | 7213 |
| 305 | Ga0466965_0039252 | 3300044683 | Bacteria | 2327 |
| 306 | Ga0466966_0004429 | 3300044684 | Bacteria | 9260 |
| 307 | Ga0466961_0009863 | 3300044693 | Bacteria | 6083 |
| 308 | Ga0466961_0052411 | 3300044693 | Bacteria | 2603 |
| 309 | Ga0466963_0005703 | 3300044694 | Bacteria | 7317 |
| 310 | Ga0466964_0065288 | 3300044706 | Bacteria | 1524 |
| 311 | Ga0453684_0000063 | 3300044712 | Bacteria | 486079 |
| 312 | Ga0466971_0031188 | 3300044719 | Bacteria | 2386 |
| 313 | Ga0466968_0043606 | 3300044735 | Bacteria | 1900 |
| 314 | Ga0466968_0104968 | 3300044735 | Bacteria | 1265 |
| 315 | Ga0466970_0132905 | 3300044765 | Bacteria | 1367 |
| 316 | Ga0466959_0117667 | 3300045049 | Bacteria | 1891 |
| 317 | Ga0466959_0464398 | 3300045049 | Bacteria | 857 |
| 318 | Ga0451576_0051413 | 3300045051 | Bacteria | 4320 |
| 319 | Ga0451576_0886732 | 3300045051 | Bacteria | 936 |
| 320 | Ga0466958_0004385 | 3300045836 | Bacteria | 7442 |
| 321 | Ga0466958_0680835 | 3300045836 | Bacteria | 670 |
| 322 | Ga0466967_0002129 | 3300045976 | Bacteria | 12137 |
| 323 | Ga0495627_000078 | 3300046453 | Bacteria | 119920 |
| 324 | Ga0495638_0102125 | 3300046460 | Bacteria | 1714 |
| 325 | Ga0495580_0002363 | 3300046472 | Bacteria | 16475 |
| 326 | Ga0495580_0034578 | 3300046472 | Bacteria | 3638 |
| 327 | Ga0495582_0295206 | 3300046473 | Bacteria | 931 |
| 328 | Ga0495664_0355072 | 3300046477 | Bacteria | 882 |
| 329 | Ga0495630_0023715 | 3300046517 | Bacteria | 4536 |
| 330 | Ga0495643_0061147 | 3300046522 | Bacteria | 1998 |
| 331 | Ga0495648_0094382 | 3300046524 | Bacteria | 1666 |
| 332 | Ga0495666_0226517 | 3300046526 | Bacteria | 855 |
| 333 | Ga0495652_0819501 | 3300046529 | Bacteria | 618 |
| 334 | Ga0495654_0199792 | 3300046530 | Bacteria | 856 |
| 335 | Ga0495586_0068726 | 3300046535 | Bacteria | 1933 |
| 336 | Ga0495645_0128845 | 3300046543 | Bacteria | 1776 |
| 337 | Ga0495633_0096643 | 3300046558 | Bacteria | 1372 |
| 338 | Ga0495667_0720382 | 3300046559 | Bacteria | 618 |
| 339 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 340 | Ga0495625_0000652 | 3300046660 | Bacteria | 49796 |
| 341 | Ga0495625_0246195 | 3300046660 | Bacteria | 1162 |
| 342 | Ga0495658_0172357 | 3300046683 | Bacteria | 1340 |
| 343 | Ga0495669_0045943 | 3300046684 | Bacteria | 1948 |
| 344 | Ga0495613_0266663 | 3300046689 | Bacteria | 1192 |
| 345 | Ga0495613_0621176 | 3300046689 | Unclassified | 717 |
| 346 | Ga0495671_0053953 | 3300046692 | Bacteria | 1994 |
| 347 | Ga0495581_0296900 | 3300047315 | Bacteria | 944 |
| 348 | Ga0495674_0146025 | 3300047319 | Bacteria | 1986 |
| 349 | Ga0495673_0019778 | 3300047469 | Bacteria | 3368 |
| 350 | Ga0495681_0138668 | 3300047470 | Bacteria | 1029 |
| 351 | Ga0496100_0683581 | 3300048903 | Bacteria | 800 |
| 352 | Ga0496101_0002111 | 3300048904 | Bacteria | 12118 |
| 353 | Ga0496103_0015553 | 3300048906 | Bacteria | 4531 |
| 354 | Ga0496103_0651608 | 3300048906 | Bacteria | 669 |
| 355 | Ga0496103_0750989 | 3300048906 | Bacteria | 617 |
| 356 | Ga0496104_0190690 | 3300048907 | Bacteria | 1961 |
| 357 | Ga0496104_0318017 | 3300048907 | Bacteria | 1469 |
| 358 | Ga0496107_0019177 | 3300048910 | Bacteria | 4825 |
| 359 | Ga0496109_0056732 | 3300048912 | Bacteria | 3573 |
| 360 | Ga0496110_0078126 | 3300048913 | Bacteria | 2946 |
| 361 | Ga0496111_0028030 | 3300048914 | Bacteria | 3990 |
| 362 | Ga0496112_0365550 | 3300048915 | Bacteria | 1384 |
| 363 | Ga0496114_0011053 | 3300048917 | Bacteria | 7201 |
| 364 | Ga0496115_0023032 | 3300048918 | Bacteria | 4830 |
| 365 | Ga0496115_0746960 | 3300048918 | Bacteria | 765 |
| 366 | Ga0496116_0002812 | 3300048919 | Bacteria | 17865 |
| 367 | Ga0496117_0001472 | 3300048920 | Bacteria | 33857 |
| 368 | Ga0496117_0027981 | 3300048920 | Bacteria | 4372 |
| 369 | Ga0496117_0084881 | 3300048920 | Bacteria | 2064 |
| 370 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 371 | Ga0496118_0017435 | 3300048921 | Bacteria | 6536 |
| 372 | Ga0496118_0030739 | 3300048921 | Bacteria | 4471 |
| 373 | Ga0496119_0001712 | 3300048922 | Bacteria | 25579 |
| 374 | Ga0496119_0011319 | 3300048922 | Bacteria | 7407 |
| 375 | Ga0496119_0013703 | 3300048922 | Bacteria | 6428 |
| 376 | Ga0496120_0001527 | 3300048923 | Bacteria | 27270 |
| 377 | Ga0496120_0027591 | 3300048923 | Bacteria | 3489 |
| 378 | Ga0496120_0042782 | 3300048923 | Unclassified | 2643 |
| 379 | Ga0496121_0119462 | 3300048924 | Bacteria | 1993 |
| 380 | Ga0496123_0023394 | 3300048926 | Bacteria | 4730 |
| 381 | Ga0496124_0071730 | 3300048927 | Bacteria | 2870 |
| 382 | Ga0496124_0076769 | 3300048927 | Bacteria | 2756 |
| 383 | Ga0496125_0000324 | 3300048928 | Bacteria | 92755 |
| 384 | Ga0496125_0012092 | 3300048928 | Bacteria | 8587 |
| 385 | Ga0496125_0069441 | 3300048928 | Bacteria | 2765 |
| 386 | Ga0496125_0211298 | 3300048928 | Bacteria | 1260 |
| 387 | Ga0496126_0023635 | 3300048929 | Bacteria | 5954 |
| 388 | Ga0496126_0041785 | 3300048929 | Bacteria | 4240 |
| 389 | Ga0496126_0281068 | 3300048929 | Bacteria | 1379 |
| 390 | Ga0495682_0114423 | 3300049460 | Bacteria | 967 |
| 391 | Ga0501034_0009151 | 3300049571 | Bacteria | 10393 |
| 392 | Ga0501038_0034426 | 3300049574 | Bacteria | 4453 |
| 393 | Ga0501043_0017579 | 3300049579 | Bacteria | 5607 |
| 394 | Ga0501223_003796 | 3300049663 | Bacteria | 3264 |
| 395 | Ga0501224_000006 | 3300049664 | Bacteria | 149611 |
| 396 | Ga0501233_007846 | 3300049668 | Bacteria | 2042 |
| 397 | Ga0501235_010074 | 3300049669 | Bacteria | 2066 |
| 398 | Ga0501225_0000177 | 3300049705 | Bacteria | 19642 |
| 399 | Ga0501035_0134601 | 3300049822 | Bacteria | 2152 |
| 400 | Ga0501044_0097689 | 3300049823 | Bacteria | 2958 |
| 401 | Ga0501044_0119821 | 3300049823 | Bacteria | 2633 |
| 402 | Ga0501226_000048 | 3300049853 | Bacteria | 53910 |
| 403 | nmdc:mga0qj67_16510_c1 | 3300050509 | Bacteria | 5602 |
| 404 | nmdc:mga08y16_47896_c1 | 3300050511 | Bacteria | 4474 |
| 405 | nmdc:mga08y16_648818_c1 | 3300050511 | Bacteria | 1060 |
| 406 | Ga0500643_040557 | 3300053087 | Bacteria | 1370 |
| 407 | Ga0500583_0146287 | 3300053092 | Bacteria | 1175 |
| 408 | Ga0500583_0319918 | 3300053092 | Bacteria | 756 |
| 409 | Ga0500641_0018418 | 3300053096 | Bacteria | 2627 |
| 410 | Ga0500641_0264420 | 3300053096 | Bacteria | 717 |
| 411 | Ga0500556_0000248 | 3300053104 | Bacteria | 43810 |
| 412 | Ga0500556_0048575 | 3300053104 | Bacteria | 1527 |
| 413 | Ga0500556_0060714 | 3300053104 | Bacteria | 1392 |
| 414 | Ga0500592_000395 | 3300053116 | Bacteria | 7317 |
| 415 | Ga0500594_0131775 | 3300053118 | Bacteria | 792 |
| 416 | Ga0500614_131634 | 3300053123 | Bacteria | 743 |
| 417 | Ga0500617_037042 | 3300053124 | Bacteria | 2183 |
| 418 | Ga0500658_0043617 | 3300053134 | Bacteria | 1806 |
| 419 | Ga0500568_0008339 | 3300053139 | Bacteria | 5006 |
| 420 | Ga0500568_0116962 | 3300053139 | Bacteria | 995 |
| 421 | Ga0500568_0188873 | 3300053139 | Bacteria | 756 |
| 422 | Ga0500588_0011761 | 3300053146 | Bacteria | 2151 |
| 423 | Ga0500589_145958 | 3300053147 | Bacteria | 969 |
| 424 | Ga0500616_0000042 | 3300053153 | Bacteria | 351293 |
| 425 | Ga0500616_0063981 | 3300053153 | Bacteria | 1895 |
| 426 | Ga0500627_0000054 | 3300053158 | Bacteria | 55229 |
| 427 | Ga0500630_232622 | 3300053159 | Bacteria | 676 |
| 428 | Ga0500639_075042 | 3300053163 | Bacteria | 1714 |
| 429 | Ga0500637_0001266 | 3300053178 | Bacteria | 10570 |
| 430 | Ga0501084_0153240 | 3300054114 | Bacteria | 1943 |
| 431 | Ga0466962_0006794 | 3300061719 | Bacteria | 5490 |
| 432 | Ga0466962_0022587 | 3300061719 | Bacteria | 3023 |
| 433 | Ga0466962_0386895 | 3300061719 | Bacteria | 699 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10194190 | Ga0105238_101941902 | 160 |
| 2 | 3300026116 | Ga0207674_10027840 | Ga0207674_100278405 | 160 |
| 3 | 3300039447 | Ga0436361_1002072 | Ga0436361_1002072_263_850 | 163 |
| 4 | 3300005616 | Ga0068852_101739922 | Ga0068852_1017399221 | 164 |
| 5 | 3300003791 | Ga0055530_10037304 | Ga0055530_100373042 | 165 |
| 6 | 3300025298 | Ga0209050_1000822 | Ga0209050_100082215 | 165 |
| 7 | 3300013306 | Ga0163162_10032619 | Ga0163162_100326192 | 168 |
| 8 | 3300013307 | Ga0157372_10024184 | Ga0157372_1002418412 | 168 |
| 9 | 3300039437 | Ga0436365_0114693 | Ga0436365_0114693_524_1042 | 168 |
| 10 | 3300039450 | Ga0436363_0951177 | Ga0436363_0951177_9233_9751 | 168 |
| 11 | 3300048903 | Ga0496100_0683581 | Ga0496100_0683581_200_757 | 168 |
| 12 | 3300048906 | Ga0496103_0651608 | Ga0496103_0651608_38_595 | 168 |
| 13 | 3300048907 | Ga0496104_0190690 | Ga0496104_0190690_1209_1766 | 168 |
| 14 | 3300003794 | Ga0055531_10009084 | Ga0055531_100090843 | 169 |
| 15 | 3300009101 | Ga0105247_10061019 | Ga0105247_100610193 | 169 |
| 16 | 3300009174 | Ga0105241_10276114 | Ga0105241_102761143 | 169 |
| 17 | 3300009177 | Ga0105248_10802666 | Ga0105248_108026662 | 169 |
| 18 | 3300009545 | Ga0105237_10114676 | Ga0105237_101146762 | 169 |
| 19 | 3300009553 | Ga0105249_10199886 | Ga0105249_101998862 | 169 |
| 20 | 3300013296 | Ga0157374_10417748 | Ga0157374_104177482 | 169 |
| 21 | 3300013306 | Ga0163162_11454394 | Ga0163162_114543942 | 169 |
| 22 | 3300025304 | Ga0209257_1000487 | Ga0209257_100048722 | 169 |
| 23 | 3300035112 | Ga0373932_0050715 | Ga0373932_0050715_345_863 | 169 |
| 24 | 3300046660 | Ga0495625_0246195 | Ga0495625_0246195_120_737 | 169 |
| 25 | 3300048928 | Ga0496125_0000324 | Ga0496125_0000324_55139_55663 | 169 |
| 26 | 3300048929 | Ga0496126_0023635 | Ga0496126_0023635_2522_3046 | 169 |
| 27 | 3300044684 | Ga0466966_0004429 | Ga0466966_0004429_1221_1742 | 170 |
| 28 | 3300044693 | Ga0466961_0052411 | Ga0466961_0052411_530_1051 | 170 |
| 29 | 3300045049 | Ga0466959_0464398 | Ga0466959_0464398_320_841 | 170 |
| 30 | 3300046660 | Ga0495625_0000652 | Ga0495625_0000652_16084_16707 | 170 |
| 31 | iso_pu_bacteria | 2643221605 | 2644039479 | 170 |
| 32 | 3300009093 | Ga0105240_10009404 | Ga0105240_1000940412 | 171 |
| 33 | 3300009176 | Ga0105242_10581905 | Ga0105242_105819052 | 171 |
| 34 | 3300009551 | Ga0105238_10358245 | Ga0105238_103582452 | 171 |
| 35 | 3300009553 | Ga0105249_10116139 | Ga0105249_101161393 | 171 |
| 36 | 3300013308 | Ga0157375_10576043 | Ga0157375_105760432 | 171 |
| 37 | 3300014968 | Ga0157379_10347294 | Ga0157379_103472942 | 171 |
| 38 | 3300014969 | Ga0157376_10155784 | Ga0157376_101557842 | 171 |
| 39 | 3300014969 | Ga0157376_10561206 | Ga0157376_105612062 | 171 |
| 40 | 3300041453 | Ga0451797_1364172 | Ga0451797_1364172_56_616 | 171 |
| 41 | 3300048922 | Ga0496119_0001712 | Ga0496119_0001712_6799_7329 | 171 |
| 42 | 3300048922 | Ga0496119_0011319 | Ga0496119_0011319_1663_2193 | 171 |
| 43 | 3300048923 | Ga0496120_0001527 | Ga0496120_0001527_18737_19267 | 171 |
| 44 | 3300048923 | Ga0496120_0042782 | Ga0496120_0042782_679_1209 | 171 |
| 45 | 3300048928 | Ga0496125_0012092 | Ga0496125_0012092_2005_2535 | 171 |
| 46 | 3300049460 | Ga0495682_0114423 | Ga0495682_0114423_194_724 | 171 |
| 47 | 3300053123 | Ga0500614_131634 | Ga0500614_131634_66_596 | 171 |
| 48 | 3300039438 | Ga0436360_0650621 | Ga0436360_0650621_605_1135 | 172 |
| 49 | 3300039450 | Ga0436363_1015046 | Ga0436363_1015046_235_762 | 172 |
| 50 | 3300053104 | Ga0500556_0000248 | Ga0500556_0000248_42081_42635 | 172 |
| 51 | 3300005718 | Ga0068866_10728098 | Ga0068866_107280981 | 173 |
| 52 | 3300009176 | Ga0105242_10330154 | Ga0105242_103301542 | 173 |
| 53 | 3300014325 | Ga0163163_10334076 | Ga0163163_103340762 | 173 |
| 54 | 3300025926 | Ga0207659_10221041 | Ga0207659_102210412 | 173 |
| 55 | 3300026023 | Ga0207677_10452893 | Ga0207677_104528932 | 173 |
| 56 | 3300046473 | Ga0495582_0295206 | Ga0495582_0295206_312_845 | 173 |
| 57 | 3300046526 | Ga0495666_0226517 | Ga0495666_0226517_283_816 | 173 |
| 58 | 3300046529 | Ga0495652_0819501 | Ga0495652_0819501_49_582 | 173 |
| 59 | 3300047315 | Ga0495581_0296900 | Ga0495581_0296900_18_551 | 173 |
| 60 | 3300053087 | Ga0500643_040557 | Ga0500643_040557_162_695 | 173 |
| 61 | iso_pu_bacteria | 2643221563 | 2643835838 | 173 |
| 62 | iso_pu_bacteria | 2643221608 | 2644056764 | 173 |
| 63 | iso_pu_bacteria | 2852653556 | 2852655022 | 173 |
| 64 | 3300005355 | Ga0070671_100133508 | Ga0070671_1001335083 | 174 |
| 65 | 3300005356 | Ga0070674_100107637 | Ga0070674_1001076372 | 174 |
| 66 | 3300005436 | Ga0070713_100332302 | Ga0070713_1003323022 | 174 |
| 67 | 3300005455 | Ga0070663_100117285 | Ga0070663_1001172852 | 174 |
| 68 | 3300005539 | Ga0068853_100086669 | Ga0068853_1000866692 | 174 |
| 69 | 3300005548 | Ga0070665_100161955 | Ga0070665_1001619552 | 174 |
| 70 | 3300005548 | Ga0070665_100254504 | Ga0070665_1002545041 | 174 |
| 71 | 3300005614 | Ga0068856_100171262 | Ga0068856_1001712622 | 174 |
| 72 | 3300005614 | Ga0068856_100535614 | Ga0068856_1005356142 | 174 |
| 73 | 3300005618 | Ga0068864_100249239 | Ga0068864_1002492392 | 174 |
| 74 | 3300005842 | Ga0068858_100072202 | Ga0068858_1000722023 | 174 |
| 75 | 3300005843 | Ga0068860_101341719 | Ga0068860_1013417192 | 174 |
| 76 | 3300006358 | Ga0068871_100135141 | Ga0068871_1001351412 | 174 |
| 77 | 3300009094 | Ga0111539_10291853 | Ga0111539_102918532 | 174 |
| 78 | 3300009094 | Ga0111539_10763053 | Ga0111539_107630531 | 174 |
| 79 | 3300012513 | Ga0157326_1002628 | Ga0157326_10026282 | 174 |
| 80 | 3300013307 | Ga0157372_10002811 | Ga0157372_100028116 | 174 |
| 81 | 3300025904 | Ga0207647_10109662 | Ga0207647_101096622 | 174 |
| 82 | 3300025931 | Ga0207644_10247234 | Ga0207644_102472342 | 174 |
| 83 | 3300025986 | Ga0207658_10128912 | Ga0207658_101289123 | 174 |
| 84 | 3300026035 | Ga0207703_10035384 | Ga0207703_100353843 | 174 |
| 85 | 3300026041 | Ga0207639_10203778 | Ga0207639_102037782 | 174 |
| 86 | 3300026067 | Ga0207678_10064523 | Ga0207678_100645232 | 174 |
| 87 | 3300026078 | Ga0207702_10152031 | Ga0207702_101520312 | 174 |
| 88 | 3300026088 | Ga0207641_10001051 | Ga0207641_1000105122 | 174 |
| 89 | 3300026121 | Ga0207683_10352161 | Ga0207683_103521612 | 174 |
| 90 | 3300027907 | Ga0207428_10063836 | Ga0207428_100638362 | 174 |
| 91 | 3300028379 | Ga0268266_10333118 | Ga0268266_103331182 | 174 |
| 92 | 3300028381 | Ga0268264_10000102 | Ga0268264_10000102102 | 174 |
| 93 | 3300028556 | Ga0265337_1010647 | Ga0265337_10106472 | 174 |
| 94 | 3300028573 | Ga0265334_10038186 | Ga0265334_100381862 | 174 |
| 95 | 3300028800 | Ga0265338_10098414 | Ga0265338_100984142 | 174 |
| 96 | 3300031250 | Ga0265331_10143564 | Ga0265331_101435641 | 174 |
| 97 | 3300037068 | Ga0373925_0922106 | Ga0373925_0922106_162_701 | 174 |
| 98 | 3300044712 | Ga0453684_0000063 | Ga0453684_0000063_376634_377164 | 174 |
| 99 | 3300046559 | Ga0495667_0720382 | Ga0495667_0720382_59_595 | 174 |
| 100 | 3300048918 | Ga0496115_0746960 | Ga0496115_0746960_210_746 | 174 |
| 101 | 3300050511 | nmdc:mga08y16_47896_c1 | nmdc:mga08y16_47896_c1_1296_1835 | 174 |
| 102 | 3300050511 | nmdc:mga08y16_648818_c1 | nmdc:mga08y16_648818_c1_184_729 | 174 |
| 103 | 3300005340 | Ga0070689_100139232 | Ga0070689_1001392322 | 175 |
| 104 | 3300006038 | Ga0075365_10318740 | Ga0075365_103187402 | 175 |
| 105 | 3300006358 | Ga0068871_100715444 | Ga0068871_1007154441 | 175 |
| 106 | 3300013307 | Ga0157372_10024571 | Ga0157372_100245713 | 175 |
| 107 | 3300025936 | Ga0207670_10003322 | Ga0207670_100033222 | 175 |
| 108 | 3300025936 | Ga0207670_10068665 | Ga0207670_100686652 | 175 |
| 109 | 3300028573 | Ga0265334_10045809 | Ga0265334_100458092 | 175 |
| 110 | 3300028800 | Ga0265338_10000356 | Ga0265338_1000035655 | 175 |
| 111 | 3300029957 | Ga0265324_10059029 | Ga0265324_100590292 | 175 |
| 112 | 3300030878 | Ga0265770_1000527 | Ga0265770_10005275 | 175 |
| 113 | 3300030878 | Ga0265770_1014942 | Ga0265770_10149421 | 175 |
| 114 | 3300031090 | Ga0265760_10000709 | Ga0265760_100007096 | 175 |
| 115 | 3300031238 | Ga0265332_10004917 | Ga0265332_100049178 | 175 |
| 116 | 3300031241 | Ga0265325_10001375 | Ga0265325_1000137510 | 175 |
| 117 | 3300031247 | Ga0265340_10140023 | Ga0265340_101400232 | 175 |
| 118 | 3300031249 | Ga0265339_10004601 | Ga0265339_100046018 | 175 |
| 119 | 3300031250 | Ga0265331_10006116 | Ga0265331_100061161 | 175 |
| 120 | 3300031251 | Ga0265327_10003173 | Ga0265327_100031732 | 175 |
| 121 | 3300031344 | Ga0265316_10014203 | Ga0265316_100142034 | 175 |
| 122 | 3300031595 | Ga0265313_10000215 | Ga0265313_100002158 | 175 |
| 123 | 3300031712 | Ga0265342_10014049 | Ga0265342_100140494 | 175 |
| 124 | 3300035115 | Ga0373941_0040823 | Ga0373941_0040823_542_1084 | 175 |
| 125 | 3300035691 | Ga0373931_0259618 | Ga0373931_0259618_232_774 | 175 |
| 126 | 3300036647 | Ga0316582_0050739 | Ga0316582_0050739_1966_2505 | 175 |
| 127 | 3300039447 | Ga0436361_1061351 | Ga0436361_1061351_2425_2967 | 175 |
| 128 | 3300044719 | Ga0466971_0031188 | Ga0466971_0031188_1121_1765 | 175 |
| 129 | 3300044735 | Ga0466968_0043606 | Ga0466968_0043606_84_728 | 175 |
| 130 | 3300044765 | Ga0466970_0132905 | Ga0466970_0132905_707_1351 | 175 |
| 131 | 3300045051 | Ga0451576_0886732 | Ga0451576_0886732_299_841 | 175 |
| 132 | 3300046477 | Ga0495664_0355072 | Ga0495664_0355072_101_640 | 175 |
| 133 | 3300046535 | Ga0495586_0068726 | Ga0495586_0068726_1383_1922 | 175 |
| 134 | 3300046683 | Ga0495658_0172357 | Ga0495658_0172357_663_1202 | 175 |
| 135 | 3300046689 | Ga0495613_0621176 | Ga0495613_0621176_11_550 | 175 |
| 136 | 3300049823 | Ga0501044_0097689 | Ga0501044_0097689_236_775 | 175 |
| 137 | 3300053139 | Ga0500568_0116962 | Ga0500568_0116962_91_633 | 175 |
| 138 | 3300053153 | Ga0500616_0000042 | Ga0500616_0000042_11282_11833 | 175 |
| 139 | 3300054114 | Ga0501084_0153240 | Ga0501084_0153240_103_645 | 175 |
| 140 | 3300061719 | Ga0466962_0022587 | Ga0466962_0022587_1098_1742 | 175 |
| 141 | 3300003322 | rootL2_10043958 | rootL2_100439582 | 176 |
| 142 | 3300005272 | Ga0065703_1023663 | Ga0065703_10236631 | 176 |
| 143 | 3300005327 | Ga0070658_10159494 | Ga0070658_101594943 | 176 |
| 144 | 3300005335 | Ga0070666_10032933 | Ga0070666_100329332 | 176 |
| 145 | 3300005338 | Ga0068868_100094180 | Ga0068868_1000941802 | 176 |
| 146 | 3300005344 | Ga0070661_100757837 | Ga0070661_1007578371 | 176 |
| 147 | 3300005344 | Ga0070661_101131711 | Ga0070661_1011317111 | 176 |
| 148 | 3300005355 | Ga0070671_100016624 | Ga0070671_1000166243 | 176 |
| 149 | 3300005355 | Ga0070671_100504646 | Ga0070671_1005046462 | 176 |
| 150 | 3300005356 | Ga0070674_100832081 | Ga0070674_1008320812 | 176 |
| 151 | 3300005367 | Ga0070667_100017540 | Ga0070667_1000175402 | 176 |
| 152 | 3300005367 | Ga0070667_100033950 | Ga0070667_1000339504 | 176 |
| 153 | 3300005434 | Ga0070709_10091314 | Ga0070709_100913142 | 176 |
| 154 | 3300005436 | Ga0070713_100030365 | Ga0070713_1000303652 | 176 |
| 155 | 3300005437 | Ga0070710_10047610 | Ga0070710_100476102 | 176 |
| 156 | 3300005439 | Ga0070711_100077960 | Ga0070711_1000779602 | 176 |
| 157 | 3300005440 | Ga0070705_100854789 | Ga0070705_1008547891 | 176 |
| 158 | 3300005456 | Ga0070678_100264186 | Ga0070678_1002641862 | 176 |
| 159 | 3300005458 | Ga0070681_10232327 | Ga0070681_102323272 | 176 |
| 160 | 3300005459 | Ga0068867_100113160 | Ga0068867_1001131602 | 176 |
| 161 | 3300005539 | Ga0068853_101155659 | Ga0068853_1011556591 | 176 |
| 162 | 3300005543 | Ga0070672_100418074 | Ga0070672_1004180742 | 176 |
| 163 | 3300005544 | Ga0070686_100137952 | Ga0070686_1001379522 | 176 |
| 164 | 3300005545 | Ga0070695_100246058 | Ga0070695_1002460581 | 176 |
| 165 | 3300005548 | Ga0070665_100004651 | Ga0070665_1000046519 | 176 |
| 166 | 3300005548 | Ga0070665_100016873 | Ga0070665_1000168733 | 176 |
| 167 | 3300005548 | Ga0070665_100128705 | Ga0070665_1001287053 | 176 |
| 168 | 3300005548 | Ga0070665_100239004 | Ga0070665_1002390042 | 176 |
| 169 | 3300005549 | Ga0070704_100726936 | Ga0070704_1007269362 | 176 |
| 170 | 3300005563 | Ga0068855_100086401 | Ga0068855_1000864012 | 176 |
| 171 | 3300005578 | Ga0068854_101198159 | Ga0068854_1011981591 | 176 |
| 172 | 3300005615 | Ga0070702_100224311 | Ga0070702_1002243113 | 176 |
| 173 | 3300005616 | Ga0068852_100445809 | Ga0068852_1004458092 | 176 |
| 174 | 3300005618 | Ga0068864_101443426 | Ga0068864_1014434261 | 176 |
| 175 | 3300005718 | Ga0068866_10005524 | Ga0068866_100055242 | 176 |
| 176 | 3300005719 | Ga0068861_100141959 | Ga0068861_1001419592 | 176 |
| 177 | 3300005834 | Ga0068851_10112024 | Ga0068851_101120242 | 176 |
| 178 | 3300005841 | Ga0068863_100026269 | Ga0068863_1000262692 | 176 |
| 179 | 3300005842 | Ga0068858_100007974 | Ga0068858_1000079742 | 176 |
| 180 | 3300005842 | Ga0068858_100919485 | Ga0068858_1009194852 | 176 |
| 181 | 3300005842 | Ga0068858_101202277 | Ga0068858_1012022771 | 176 |
| 182 | 3300005843 | Ga0068860_100103586 | Ga0068860_1001035862 | 176 |
| 183 | 3300005844 | Ga0068862_100124111 | Ga0068862_1001241112 | 176 |
| 184 | 3300005844 | Ga0068862_101195058 | Ga0068862_1011950582 | 176 |
| 185 | 3300005937 | Ga0081455_10000192 | Ga0081455_1000019246 | 176 |
| 186 | 3300005937 | Ga0081455_10256268 | Ga0081455_102562682 | 176 |
| 187 | 3300006163 | Ga0070715_10004901 | Ga0070715_100049012 | 176 |
| 188 | 3300006173 | Ga0070716_100007651 | Ga0070716_1000076512 | 176 |
| 189 | 3300006173 | Ga0070716_100227401 | Ga0070716_1002274012 | 176 |
| 190 | 3300006173 | Ga0070716_100504869 | Ga0070716_1005048692 | 176 |
| 191 | 3300006175 | Ga0070712_100222347 | Ga0070712_1002223472 | 176 |
| 192 | 3300006175 | Ga0070712_100880829 | Ga0070712_1008808291 | 176 |
| 193 | 3300006237 | Ga0097621_100018904 | Ga0097621_1000189042 | 176 |
| 194 | 3300006358 | Ga0068871_100066860 | Ga0068871_1000668602 | 176 |
| 195 | 3300006871 | Ga0075434_101086810 | Ga0075434_1010868101 | 176 |
| 196 | 3300006881 | Ga0068865_100086529 | Ga0068865_1000865292 | 176 |
| 197 | 3300009098 | Ga0105245_10120438 | Ga0105245_101204382 | 176 |
| 198 | 3300009098 | Ga0105245_10328770 | Ga0105245_103287702 | 176 |
| 199 | 3300009174 | Ga0105241_10444229 | Ga0105241_104442292 | 176 |
| 200 | 3300009176 | Ga0105242_10000748 | Ga0105242_100007483 | 176 |
| 201 | 3300009177 | Ga0105248_10008783 | Ga0105248_100087836 | 176 |
| 202 | 3300009545 | Ga0105237_10053793 | Ga0105237_100537932 | 176 |
| 203 | 3300009551 | Ga0105238_10176397 | Ga0105238_101763972 | 176 |
| 204 | 3300010375 | Ga0105239_10398332 | Ga0105239_103983322 | 176 |
| 205 | 3300013296 | Ga0157374_10001676 | Ga0157374_1000167612 | 176 |
| 206 | 3300013297 | Ga0157378_10003178 | Ga0157378_100031786 | 176 |
| 207 | 3300013297 | Ga0157378_10451047 | Ga0157378_104510472 | 176 |
| 208 | 3300013307 | Ga0157372_10039230 | Ga0157372_100392303 | 176 |
| 209 | 3300013308 | Ga0157375_10132411 | Ga0157375_101324112 | 176 |
| 210 | 3300014325 | Ga0163163_12116865 | Ga0163163_121168651 | 176 |
| 211 | 3300014968 | Ga0157379_10083066 | Ga0157379_100830662 | 176 |
| 212 | 3300014968 | Ga0157379_10212263 | Ga0157379_102122632 | 176 |
| 213 | 3300021377 | Ga0213874_10002426 | Ga0213874_100024262 | 176 |
| 214 | 3300021384 | Ga0213876_10074196 | Ga0213876_100741962 | 176 |
| 215 | 3300025321 | Ga0207656_10069283 | Ga0207656_100692831 | 176 |
| 216 | 3300025898 | Ga0207692_10027207 | Ga0207692_100272072 | 176 |
| 217 | 3300025903 | Ga0207680_10467379 | Ga0207680_104673792 | 176 |
| 218 | 3300025905 | Ga0207685_10002232 | Ga0207685_100022322 | 176 |
| 219 | 3300025906 | Ga0207699_10822433 | Ga0207699_108224331 | 176 |
| 220 | 3300025909 | Ga0207705_10414318 | Ga0207705_104143182 | 176 |
| 221 | 3300025911 | Ga0207654_10541977 | Ga0207654_105419771 | 176 |
| 222 | 3300025912 | Ga0207707_10017766 | Ga0207707_100177662 | 176 |
| 223 | 3300025913 | Ga0207695_10027047 | Ga0207695_100270473 | 176 |
| 224 | 3300025913 | Ga0207695_10122541 | Ga0207695_101225413 | 176 |
| 225 | 3300025914 | Ga0207671_10143978 | Ga0207671_101439782 | 176 |
| 226 | 3300025914 | Ga0207671_10339979 | Ga0207671_103399792 | 176 |
| 227 | 3300025915 | Ga0207693_10001300 | Ga0207693_1000130021 | 176 |
| 228 | 3300025915 | Ga0207693_10704953 | Ga0207693_107049531 | 176 |
| 229 | 3300025916 | Ga0207663_10129186 | Ga0207663_101291862 | 176 |
| 230 | 3300025920 | Ga0207649_10710965 | Ga0207649_107109651 | 176 |
| 231 | 3300025921 | Ga0207652_10190705 | Ga0207652_101907052 | 176 |
| 232 | 3300025924 | Ga0207694_10257307 | Ga0207694_102573072 | 176 |
| 233 | 3300025928 | Ga0207700_10028195 | Ga0207700_100281954 | 176 |
| 234 | 3300025931 | Ga0207644_10532257 | Ga0207644_105322571 | 176 |
| 235 | 3300025934 | Ga0207686_10403057 | Ga0207686_104030572 | 176 |
| 236 | 3300025939 | Ga0207665_10000795 | Ga0207665_100007954 | 176 |
| 237 | 3300025939 | Ga0207665_10091896 | Ga0207665_100918962 | 176 |
| 238 | 3300025941 | Ga0207711_10104669 | Ga0207711_101046692 | 176 |
| 239 | 3300025944 | Ga0207661_10147348 | Ga0207661_101473482 | 176 |
| 240 | 3300025944 | Ga0207661_10171992 | Ga0207661_101719922 | 176 |
| 241 | 3300025949 | Ga0207667_10317890 | Ga0207667_103178902 | 176 |
| 242 | 3300025949 | Ga0207667_11228247 | Ga0207667_112282472 | 176 |
| 243 | 3300025960 | Ga0207651_10666322 | Ga0207651_106663222 | 176 |
| 244 | 3300025961 | Ga0207712_10347573 | Ga0207712_103475731 | 176 |
| 245 | 3300025961 | Ga0207712_10368553 | Ga0207712_103685532 | 176 |
| 246 | 3300025961 | Ga0207712_10448338 | Ga0207712_104483382 | 176 |
| 247 | 3300026035 | Ga0207703_10195520 | Ga0207703_101955202 | 176 |
| 248 | 3300026035 | Ga0207703_11405395 | Ga0207703_114053951 | 176 |
| 249 | 3300026088 | Ga0207641_10088780 | Ga0207641_100887802 | 176 |
| 250 | 3300026089 | Ga0207648_10325984 | Ga0207648_103259842 | 176 |
| 251 | 3300026118 | Ga0207675_100030282 | Ga0207675_1000302824 | 176 |
| 252 | 3300026118 | Ga0207675_100182176 | Ga0207675_1001821762 | 176 |
| 253 | 3300026121 | Ga0207683_10002715 | Ga0207683_100027153 | 176 |
| 254 | 3300028379 | Ga0268266_10006042 | Ga0268266_100060422 | 176 |
| 255 | 3300028379 | Ga0268266_10098467 | Ga0268266_100984673 | 176 |
| 256 | 3300028379 | Ga0268266_10165965 | Ga0268266_101659652 | 176 |
| 257 | 3300028379 | Ga0268266_10310897 | Ga0268266_103108971 | 176 |
| 258 | 3300028380 | Ga0268265_10027152 | Ga0268265_100271524 | 176 |
| 259 | 3300028380 | Ga0268265_10091484 | Ga0268265_100914842 | 176 |
| 260 | 3300028381 | Ga0268264_10011159 | Ga0268264_100111592 | 176 |
| 261 | 3300028794 | Ga0307515_10322375 | Ga0307515_103223752 | 176 |
| 262 | 3300028800 | Ga0265338_10535443 | Ga0265338_105354431 | 176 |
| 263 | 3300030521 | Ga0307511_10000165 | Ga0307511_1000016521 | 176 |
| 264 | 3300030521 | Ga0307511_10005693 | Ga0307511_100056935 | 176 |
| 265 | 3300031249 | Ga0265339_10115303 | Ga0265339_101153031 | 176 |
| 266 | 3300031507 | Ga0307509_10000005 | Ga0307509_10000005339 | 176 |
| 267 | 3300031901 | Ga0307406_10710436 | Ga0307406_107104361 | 176 |
| 268 | 3300035113 | Ga0373936_0053896 | Ga0373936_0053896_864_1406 | 176 |
| 269 | 3300035113 | Ga0373936_0201078 | Ga0373936_0201078_199_741 | 176 |
| 270 | 3300035118 | Ga0373954_0024416 | Ga0373954_0024416_1260_1808 | 176 |
| 271 | 3300035120 | Ga0373957_0115703 | Ga0373957_0115703_367_915 | 176 |
| 272 | 3300035171 | Ga0373946_0015993 | Ga0373946_0015993_1347_1895 | 176 |
| 273 | 3300035695 | Ga0373927_0635686 | Ga0373927_0635686_49_591 | 176 |
| 274 | 3300037068 | Ga0373925_0086535 | Ga0373925_0086535_1247_1795 | 176 |
| 275 | 3300037471 | Ga0395905_0911834 | Ga0395905_0911834_229_771 | 176 |
| 276 | 3300037853 | Ga0436364_0123985 | Ga0436364_0123985_1164_1709 | 176 |
| 277 | 3300039437 | Ga0436365_0027294 | Ga0436365_0027294_2514_3065 | 176 |
| 278 | 3300039438 | Ga0436360_0683286 | Ga0436360_0683286_540_1082 | 176 |
| 279 | 3300039447 | Ga0436361_0094519 | Ga0436361_0094519_276_863 | 176 |
| 280 | 3300039447 | Ga0436361_0445108 | Ga0436361_0445108_697_1236 | 176 |
| 281 | 3300039450 | Ga0436363_0423907 | Ga0436363_0423907_351_902 | 176 |
| 282 | 3300039450 | Ga0436363_0928702 | Ga0436363_0928702_337_891 | 176 |
| 283 | 3300042876 | Ga0451577_0548557 | Ga0451577_0548557_121_666 | 176 |
| 284 | 3300045051 | Ga0451576_0051413 | Ga0451576_0051413_2851_3396 | 176 |
| 285 | 3300046453 | Ga0495627_000078 | Ga0495627_000078_36530_37087 | 176 |
| 286 | 3300046460 | Ga0495638_0102125 | Ga0495638_0102125_30_584 | 176 |
| 287 | 3300046472 | Ga0495580_0002363 | Ga0495580_0002363_10942_11490 | 176 |
| 288 | 3300046472 | Ga0495580_0034578 | Ga0495580_0034578_2808_3356 | 176 |
| 289 | 3300046517 | Ga0495630_0023715 | Ga0495630_0023715_1491_2039 | 176 |
| 290 | 3300046522 | Ga0495643_0061147 | Ga0495643_0061147_740_1282 | 176 |
| 291 | 3300046524 | Ga0495648_0094382 | Ga0495648_0094382_636_1193 | 176 |
| 292 | 3300046543 | Ga0495645_0128845 | Ga0495645_0128845_973_1521 | 176 |
| 293 | 3300046558 | Ga0495633_0096643 | Ga0495633_0096643_130_687 | 176 |
| 294 | 3300046684 | Ga0495669_0045943 | Ga0495669_0045943_1222_1773 | 176 |
| 295 | 3300046689 | Ga0495613_0266663 | Ga0495613_0266663_253_801 | 176 |
| 296 | 3300046692 | Ga0495671_0053953 | Ga0495671_0053953_39_584 | 176 |
| 297 | 3300047319 | Ga0495674_0146025 | Ga0495674_0146025_79_627 | 176 |
| 298 | 3300047469 | Ga0495673_0019778 | Ga0495673_0019778_453_1010 | 176 |
| 299 | 3300048904 | Ga0496101_0002111 | Ga0496101_0002111_8465_9013 | 176 |
| 300 | 3300048906 | Ga0496103_0015553 | Ga0496103_0015553_561_1106 | 176 |
| 301 | 3300048906 | Ga0496103_0750989 | Ga0496103_0750989_57_605 | 176 |
| 302 | 3300048907 | Ga0496104_0318017 | Ga0496104_0318017_312_860 | 176 |
| 303 | 3300048910 | Ga0496107_0019177 | Ga0496107_0019177_448_996 | 176 |
| 304 | 3300048912 | Ga0496109_0056732 | Ga0496109_0056732_1058_1606 | 176 |
| 305 | 3300048913 | Ga0496110_0078126 | Ga0496110_0078126_296_844 | 176 |
| 306 | 3300048914 | Ga0496111_0028030 | Ga0496111_0028030_1019_1567 | 176 |
| 307 | 3300048915 | Ga0496112_0365550 | Ga0496112_0365550_65_613 | 176 |
| 308 | 3300048917 | Ga0496114_0011053 | Ga0496114_0011053_6045_6593 | 176 |
| 309 | 3300048918 | Ga0496115_0023032 | Ga0496115_0023032_901_1449 | 176 |
| 310 | 3300048919 | Ga0496116_0002812 | Ga0496116_0002812_11172_11717 | 176 |
| 311 | 3300048920 | Ga0496117_0001472 | Ga0496117_0001472_27977_28522 | 176 |
| 312 | 3300048921 | Ga0496118_0000032 | Ga0496118_0000032_324272_324817 | 176 |
| 313 | 3300048924 | Ga0496121_0119462 | Ga0496121_0119462_597_1142 | 176 |
| 314 | 3300048927 | Ga0496124_0076769 | Ga0496124_0076769_1650_2195 | 176 |
| 315 | 3300053092 | Ga0500583_0146287 | Ga0500583_0146287_366_911 | 176 |
| 316 | 3300053092 | Ga0500583_0319918 | Ga0500583_0319918_99_653 | 176 |
| 317 | 3300053096 | Ga0500641_0018418 | Ga0500641_0018418_1513_2058 | 176 |
| 318 | 3300053096 | Ga0500641_0264420 | Ga0500641_0264420_62_616 | 176 |
| 319 | 3300053104 | Ga0500556_0048575 | Ga0500556_0048575_450_995 | 176 |
| 320 | 3300053104 | Ga0500556_0060714 | Ga0500556_0060714_764_1309 | 176 |
| 321 | 3300053124 | Ga0500617_037042 | Ga0500617_037042_419_964 | 176 |
| 322 | 3300053134 | Ga0500658_0043617 | Ga0500658_0043617_954_1499 | 176 |
| 323 | 3300053139 | Ga0500568_0188873 | Ga0500568_0188873_126_680 | 176 |
| 324 | 3300053146 | Ga0500588_0011761 | Ga0500588_0011761_1264_1809 | 176 |
| 325 | 3300053147 | Ga0500589_145958 | Ga0500589_145958_198_743 | 176 |
| 326 | 3300053153 | Ga0500616_0063981 | Ga0500616_0063981_195_749 | 176 |
| 327 | 3300053159 | Ga0500630_232622 | Ga0500630_232622_114_656 | 176 |
| 328 | 3300053163 | Ga0500639_075042 | Ga0500639_075042_387_929 | 176 |
| 329 | 3300053178 | Ga0500637_0001266 | Ga0500637_0001266_9096_9638 | 176 |
| 330 | 3300003187 | JGI25151J46595_10090150 | JGI25151J46595_100901501 | 177 |
| 331 | 3300003781 | Ga0055536_1001904 | Ga0055536_10019045 | 177 |
| 332 | 3300003781 | Ga0055536_1003233 | Ga0055536_10032338 | 177 |
| 333 | 3300003781 | Ga0055536_1009211 | Ga0055536_10092116 | 177 |
| 334 | 3300003784 | Ga0055534_1014513 | Ga0055534_10145132 | 177 |
| 335 | 3300003791 | Ga0055530_10000013 | Ga0055530_10000013107 | 177 |
| 336 | 3300003794 | Ga0055531_10000627 | Ga0055531_1000062722 | 177 |
| 337 | 3300025291 | Ga0209675_1000808 | Ga0209675_100080818 | 177 |
| 338 | 3300025292 | Ga0209676_1000221 | Ga0209676_1000221105 | 177 |
| 339 | 3300025292 | Ga0209676_1000453 | Ga0209676_100045334 | 177 |
| 340 | 3300025292 | Ga0209676_1001788 | Ga0209676_100178810 | 177 |
| 341 | 3300025294 | Ga0209025_1008523 | Ga0209025_10085234 | 177 |
| 342 | 3300025294 | Ga0209025_1062868 | Ga0209025_10628682 | 177 |
| 343 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042282 | 177 |
| 344 | 3300025298 | Ga0209050_1026115 | Ga0209050_10261152 | 177 |
| 345 | 3300025304 | Ga0209257_1000135 | Ga0209257_1000135105 | 177 |
| 346 | 3300031911 | Ga0307412_10031801 | Ga0307412_100318013 | 177 |
| 347 | 3300031911 | Ga0307412_10248443 | Ga0307412_102484432 | 177 |
| 348 | 3300032004 | Ga0307414_10005170 | Ga0307414_100051705 | 177 |
| 349 | 3300032004 | Ga0307414_10051855 | Ga0307414_100518551 | 177 |
| 350 | 3300032004 | Ga0307414_10106918 | Ga0307414_101069182 | 177 |
| 351 | 3300032004 | Ga0307414_10226598 | Ga0307414_102265982 | 177 |
| 352 | 3300033180 | Ga0307510_10131016 | Ga0307510_101310163 | 177 |
| 353 | 3300039438 | Ga0436360_0781012 | Ga0436360_0781012_249_842 | 177 |
| 354 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_93051_93611 | 177 |
| 355 | 3300048927 | Ga0496124_0071730 | Ga0496124_0071730_62_613 | 177 |
| 356 | 3300048928 | Ga0496125_0211298 | Ga0496125_0211298_22_582 | 177 |
| 357 | 3300049574 | Ga0501038_0034426 | Ga0501038_0034426_1214_1789 | 177 |
| 358 | 3300049579 | Ga0501043_0017579 | Ga0501043_0017579_2156_2731 | 177 |
| 359 | 3300049822 | Ga0501035_0134601 | Ga0501035_0134601_161_736 | 177 |
| 360 | 3300049823 | Ga0501044_0119821 | Ga0501044_0119821_810_1385 | 177 |
| 361 | 3300053118 | Ga0500594_0131775 | Ga0500594_0131775_122_685 | 177 |
| 362 | 3300053139 | Ga0500568_0008339 | Ga0500568_0008339_2136_2696 | 177 |
| 363 | 3300003203 | JGI25406J46586_10160383 | JGI25406J46586_101603831 | 178 |
| 364 | 3300005841 | Ga0068863_100043924 | Ga0068863_1000439245 | 178 |
| 365 | 3300005843 | Ga0068860_100001431 | Ga0068860_10000143110 | 178 |
| 366 | 3300005844 | Ga0068862_100000331 | Ga0068862_10000033112 | 178 |
| 367 | 3300005985 | Ga0081539_10005075 | Ga0081539_100050755 | 178 |
| 368 | 3300006846 | Ga0075430_100023719 | Ga0075430_1000237196 | 178 |
| 369 | 3300009553 | Ga0105249_10000127 | Ga0105249_1000012719 | 178 |
| 370 | 3300025900 | Ga0207710_10004351 | Ga0207710_100043515 | 178 |
| 371 | 3300025961 | Ga0207712_10000150 | Ga0207712_1000015052 | 178 |
| 372 | 3300026088 | Ga0207641_10221287 | Ga0207641_102212873 | 178 |
| 373 | 3300028380 | Ga0268265_10001409 | Ga0268265_1000140910 | 178 |
| 374 | 3300028381 | Ga0268264_10000504 | Ga0268264_1000050413 | 178 |
| 375 | 3300046530 | Ga0495654_0199792 | Ga0495654_0199792_112_675 | 178 |
| 376 | 3300047470 | Ga0495681_0138668 | Ga0495681_0138668_147_710 | 178 |
| 377 | 3300048920 | Ga0496117_0027981 | Ga0496117_0027981_1821_2357 | 178 |
| 378 | 3300048920 | Ga0496117_0084881 | Ga0496117_0084881_465_1001 | 178 |
| 379 | 3300048921 | Ga0496118_0017435 | Ga0496118_0017435_2691_3227 | 178 |
| 380 | 3300048921 | Ga0496118_0030739 | Ga0496118_0030739_3013_3549 | 178 |
| 381 | 3300048922 | Ga0496119_0013703 | Ga0496119_0013703_3117_3653 | 178 |
| 382 | 3300048923 | Ga0496120_0027591 | Ga0496120_0027591_828_1364 | 178 |
| 383 | 3300048926 | Ga0496123_0023394 | Ga0496123_0023394_2179_2715 | 178 |
| 384 | 3300048928 | Ga0496125_0069441 | Ga0496125_0069441_980_1516 | 178 |
| 385 | 3300048929 | Ga0496126_0041785 | Ga0496126_0041785_2615_3151 | 178 |
| 386 | 3300048929 | Ga0496126_0281068 | Ga0496126_0281068_50_586 | 178 |
| 387 | 3300050509 | nmdc:mga0qj67_16510_c1 | nmdc:mga0qj67_16510_c1_3531_4109 | 178 |
| 388 | 3300053116 | Ga0500592_000395 | Ga0500592_000395_5745_6308 | 178 |
| 389 | 3300053158 | Ga0500627_0000054 | Ga0500627_0000054_54243_54806 | 178 |
| 390 | 3300025933 | Ga0207706_10242875 | Ga0207706_102428752 | 179 |
| 391 | 3300031548 | Ga0307408_100426972 | Ga0307408_1004269721 | 179 |
| 392 | 3300031911 | Ga0307412_10004515 | Ga0307412_100045153 | 179 |
| 393 | 3300032002 | Ga0307416_100140489 | Ga0307416_1001404892 | 179 |
| 394 | 3300032004 | Ga0307414_10007589 | Ga0307414_100075896 | 179 |
| 395 | 3300037853 | Ga0436364_1297790 | Ga0436364_1297790_309_881 | 179 |
| 396 | 3300049571 | Ga0501034_0009151 | Ga0501034_0009151_3533_4090 | 179 |
| 397 | 3300049663 | Ga0501223_003796 | Ga0501223_003796_1182_1721 | 179 |
| 398 | 3300049664 | Ga0501224_000006 | Ga0501224_000006_60858_61397 | 179 |
| 399 | 3300049668 | Ga0501233_007846 | Ga0501233_007846_506_1045 | 179 |
| 400 | 3300049669 | Ga0501235_010074 | Ga0501235_010074_1376_1915 | 179 |
| 401 | 3300049705 | Ga0501225_0000177 | Ga0501225_0000177_6823_7362 | 179 |
| 402 | 3300049853 | Ga0501226_000048 | Ga0501226_000048_40056_40595 | 179 |
| 403 | 3300001990 | JGI24737J22298_10012581 | JGI24737J22298_100125812 | 180 |
| 404 | 3300002067 | JGI24735J21928_10019252 | JGI24735J21928_100192522 | 180 |
| 405 | 3300002075 | JGI24738J21930_10005044 | JGI24738J21930_100050442 | 180 |
| 406 | 3300003762 | Ga0055542_1005864 | Ga0055542_10058642 | 180 |
| 407 | 3300005457 | Ga0070662_100437498 | Ga0070662_1004374982 | 180 |
| 408 | 3300005539 | Ga0068853_100027582 | Ga0068853_1000275828 | 180 |
| 409 | 3300005614 | Ga0068856_100017668 | Ga0068856_1000176684 | 180 |
| 410 | 3300005616 | Ga0068852_100000043 | Ga0068852_10000004331 | 180 |
| 411 | 3300005616 | Ga0068852_100353237 | Ga0068852_1003532372 | 180 |
| 412 | 3300013102 | Ga0157371_10404094 | Ga0157371_104040942 | 180 |
| 413 | 3300013307 | Ga0157372_10028716 | Ga0157372_100287164 | 180 |
| 414 | 3300013307 | Ga0157372_10750732 | Ga0157372_107507322 | 180 |
| 415 | 3300025254 | Ga0209148_1000074 | Ga0209148_1000074212 | 180 |
| 416 | 3300025904 | Ga0207647_10000756 | Ga0207647_100007566 | 180 |
| 417 | 3300025933 | Ga0207706_10029402 | Ga0207706_100294023 | 180 |
| 418 | 3300026078 | Ga0207702_10024793 | Ga0207702_100247937 | 180 |
| 419 | 3300026116 | Ga0207674_11061223 | Ga0207674_110612232 | 180 |
| 420 | 3300026142 | Ga0207698_10030305 | Ga0207698_100303053 | 180 |
| 421 | 3300037471 | Ga0395905_0012524 | Ga0395905_0012524_3101_3643 | 180 |
| 422 | 3300039437 | Ga0436365_0240348 | Ga0436365_0240348_464_1015 | 180 |
| 423 | 3300042005 | Ga0439448_0001045 | Ga0439448_0001045_5832_6374 | 180 |
| 424 | 3300042012 | Ga0439455_0000109 | Ga0439455_0000109_2327_2869 | 180 |
| 425 | 3300042157 | Ga0439458_0000632 | Ga0439458_0000632_4146_4688 | 180 |
| 426 | 3300044658 | Ga0466972_0004177 | Ga0466972_0004177_84_626 | 180 |
| 427 | 3300044683 | Ga0466965_0039252 | Ga0466965_0039252_1683_2291 | 180 |
| 428 | 3300044693 | Ga0466961_0009863 | Ga0466961_0009863_5469_6011 | 180 |
| 429 | 3300044694 | Ga0466963_0005703 | Ga0466963_0005703_6258_6803 | 180 |
| 430 | 3300044706 | Ga0466964_0065288 | Ga0466964_0065288_360_902 | 180 |
| 431 | 3300044735 | Ga0466968_0104968 | Ga0466968_0104968_84_626 | 180 |
| 432 | 3300045049 | Ga0466959_0117667 | Ga0466959_0117667_60_602 | 180 |
| 433 | 3300045836 | Ga0466958_0004385 | Ga0466958_0004385_4906_5451 | 180 |
| 434 | 3300045836 | Ga0466958_0680835 | Ga0466958_0680835_47_589 | 180 |
| 435 | 3300045976 | Ga0466967_0002129 | Ga0466967_0002129_9290_9835 | 180 |
| 436 | 3300061719 | Ga0466962_0006794 | Ga0466962_0006794_3597_4142 | 180 |
| 437 | 3300061719 | Ga0466962_0386895 | Ga0466962_0386895_25_633 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3drn-assembly2.cif.gz_B | the crystal structure of bcp1 from sulfolobus sulfataricus | 0.8975 | 23 | 177 |
| 3drn-assembly2.cif.gz_B | the crystal structure of bcp1 from sulfolobus sulfataricus | 0.8919 | 23 | 177 |
| 4xs4-assembly1.cif.gz_B-2 | salmonella typhimurium ahpc c165s mutant | 0.8826 | 25 | 177 |
| 4xih-assembly1.cif.gz_B-2 | crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis | 0.8817 | 22 | 172 |
| 3sbc-assembly1.cif.gz_E | crystal structure of saccharomyces cerevisiae tsa1c47s mutant protein | 0.8804 | 24 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54W30_4_152_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9118 | 23 | 175 | 3.40.30.10 |
| af_Q559T9_1_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9082 | 23 | 173 | 3.40.30.10 |
| af_Q54W30_4_152_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9003 | 23 | 175 | 3.40.30.10 |
| af_I1MS47_66_213_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8986 | 23 | 172 | 3.40.30.10 |
| 3drnB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8975 | 23 | 177 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A1H638-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9768 | 22 | 178 |
GO:0005737
GO:0008379 GO:0009579 GO:0034599 GO:0045454 |
| AF-A0A534AC98-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9688 | 46 | 180 |
GO:0005737
GO:0008379 GO:0009579 GO:0034599 GO:0045454 |
| AF-A0A534AC98-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.955 | 46 | 180 |
GO:0005737
GO:0008379 GO:0009579 GO:0034599 GO:0045454 |
| AF-A0A3D0W881-F1-model_v4 | 3-demethylubiquinone-9 3-O-methyltransferase | 0.9474 | 23 | 175 |
GO:0010420
GO:0016209 GO:0016491 GO:0032259 GO:0061542 |
| AF-A0A511XPW8-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9441 | 38 | 179 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar