F443833

General Info

Members Datasets Scaffolds Average Seq Length
437 276 433 182

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0031188|Ga0466971_0031188_1121_1765
Length 214
Sequence MGVLAAASALTDDVAPGAVRCLDGLTPTSIRRGFMRRSTTFMLAAMLASVPVLAALPDGSKAPDINTEASLAGKTFKFSLADALKKGPVVLYFYPAAFTPGCTVEAHEFAEATPKFKELGATVIGVSHDPIDKLQKFSVSECRNKFAVASDGDGSIMKAYDAVLAAKPEYANRTSYVIAPSGEVIYSYTDLNPGKHVENTMSAVKKWQDEHKKS

Samples

Sample ID Description Type Environment
1 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
2 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
249 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
250 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
251 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
252 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
262 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
265 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
269 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
272 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
273 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
274 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0.69
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.76
Nodule 0
Rhizoplane 3.66
Rhizosphere 75.51
Stem 0
Stem Tuber 0
Unclassified 10.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10012581 3300001990 Bacteria 2758
2 JGI24735J21928_10019252 3300002067 Bacteria 2099
3 JGI24738J21930_10005044 3300002075 Bacteria 3191
4 JGI25151J46595_10090150 3300003187 Bacteria 856
5 JGI25406J46586_10160383 3300003203 Bacteria 656
6 rootL2_10043958 3300003322 Bacteria 3032
7 Ga0055542_1005864 3300003762 Bacteria 2698
8 Ga0055536_1001904 3300003781 Bacteria 12099
9 Ga0055536_1003233 3300003781 Bacteria 8830
10 Ga0055536_1009211 3300003781 Bacteria 4120
11 Ga0055534_1014513 3300003784 Bacteria 1472
12 Ga0055530_10000013 3300003791 Bacteria 153390
13 Ga0055530_10037304 3300003791 Bacteria 1217
14 Ga0055531_10000627 3300003794 Bacteria 30500
15 Ga0055531_10009084 3300003794 Bacteria 5127
16 Ga0065703_1023663 3300005272 Bacteria 684
17 Ga0070658_10159494 3300005327 Bacteria 1892
18 Ga0070666_10032933 3300005335 Bacteria 3426
19 Ga0068868_100094180 3300005338 Bacteria 2416
20 Ga0070689_100139232 3300005340 Bacteria 1951
21 Ga0070661_100757837 3300005344 Bacteria 794
22 Ga0070661_101131711 3300005344 Bacteria 653
23 Ga0070671_100016624 3300005355 Bacteria 5947
24 Ga0070671_100133508 3300005355 Bacteria 2092
25 Ga0070671_100504646 3300005355 Bacteria 1041
26 Ga0070674_100107637 3300005356 Bacteria 2041
27 Ga0070674_100832081 3300005356 Bacteria 799
28 Ga0070667_100017540 3300005367 Bacteria 5934
29 Ga0070667_100033950 3300005367 Bacteria 4268
30 Ga0070709_10091314 3300005434 Bacteria 2009
31 Ga0070713_100030365 3300005436 Bacteria 4291
32 Ga0070713_100332302 3300005436 Bacteria 1406
33 Ga0070710_10047610 3300005437 Bacteria 2392
34 Ga0070711_100077960 3300005439 Bacteria 2353
35 Ga0070705_100854789 3300005440 Bacteria 728
36 Ga0070663_100117285 3300005455 Bacteria 2007
37 Ga0070678_100264186 3300005456 Bacteria 1449
38 Ga0070662_100437498 3300005457 Bacteria 1084
39 Ga0070681_10232327 3300005458 Unclassified 1758
40 Ga0068867_100113160 3300005459 Bacteria 2087
41 Ga0068853_100027582 3300005539 Bacteria 4771
42 Ga0068853_100086669 3300005539 Bacteria 2746
43 Ga0068853_101155659 3300005539 Bacteria 747
44 Ga0070672_100418074 3300005543 Bacteria 1151
45 Ga0070686_100137952 3300005544 Bacteria 1694
46 Ga0070695_100246058 3300005545 Bacteria 1299
47 Ga0070665_100004651 3300005548 Bacteria 14331
48 Ga0070665_100016873 3300005548 Bacteria 7321
49 Ga0070665_100128705 3300005548 Bacteria 2534
50 Ga0070665_100161955 3300005548 Bacteria 2239
51 Ga0070665_100239004 3300005548 Bacteria 1817
52 Ga0070665_100254504 3300005548 Bacteria 1757
53 Ga0070704_100726936 3300005549 Bacteria 882
54 Ga0068855_100086401 3300005563 Bacteria 3627
55 Ga0068854_101198159 3300005578 Bacteria 680
56 Ga0068856_100017668 3300005614 Bacteria 6914
57 Ga0068856_100171262 3300005614 Bacteria 2183
58 Ga0068856_100535614 3300005614 Bacteria 1192
59 Ga0070702_100224311 3300005615 Bacteria 1259
60 Ga0068852_100000043 3300005616 Bacteria 89867
61 Ga0068852_100353237 3300005616 Bacteria 1436
62 Ga0068852_100445809 3300005616 Bacteria 1280
63 Ga0068852_101739922 3300005616 Bacteria 646
64 Ga0068864_100249239 3300005618 Bacteria 1648
65 Ga0068864_101443426 3300005618 Bacteria 690
66 Ga0068866_10005524 3300005718 Bacteria 5221
67 Ga0068866_10728098 3300005718 Bacteria 683
68 Ga0068861_100141959 3300005719 Bacteria 1961
69 Ga0068851_10112024 3300005834 Bacteria 1458
70 Ga0068863_100026269 3300005841 Bacteria 5555
71 Ga0068863_100043924 3300005841 Bacteria 4242
72 Ga0068858_100007974 3300005842 Bacteria 10206
73 Ga0068858_100072202 3300005842 Bacteria 3202
74 Ga0068858_100919485 3300005842 Bacteria 856
75 Ga0068858_101202277 3300005842 Bacteria 745
76 Ga0068860_100001431 3300005843 Bacteria 25836
77 Ga0068860_100103586 3300005843 Bacteria 2716
78 Ga0068860_101341719 3300005843 Bacteria 736
79 Ga0068862_100000331 3300005844 Bacteria 51655
80 Ga0068862_100124111 3300005844 Bacteria 2279
81 Ga0068862_101195058 3300005844 Bacteria 759
82 Ga0081455_10000192 3300005937 Bacteria 77713
83 Ga0081455_10256268 3300005937 Bacteria 1276
84 Ga0081539_10005075 3300005985 Bacteria 13800
85 Ga0075365_10318740 3300006038 Bacteria 1095
86 Ga0070715_10004901 3300006163 Bacteria 4436
87 Ga0070716_100007651 3300006173 Bacteria 5330
88 Ga0070716_100227401 3300006173 Bacteria 1257
89 Ga0070716_100504869 3300006173 Bacteria 893
90 Ga0070712_100222347 3300006175 Bacteria 1495
91 Ga0070712_100880829 3300006175 Bacteria 771
92 Ga0097621_100018904 3300006237 Bacteria 5277
93 Ga0068871_100066860 3300006358 Bacteria 2947
94 Ga0068871_100135141 3300006358 Bacteria 2094
95 Ga0068871_100715444 3300006358 Bacteria 918
96 Ga0075430_100023719 3300006846 Bacteria 5225
97 Ga0075434_101086810 3300006871 Bacteria 813
98 Ga0068865_100086529 3300006881 Bacteria 2263
99 Ga0105240_10009404 3300009093 Bacteria 13842
100 Ga0111539_10291853 3300009094 Bacteria 1898
101 Ga0111539_10763053 3300009094 Bacteria 1126
102 Ga0105245_10120438 3300009098 Bacteria 2451
103 Ga0105245_10328770 3300009098 Bacteria 1508
104 Ga0105247_10061019 3300009101 Bacteria 2337
105 Ga0105241_10276114 3300009174 Bacteria 1433
106 Ga0105241_10444229 3300009174 Bacteria 1146
107 Ga0105242_10000748 3300009176 Bacteria 25302
108 Ga0105242_10330154 3300009176 Unclassified 1402
109 Ga0105242_10581905 3300009176 Bacteria 1078
110 Ga0105248_10008783 3300009177 Bacteria 11095
111 Ga0105248_10802666 3300009177 Bacteria 1062
112 Ga0105237_10053793 3300009545 Bacteria 4037
113 Ga0105237_10114676 3300009545 Bacteria 2687
114 Ga0105238_10176397 3300009551 Bacteria 2114
115 Ga0105238_10194190 3300009551 Bacteria 2006
116 Ga0105238_10358245 3300009551 Bacteria 1448
117 Ga0105249_10000127 3300009553 Bacteria 102392
118 Ga0105249_10116139 3300009553 Bacteria 2536
119 Ga0105249_10199886 3300009553 Bacteria 1955
120 Ga0105239_10398332 3300010375 Bacteria 1558
121 Ga0157326_1002628 3300012513 Bacteria 1914
122 Ga0157371_10404094 3300013102 Bacteria 1000
123 Ga0157374_10001676 3300013296 Bacteria 18563
124 Ga0157374_10417748 3300013296 Bacteria 1340
125 Ga0157378_10003178 3300013297 Bacteria 14586
126 Ga0157378_10451047 3300013297 Bacteria 1276
127 Ga0163162_10032619 3300013306 Bacteria 5173
128 Ga0163162_11454394 3300013306 Bacteria 780
129 Ga0157372_10002811 3300013307 Bacteria 18801
130 Ga0157372_10024184 3300013307 Bacteria 6594
131 Ga0157372_10024571 3300013307 Bacteria 6548
132 Ga0157372_10028716 3300013307 Bacteria 6072
133 Ga0157372_10039230 3300013307 Bacteria 5227
134 Ga0157372_10750732 3300013307 Bacteria 1135
135 Ga0157375_10132411 3300013308 Bacteria 2614
136 Ga0157375_10576043 3300013308 Bacteria 1286
137 Ga0163163_10334076 3300014325 Bacteria 1570
138 Ga0163163_12116865 3300014325 Bacteria 622
139 Ga0157379_10083066 3300014968 Bacteria 2871
140 Ga0157379_10212263 3300014968 Bacteria 1752
141 Ga0157379_10347294 3300014968 Bacteria 1358
142 Ga0157376_10155784 3300014969 Bacteria 2065
143 Ga0157376_10561206 3300014969 Bacteria 1131
144 Ga0213874_10002426 3300021377 Bacteria 4014
145 Ga0213876_10074196 3300021384 Bacteria 1797
146 Ga0209148_1000074 3300025254 Bacteria 314356
147 Ga0209675_1000808 3300025291 Bacteria 20627
148 Ga0209676_1000221 3300025292 Bacteria 124715
149 Ga0209676_1000453 3300025292 Bacteria 69137
150 Ga0209676_1001788 3300025292 Bacteria 18043
151 Ga0209025_1008523 3300025294 Bacteria 7365
152 Ga0209025_1062868 3300025294 Bacteria 1374
153 Ga0209050_1000042 3300025298 Bacteria 402842
154 Ga0209050_1000822 3300025298 Bacteria 43254
155 Ga0209050_1026115 3300025298 Bacteria 1963
156 Ga0209257_1000135 3300025304 Bacteria 205668
157 Ga0209257_1000487 3300025304 Bacteria 71315
158 Ga0207656_10069283 3300025321 Bacteria 1565
159 Ga0207692_10027207 3300025898 Bacteria 2692
160 Ga0207710_10004351 3300025900 Bacteria 6193
161 Ga0207680_10467379 3300025903 Bacteria 896
162 Ga0207647_10000756 3300025904 Bacteria 25295
163 Ga0207647_10109662 3300025904 Bacteria 1632
164 Ga0207685_10002232 3300025905 Bacteria 4386
165 Ga0207699_10822433 3300025906 Bacteria 683
166 Ga0207705_10414318 3300025909 Bacteria 1043
167 Ga0207654_10541977 3300025911 Bacteria 826
168 Ga0207707_10017766 3300025912 Bacteria 6202
169 Ga0207695_10027047 3300025913 Bacteria 6391
170 Ga0207695_10122541 3300025913 Bacteria 2566
171 Ga0207671_10143978 3300025914 Bacteria 1838
172 Ga0207671_10339979 3300025914 Bacteria 1189
173 Ga0207693_10001300 3300025915 Bacteria 22186
174 Ga0207693_10704953 3300025915 Bacteria 782
175 Ga0207663_10129186 3300025916 Bacteria 1743
176 Ga0207649_10710965 3300025920 Bacteria 780
177 Ga0207652_10190705 3300025921 Unclassified 1844
178 Ga0207694_10257307 3300025924 Unclassified 1429
179 Ga0207659_10221041 3300025926 Bacteria 1523
180 Ga0207700_10028195 3300025928 Bacteria 3944
181 Ga0207644_10247234 3300025931 Bacteria 1422
182 Ga0207644_10532257 3300025931 Bacteria 971
183 Ga0207706_10029402 3300025933 Bacteria 4904
184 Ga0207706_10242875 3300025933 Bacteria 1574
185 Ga0207686_10403057 3300025934 Bacteria 1042
186 Ga0207670_10003322 3300025936 Bacteria 8528
187 Ga0207670_10068665 3300025936 Bacteria 2443
188 Ga0207665_10000795 3300025939 Bacteria 21329
189 Ga0207665_10091896 3300025939 Bacteria 2105
190 Ga0207711_10104669 3300025941 Bacteria 2508
191 Ga0207661_10147348 3300025944 Bacteria 2032
192 Ga0207661_10171992 3300025944 Bacteria 1886
193 Ga0207667_10317890 3300025949 Bacteria 1590
194 Ga0207667_11228247 3300025949 Bacteria 728
195 Ga0207651_10666322 3300025960 Bacteria 914
196 Ga0207712_10000150 3300025961 Bacteria 72311
197 Ga0207712_10347573 3300025961 Bacteria 1232
198 Ga0207712_10368553 3300025961 Bacteria 1199
199 Ga0207712_10448338 3300025961 Unclassified 1094
200 Ga0207658_10128912 3300025986 Bacteria 2029
201 Ga0207677_10452893 3300026023 Bacteria 1100
202 Ga0207703_10035384 3300026035 Bacteria 3968
203 Ga0207703_10195520 3300026035 Bacteria 1794
204 Ga0207703_11405395 3300026035 Bacteria 671
205 Ga0207639_10203778 3300026041 Bacteria 1698
206 Ga0207678_10064523 3300026067 Bacteria 3146
207 Ga0207702_10024793 3300026078 Bacteria 4976
208 Ga0207702_10152031 3300026078 Bacteria 2106
209 Ga0207641_10001051 3300026088 Bacteria 27868
210 Ga0207641_10088780 3300026088 Bacteria 2700
211 Ga0207641_10221287 3300026088 Bacteria 1755
212 Ga0207648_10325984 3300026089 Bacteria 1381
213 Ga0207674_10027840 3300026116 Bacteria 5972
214 Ga0207674_11061223 3300026116 Bacteria 779
215 Ga0207675_100030282 3300026118 Bacteria 5040
216 Ga0207675_100182176 3300026118 Bacteria 2012
217 Ga0207683_10002715 3300026121 Bacteria 15449
218 Ga0207683_10352161 3300026121 Bacteria 1351
219 Ga0207698_10030305 3300026142 Bacteria 3888
220 Ga0207428_10063836 3300027907 Bacteria 2908
221 Ga0268266_10006042 3300028379 Bacteria 11159
222 Ga0268266_10098467 3300028379 Bacteria 2573
223 Ga0268266_10165965 3300028379 Bacteria 2000
224 Ga0268266_10310897 3300028379 Bacteria 1472
225 Ga0268266_10333118 3300028379 Bacteria 1423
226 Ga0268265_10001409 3300028380 Bacteria 20352
227 Ga0268265_10027152 3300028380 Bacteria 4082
228 Ga0268265_10091484 3300028380 Bacteria 2433
229 Ga0268264_10000102 3300028381 Bacteria 222526
230 Ga0268264_10000504 3300028381 Bacteria 50665
231 Ga0268264_10011159 3300028381 Bacteria 7421
232 Ga0265337_1010647 3300028556 Bacteria 3209
233 Ga0265334_10038186 3300028573 Bacteria 1890
234 Ga0265334_10045809 3300028573 Bacteria 1693
235 Ga0307515_10322375 3300028794 Bacteria 1210
236 Ga0265338_10000356 3300028800 Bacteria 82744
237 Ga0265338_10098414 3300028800 Bacteria 2393
238 Ga0265338_10535443 3300028800 Bacteria 821
239 Ga0265324_10059029 3300029957 Bacteria 1312
240 Ga0307511_10000165 3300030521 Bacteria 64541
241 Ga0307511_10005693 3300030521 Bacteria 12634
242 Ga0265770_1000527 3300030878 Bacteria 5346
243 Ga0265770_1014942 3300030878 Bacteria 1177
244 Ga0265760_10000709 3300031090 Bacteria 9490
245 Ga0265332_10004917 3300031238 Bacteria 6213
246 Ga0265325_10001375 3300031241 Bacteria 17182
247 Ga0265340_10140023 3300031247 Bacteria 1107
248 Ga0265339_10004601 3300031249 Bacteria 9389
249 Ga0265339_10115303 3300031249 Bacteria 1386
250 Ga0265331_10006116 3300031250 Bacteria 7163
251 Ga0265331_10143564 3300031250 Bacteria 1085
252 Ga0265327_10003173 3300031251 Bacteria 16090
253 Ga0265316_10014203 3300031344 Bacteria 7024
254 Ga0307509_10000005 3300031507 Bacteria 435959
255 Ga0307408_100426972 3300031548 Bacteria 1144
256 Ga0265313_10000215 3300031595 Bacteria 62030
257 Ga0265342_10014049 3300031712 Bacteria 5329
258 Ga0307406_10710436 3300031901 Bacteria 840
259 Ga0307412_10004515 3300031911 Bacteria 7754
260 Ga0307412_10031801 3300031911 Bacteria 3337
261 Ga0307412_10248443 3300031911 Bacteria 1380
262 Ga0307416_100140489 3300032002 Bacteria 2194
263 Ga0307414_10005170 3300032004 Bacteria 7163
264 Ga0307414_10007589 3300032004 Bacteria 6100
265 Ga0307414_10051855 3300032004 Bacteria 2851
266 Ga0307414_10106918 3300032004 Bacteria 2119
267 Ga0307414_10226598 3300032004 Bacteria 1538
268 Ga0307510_10131016 3300033180 Bacteria 2181
269 Ga0373932_0050715 3300035112 Bacteria 1231
270 Ga0373936_0053896 3300035113 Bacteria 1631
271 Ga0373936_0201078 3300035113 Bacteria 879
272 Ga0373941_0040823 3300035115 Bacteria 1433
273 Ga0373954_0024416 3300035118 Bacteria 2756
274 Ga0373957_0115703 3300035120 Bacteria 1083
275 Ga0373946_0015993 3300035171 Bacteria 2854
276 Ga0373931_0259618 3300035691 Bacteria 1059
277 Ga0373927_0635686 3300035695 Bacteria 705
278 Ga0316582_0050739 3300036647 Bacteria 2630
279 Ga0373925_0086535 3300037068 Bacteria 2391
280 Ga0373925_0922106 3300037068 Bacteria 720
281 Ga0395905_0012524 3300037471 Bacteria 8162
282 Ga0395905_0911834 3300037471 Unclassified 782
283 Ga0436364_0123985 3300037853 Bacteria 1859
284 Ga0436364_1297790 3300037853 Bacteria 1090
285 Ga0436365_0027294 3300039437 Bacteria 3973
286 Ga0436365_0114693 3300039437 Bacteria 1792
287 Ga0436365_0240348 3300039437 Bacteria 1174
288 Ga0436360_0650621 3300039438 Bacteria 2094
289 Ga0436360_0683286 3300039438 Bacteria 1210
290 Ga0436360_0781012 3300039438 Bacteria 2345
291 Ga0436361_0094519 3300039447 Bacteria 1002
292 Ga0436361_0445108 3300039447 Bacteria 1256
293 Ga0436361_1002072 3300039447 Bacteria 879
294 Ga0436361_1061351 3300039447 Bacteria 3403
295 Ga0436363_0423907 3300039450 Bacteria 1512
296 Ga0436363_0928702 3300039450 Bacteria 16814
297 Ga0436363_0951177 3300039450 Bacteria 9774
298 Ga0436363_1015046 3300039450 Unclassified 878
299 Ga0451797_1364172 3300041453 Bacteria 627
300 Ga0439448_0001045 3300042005 Bacteria 6928
301 Ga0439455_0000109 3300042012 Bacteria 8273
302 Ga0439458_0000632 3300042157 Bacteria 9121
303 Ga0451577_0548557 3300042876 Bacteria 1049
304 Ga0466972_0004177 3300044658 Bacteria 7213
305 Ga0466965_0039252 3300044683 Bacteria 2327
306 Ga0466966_0004429 3300044684 Bacteria 9260
307 Ga0466961_0009863 3300044693 Bacteria 6083
308 Ga0466961_0052411 3300044693 Bacteria 2603
309 Ga0466963_0005703 3300044694 Bacteria 7317
310 Ga0466964_0065288 3300044706 Bacteria 1524
311 Ga0453684_0000063 3300044712 Bacteria 486079
312 Ga0466971_0031188 3300044719 Bacteria 2386
313 Ga0466968_0043606 3300044735 Bacteria 1900
314 Ga0466968_0104968 3300044735 Bacteria 1265
315 Ga0466970_0132905 3300044765 Bacteria 1367
316 Ga0466959_0117667 3300045049 Bacteria 1891
317 Ga0466959_0464398 3300045049 Bacteria 857
318 Ga0451576_0051413 3300045051 Bacteria 4320
319 Ga0451576_0886732 3300045051 Bacteria 936
320 Ga0466958_0004385 3300045836 Bacteria 7442
321 Ga0466958_0680835 3300045836 Bacteria 670
322 Ga0466967_0002129 3300045976 Bacteria 12137
323 Ga0495627_000078 3300046453 Bacteria 119920
324 Ga0495638_0102125 3300046460 Bacteria 1714
325 Ga0495580_0002363 3300046472 Bacteria 16475
326 Ga0495580_0034578 3300046472 Bacteria 3638
327 Ga0495582_0295206 3300046473 Bacteria 931
328 Ga0495664_0355072 3300046477 Bacteria 882
329 Ga0495630_0023715 3300046517 Bacteria 4536
330 Ga0495643_0061147 3300046522 Bacteria 1998
331 Ga0495648_0094382 3300046524 Bacteria 1666
332 Ga0495666_0226517 3300046526 Bacteria 855
333 Ga0495652_0819501 3300046529 Bacteria 618
334 Ga0495654_0199792 3300046530 Bacteria 856
335 Ga0495586_0068726 3300046535 Bacteria 1933
336 Ga0495645_0128845 3300046543 Bacteria 1776
337 Ga0495633_0096643 3300046558 Bacteria 1372
338 Ga0495667_0720382 3300046559 Bacteria 618
339 Ga0495668_0000002 3300046616 Bacteria 763179
340 Ga0495625_0000652 3300046660 Bacteria 49796
341 Ga0495625_0246195 3300046660 Bacteria 1162
342 Ga0495658_0172357 3300046683 Bacteria 1340
343 Ga0495669_0045943 3300046684 Bacteria 1948
344 Ga0495613_0266663 3300046689 Bacteria 1192
345 Ga0495613_0621176 3300046689 Unclassified 717
346 Ga0495671_0053953 3300046692 Bacteria 1994
347 Ga0495581_0296900 3300047315 Bacteria 944
348 Ga0495674_0146025 3300047319 Bacteria 1986
349 Ga0495673_0019778 3300047469 Bacteria 3368
350 Ga0495681_0138668 3300047470 Bacteria 1029
351 Ga0496100_0683581 3300048903 Bacteria 800
352 Ga0496101_0002111 3300048904 Bacteria 12118
353 Ga0496103_0015553 3300048906 Bacteria 4531
354 Ga0496103_0651608 3300048906 Bacteria 669
355 Ga0496103_0750989 3300048906 Bacteria 617
356 Ga0496104_0190690 3300048907 Bacteria 1961
357 Ga0496104_0318017 3300048907 Bacteria 1469
358 Ga0496107_0019177 3300048910 Bacteria 4825
359 Ga0496109_0056732 3300048912 Bacteria 3573
360 Ga0496110_0078126 3300048913 Bacteria 2946
361 Ga0496111_0028030 3300048914 Bacteria 3990
362 Ga0496112_0365550 3300048915 Bacteria 1384
363 Ga0496114_0011053 3300048917 Bacteria 7201
364 Ga0496115_0023032 3300048918 Bacteria 4830
365 Ga0496115_0746960 3300048918 Bacteria 765
366 Ga0496116_0002812 3300048919 Bacteria 17865
367 Ga0496117_0001472 3300048920 Bacteria 33857
368 Ga0496117_0027981 3300048920 Bacteria 4372
369 Ga0496117_0084881 3300048920 Bacteria 2064
370 Ga0496118_0000032 3300048921 Bacteria 330072
371 Ga0496118_0017435 3300048921 Bacteria 6536
372 Ga0496118_0030739 3300048921 Bacteria 4471
373 Ga0496119_0001712 3300048922 Bacteria 25579
374 Ga0496119_0011319 3300048922 Bacteria 7407
375 Ga0496119_0013703 3300048922 Bacteria 6428
376 Ga0496120_0001527 3300048923 Bacteria 27270
377 Ga0496120_0027591 3300048923 Bacteria 3489
378 Ga0496120_0042782 3300048923 Unclassified 2643
379 Ga0496121_0119462 3300048924 Bacteria 1993
380 Ga0496123_0023394 3300048926 Bacteria 4730
381 Ga0496124_0071730 3300048927 Bacteria 2870
382 Ga0496124_0076769 3300048927 Bacteria 2756
383 Ga0496125_0000324 3300048928 Bacteria 92755
384 Ga0496125_0012092 3300048928 Bacteria 8587
385 Ga0496125_0069441 3300048928 Bacteria 2765
386 Ga0496125_0211298 3300048928 Bacteria 1260
387 Ga0496126_0023635 3300048929 Bacteria 5954
388 Ga0496126_0041785 3300048929 Bacteria 4240
389 Ga0496126_0281068 3300048929 Bacteria 1379
390 Ga0495682_0114423 3300049460 Bacteria 967
391 Ga0501034_0009151 3300049571 Bacteria 10393
392 Ga0501038_0034426 3300049574 Bacteria 4453
393 Ga0501043_0017579 3300049579 Bacteria 5607
394 Ga0501223_003796 3300049663 Bacteria 3264
395 Ga0501224_000006 3300049664 Bacteria 149611
396 Ga0501233_007846 3300049668 Bacteria 2042
397 Ga0501235_010074 3300049669 Bacteria 2066
398 Ga0501225_0000177 3300049705 Bacteria 19642
399 Ga0501035_0134601 3300049822 Bacteria 2152
400 Ga0501044_0097689 3300049823 Bacteria 2958
401 Ga0501044_0119821 3300049823 Bacteria 2633
402 Ga0501226_000048 3300049853 Bacteria 53910
403 nmdc:mga0qj67_16510_c1 3300050509 Bacteria 5602
404 nmdc:mga08y16_47896_c1 3300050511 Bacteria 4474
405 nmdc:mga08y16_648818_c1 3300050511 Bacteria 1060
406 Ga0500643_040557 3300053087 Bacteria 1370
407 Ga0500583_0146287 3300053092 Bacteria 1175
408 Ga0500583_0319918 3300053092 Bacteria 756
409 Ga0500641_0018418 3300053096 Bacteria 2627
410 Ga0500641_0264420 3300053096 Bacteria 717
411 Ga0500556_0000248 3300053104 Bacteria 43810
412 Ga0500556_0048575 3300053104 Bacteria 1527
413 Ga0500556_0060714 3300053104 Bacteria 1392
414 Ga0500592_000395 3300053116 Bacteria 7317
415 Ga0500594_0131775 3300053118 Bacteria 792
416 Ga0500614_131634 3300053123 Bacteria 743
417 Ga0500617_037042 3300053124 Bacteria 2183
418 Ga0500658_0043617 3300053134 Bacteria 1806
419 Ga0500568_0008339 3300053139 Bacteria 5006
420 Ga0500568_0116962 3300053139 Bacteria 995
421 Ga0500568_0188873 3300053139 Bacteria 756
422 Ga0500588_0011761 3300053146 Bacteria 2151
423 Ga0500589_145958 3300053147 Bacteria 969
424 Ga0500616_0000042 3300053153 Bacteria 351293
425 Ga0500616_0063981 3300053153 Bacteria 1895
426 Ga0500627_0000054 3300053158 Bacteria 55229
427 Ga0500630_232622 3300053159 Bacteria 676
428 Ga0500639_075042 3300053163 Bacteria 1714
429 Ga0500637_0001266 3300053178 Bacteria 10570
430 Ga0501084_0153240 3300054114 Bacteria 1943
431 Ga0466962_0006794 3300061719 Bacteria 5490
432 Ga0466962_0022587 3300061719 Bacteria 3023
433 Ga0466962_0386895 3300061719 Bacteria 699

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10194190 Ga0105238_101941902 160
2 3300026116 Ga0207674_10027840 Ga0207674_100278405 160
3 3300039447 Ga0436361_1002072 Ga0436361_1002072_263_850 163
4 3300005616 Ga0068852_101739922 Ga0068852_1017399221 164
5 3300003791 Ga0055530_10037304 Ga0055530_100373042 165
6 3300025298 Ga0209050_1000822 Ga0209050_100082215 165
7 3300013306 Ga0163162_10032619 Ga0163162_100326192 168
8 3300013307 Ga0157372_10024184 Ga0157372_1002418412 168
9 3300039437 Ga0436365_0114693 Ga0436365_0114693_524_1042 168
10 3300039450 Ga0436363_0951177 Ga0436363_0951177_9233_9751 168
11 3300048903 Ga0496100_0683581 Ga0496100_0683581_200_757 168
12 3300048906 Ga0496103_0651608 Ga0496103_0651608_38_595 168
13 3300048907 Ga0496104_0190690 Ga0496104_0190690_1209_1766 168
14 3300003794 Ga0055531_10009084 Ga0055531_100090843 169
15 3300009101 Ga0105247_10061019 Ga0105247_100610193 169
16 3300009174 Ga0105241_10276114 Ga0105241_102761143 169
17 3300009177 Ga0105248_10802666 Ga0105248_108026662 169
18 3300009545 Ga0105237_10114676 Ga0105237_101146762 169
19 3300009553 Ga0105249_10199886 Ga0105249_101998862 169
20 3300013296 Ga0157374_10417748 Ga0157374_104177482 169
21 3300013306 Ga0163162_11454394 Ga0163162_114543942 169
22 3300025304 Ga0209257_1000487 Ga0209257_100048722 169
23 3300035112 Ga0373932_0050715 Ga0373932_0050715_345_863 169
24 3300046660 Ga0495625_0246195 Ga0495625_0246195_120_737 169
25 3300048928 Ga0496125_0000324 Ga0496125_0000324_55139_55663 169
26 3300048929 Ga0496126_0023635 Ga0496126_0023635_2522_3046 169
27 3300044684 Ga0466966_0004429 Ga0466966_0004429_1221_1742 170
28 3300044693 Ga0466961_0052411 Ga0466961_0052411_530_1051 170
29 3300045049 Ga0466959_0464398 Ga0466959_0464398_320_841 170
30 3300046660 Ga0495625_0000652 Ga0495625_0000652_16084_16707 170
31 iso_pu_bacteria 2643221605 2644039479 170
32 3300009093 Ga0105240_10009404 Ga0105240_1000940412 171
33 3300009176 Ga0105242_10581905 Ga0105242_105819052 171
34 3300009551 Ga0105238_10358245 Ga0105238_103582452 171
35 3300009553 Ga0105249_10116139 Ga0105249_101161393 171
36 3300013308 Ga0157375_10576043 Ga0157375_105760432 171
37 3300014968 Ga0157379_10347294 Ga0157379_103472942 171
38 3300014969 Ga0157376_10155784 Ga0157376_101557842 171
39 3300014969 Ga0157376_10561206 Ga0157376_105612062 171
40 3300041453 Ga0451797_1364172 Ga0451797_1364172_56_616 171
41 3300048922 Ga0496119_0001712 Ga0496119_0001712_6799_7329 171
42 3300048922 Ga0496119_0011319 Ga0496119_0011319_1663_2193 171
43 3300048923 Ga0496120_0001527 Ga0496120_0001527_18737_19267 171
44 3300048923 Ga0496120_0042782 Ga0496120_0042782_679_1209 171
45 3300048928 Ga0496125_0012092 Ga0496125_0012092_2005_2535 171
46 3300049460 Ga0495682_0114423 Ga0495682_0114423_194_724 171
47 3300053123 Ga0500614_131634 Ga0500614_131634_66_596 171
48 3300039438 Ga0436360_0650621 Ga0436360_0650621_605_1135 172
49 3300039450 Ga0436363_1015046 Ga0436363_1015046_235_762 172
50 3300053104 Ga0500556_0000248 Ga0500556_0000248_42081_42635 172
51 3300005718 Ga0068866_10728098 Ga0068866_107280981 173
52 3300009176 Ga0105242_10330154 Ga0105242_103301542 173
53 3300014325 Ga0163163_10334076 Ga0163163_103340762 173
54 3300025926 Ga0207659_10221041 Ga0207659_102210412 173
55 3300026023 Ga0207677_10452893 Ga0207677_104528932 173
56 3300046473 Ga0495582_0295206 Ga0495582_0295206_312_845 173
57 3300046526 Ga0495666_0226517 Ga0495666_0226517_283_816 173
58 3300046529 Ga0495652_0819501 Ga0495652_0819501_49_582 173
59 3300047315 Ga0495581_0296900 Ga0495581_0296900_18_551 173
60 3300053087 Ga0500643_040557 Ga0500643_040557_162_695 173
61 iso_pu_bacteria 2643221563 2643835838 173
62 iso_pu_bacteria 2643221608 2644056764 173
63 iso_pu_bacteria 2852653556 2852655022 173
64 3300005355 Ga0070671_100133508 Ga0070671_1001335083 174
65 3300005356 Ga0070674_100107637 Ga0070674_1001076372 174
66 3300005436 Ga0070713_100332302 Ga0070713_1003323022 174
67 3300005455 Ga0070663_100117285 Ga0070663_1001172852 174
68 3300005539 Ga0068853_100086669 Ga0068853_1000866692 174
69 3300005548 Ga0070665_100161955 Ga0070665_1001619552 174
70 3300005548 Ga0070665_100254504 Ga0070665_1002545041 174
71 3300005614 Ga0068856_100171262 Ga0068856_1001712622 174
72 3300005614 Ga0068856_100535614 Ga0068856_1005356142 174
73 3300005618 Ga0068864_100249239 Ga0068864_1002492392 174
74 3300005842 Ga0068858_100072202 Ga0068858_1000722023 174
75 3300005843 Ga0068860_101341719 Ga0068860_1013417192 174
76 3300006358 Ga0068871_100135141 Ga0068871_1001351412 174
77 3300009094 Ga0111539_10291853 Ga0111539_102918532 174
78 3300009094 Ga0111539_10763053 Ga0111539_107630531 174
79 3300012513 Ga0157326_1002628 Ga0157326_10026282 174
80 3300013307 Ga0157372_10002811 Ga0157372_100028116 174
81 3300025904 Ga0207647_10109662 Ga0207647_101096622 174
82 3300025931 Ga0207644_10247234 Ga0207644_102472342 174
83 3300025986 Ga0207658_10128912 Ga0207658_101289123 174
84 3300026035 Ga0207703_10035384 Ga0207703_100353843 174
85 3300026041 Ga0207639_10203778 Ga0207639_102037782 174
86 3300026067 Ga0207678_10064523 Ga0207678_100645232 174
87 3300026078 Ga0207702_10152031 Ga0207702_101520312 174
88 3300026088 Ga0207641_10001051 Ga0207641_1000105122 174
89 3300026121 Ga0207683_10352161 Ga0207683_103521612 174
90 3300027907 Ga0207428_10063836 Ga0207428_100638362 174
91 3300028379 Ga0268266_10333118 Ga0268266_103331182 174
92 3300028381 Ga0268264_10000102 Ga0268264_10000102102 174
93 3300028556 Ga0265337_1010647 Ga0265337_10106472 174
94 3300028573 Ga0265334_10038186 Ga0265334_100381862 174
95 3300028800 Ga0265338_10098414 Ga0265338_100984142 174
96 3300031250 Ga0265331_10143564 Ga0265331_101435641 174
97 3300037068 Ga0373925_0922106 Ga0373925_0922106_162_701 174
98 3300044712 Ga0453684_0000063 Ga0453684_0000063_376634_377164 174
99 3300046559 Ga0495667_0720382 Ga0495667_0720382_59_595 174
100 3300048918 Ga0496115_0746960 Ga0496115_0746960_210_746 174
101 3300050511 nmdc:mga08y16_47896_c1 nmdc:mga08y16_47896_c1_1296_1835 174
102 3300050511 nmdc:mga08y16_648818_c1 nmdc:mga08y16_648818_c1_184_729 174
103 3300005340 Ga0070689_100139232 Ga0070689_1001392322 175
104 3300006038 Ga0075365_10318740 Ga0075365_103187402 175
105 3300006358 Ga0068871_100715444 Ga0068871_1007154441 175
106 3300013307 Ga0157372_10024571 Ga0157372_100245713 175
107 3300025936 Ga0207670_10003322 Ga0207670_100033222 175
108 3300025936 Ga0207670_10068665 Ga0207670_100686652 175
109 3300028573 Ga0265334_10045809 Ga0265334_100458092 175
110 3300028800 Ga0265338_10000356 Ga0265338_1000035655 175
111 3300029957 Ga0265324_10059029 Ga0265324_100590292 175
112 3300030878 Ga0265770_1000527 Ga0265770_10005275 175
113 3300030878 Ga0265770_1014942 Ga0265770_10149421 175
114 3300031090 Ga0265760_10000709 Ga0265760_100007096 175
115 3300031238 Ga0265332_10004917 Ga0265332_100049178 175
116 3300031241 Ga0265325_10001375 Ga0265325_1000137510 175
117 3300031247 Ga0265340_10140023 Ga0265340_101400232 175
118 3300031249 Ga0265339_10004601 Ga0265339_100046018 175
119 3300031250 Ga0265331_10006116 Ga0265331_100061161 175
120 3300031251 Ga0265327_10003173 Ga0265327_100031732 175
121 3300031344 Ga0265316_10014203 Ga0265316_100142034 175
122 3300031595 Ga0265313_10000215 Ga0265313_100002158 175
123 3300031712 Ga0265342_10014049 Ga0265342_100140494 175
124 3300035115 Ga0373941_0040823 Ga0373941_0040823_542_1084 175
125 3300035691 Ga0373931_0259618 Ga0373931_0259618_232_774 175
126 3300036647 Ga0316582_0050739 Ga0316582_0050739_1966_2505 175
127 3300039447 Ga0436361_1061351 Ga0436361_1061351_2425_2967 175
128 3300044719 Ga0466971_0031188 Ga0466971_0031188_1121_1765 175
129 3300044735 Ga0466968_0043606 Ga0466968_0043606_84_728 175
130 3300044765 Ga0466970_0132905 Ga0466970_0132905_707_1351 175
131 3300045051 Ga0451576_0886732 Ga0451576_0886732_299_841 175
132 3300046477 Ga0495664_0355072 Ga0495664_0355072_101_640 175
133 3300046535 Ga0495586_0068726 Ga0495586_0068726_1383_1922 175
134 3300046683 Ga0495658_0172357 Ga0495658_0172357_663_1202 175
135 3300046689 Ga0495613_0621176 Ga0495613_0621176_11_550 175
136 3300049823 Ga0501044_0097689 Ga0501044_0097689_236_775 175
137 3300053139 Ga0500568_0116962 Ga0500568_0116962_91_633 175
138 3300053153 Ga0500616_0000042 Ga0500616_0000042_11282_11833 175
139 3300054114 Ga0501084_0153240 Ga0501084_0153240_103_645 175
140 3300061719 Ga0466962_0022587 Ga0466962_0022587_1098_1742 175
141 3300003322 rootL2_10043958 rootL2_100439582 176
142 3300005272 Ga0065703_1023663 Ga0065703_10236631 176
143 3300005327 Ga0070658_10159494 Ga0070658_101594943 176
144 3300005335 Ga0070666_10032933 Ga0070666_100329332 176
145 3300005338 Ga0068868_100094180 Ga0068868_1000941802 176
146 3300005344 Ga0070661_100757837 Ga0070661_1007578371 176
147 3300005344 Ga0070661_101131711 Ga0070661_1011317111 176
148 3300005355 Ga0070671_100016624 Ga0070671_1000166243 176
149 3300005355 Ga0070671_100504646 Ga0070671_1005046462 176
150 3300005356 Ga0070674_100832081 Ga0070674_1008320812 176
151 3300005367 Ga0070667_100017540 Ga0070667_1000175402 176
152 3300005367 Ga0070667_100033950 Ga0070667_1000339504 176
153 3300005434 Ga0070709_10091314 Ga0070709_100913142 176
154 3300005436 Ga0070713_100030365 Ga0070713_1000303652 176
155 3300005437 Ga0070710_10047610 Ga0070710_100476102 176
156 3300005439 Ga0070711_100077960 Ga0070711_1000779602 176
157 3300005440 Ga0070705_100854789 Ga0070705_1008547891 176
158 3300005456 Ga0070678_100264186 Ga0070678_1002641862 176
159 3300005458 Ga0070681_10232327 Ga0070681_102323272 176
160 3300005459 Ga0068867_100113160 Ga0068867_1001131602 176
161 3300005539 Ga0068853_101155659 Ga0068853_1011556591 176
162 3300005543 Ga0070672_100418074 Ga0070672_1004180742 176
163 3300005544 Ga0070686_100137952 Ga0070686_1001379522 176
164 3300005545 Ga0070695_100246058 Ga0070695_1002460581 176
165 3300005548 Ga0070665_100004651 Ga0070665_1000046519 176
166 3300005548 Ga0070665_100016873 Ga0070665_1000168733 176
167 3300005548 Ga0070665_100128705 Ga0070665_1001287053 176
168 3300005548 Ga0070665_100239004 Ga0070665_1002390042 176
169 3300005549 Ga0070704_100726936 Ga0070704_1007269362 176
170 3300005563 Ga0068855_100086401 Ga0068855_1000864012 176
171 3300005578 Ga0068854_101198159 Ga0068854_1011981591 176
172 3300005615 Ga0070702_100224311 Ga0070702_1002243113 176
173 3300005616 Ga0068852_100445809 Ga0068852_1004458092 176
174 3300005618 Ga0068864_101443426 Ga0068864_1014434261 176
175 3300005718 Ga0068866_10005524 Ga0068866_100055242 176
176 3300005719 Ga0068861_100141959 Ga0068861_1001419592 176
177 3300005834 Ga0068851_10112024 Ga0068851_101120242 176
178 3300005841 Ga0068863_100026269 Ga0068863_1000262692 176
179 3300005842 Ga0068858_100007974 Ga0068858_1000079742 176
180 3300005842 Ga0068858_100919485 Ga0068858_1009194852 176
181 3300005842 Ga0068858_101202277 Ga0068858_1012022771 176
182 3300005843 Ga0068860_100103586 Ga0068860_1001035862 176
183 3300005844 Ga0068862_100124111 Ga0068862_1001241112 176
184 3300005844 Ga0068862_101195058 Ga0068862_1011950582 176
185 3300005937 Ga0081455_10000192 Ga0081455_1000019246 176
186 3300005937 Ga0081455_10256268 Ga0081455_102562682 176
187 3300006163 Ga0070715_10004901 Ga0070715_100049012 176
188 3300006173 Ga0070716_100007651 Ga0070716_1000076512 176
189 3300006173 Ga0070716_100227401 Ga0070716_1002274012 176
190 3300006173 Ga0070716_100504869 Ga0070716_1005048692 176
191 3300006175 Ga0070712_100222347 Ga0070712_1002223472 176
192 3300006175 Ga0070712_100880829 Ga0070712_1008808291 176
193 3300006237 Ga0097621_100018904 Ga0097621_1000189042 176
194 3300006358 Ga0068871_100066860 Ga0068871_1000668602 176
195 3300006871 Ga0075434_101086810 Ga0075434_1010868101 176
196 3300006881 Ga0068865_100086529 Ga0068865_1000865292 176
197 3300009098 Ga0105245_10120438 Ga0105245_101204382 176
198 3300009098 Ga0105245_10328770 Ga0105245_103287702 176
199 3300009174 Ga0105241_10444229 Ga0105241_104442292 176
200 3300009176 Ga0105242_10000748 Ga0105242_100007483 176
201 3300009177 Ga0105248_10008783 Ga0105248_100087836 176
202 3300009545 Ga0105237_10053793 Ga0105237_100537932 176
203 3300009551 Ga0105238_10176397 Ga0105238_101763972 176
204 3300010375 Ga0105239_10398332 Ga0105239_103983322 176
205 3300013296 Ga0157374_10001676 Ga0157374_1000167612 176
206 3300013297 Ga0157378_10003178 Ga0157378_100031786 176
207 3300013297 Ga0157378_10451047 Ga0157378_104510472 176
208 3300013307 Ga0157372_10039230 Ga0157372_100392303 176
209 3300013308 Ga0157375_10132411 Ga0157375_101324112 176
210 3300014325 Ga0163163_12116865 Ga0163163_121168651 176
211 3300014968 Ga0157379_10083066 Ga0157379_100830662 176
212 3300014968 Ga0157379_10212263 Ga0157379_102122632 176
213 3300021377 Ga0213874_10002426 Ga0213874_100024262 176
214 3300021384 Ga0213876_10074196 Ga0213876_100741962 176
215 3300025321 Ga0207656_10069283 Ga0207656_100692831 176
216 3300025898 Ga0207692_10027207 Ga0207692_100272072 176
217 3300025903 Ga0207680_10467379 Ga0207680_104673792 176
218 3300025905 Ga0207685_10002232 Ga0207685_100022322 176
219 3300025906 Ga0207699_10822433 Ga0207699_108224331 176
220 3300025909 Ga0207705_10414318 Ga0207705_104143182 176
221 3300025911 Ga0207654_10541977 Ga0207654_105419771 176
222 3300025912 Ga0207707_10017766 Ga0207707_100177662 176
223 3300025913 Ga0207695_10027047 Ga0207695_100270473 176
224 3300025913 Ga0207695_10122541 Ga0207695_101225413 176
225 3300025914 Ga0207671_10143978 Ga0207671_101439782 176
226 3300025914 Ga0207671_10339979 Ga0207671_103399792 176
227 3300025915 Ga0207693_10001300 Ga0207693_1000130021 176
228 3300025915 Ga0207693_10704953 Ga0207693_107049531 176
229 3300025916 Ga0207663_10129186 Ga0207663_101291862 176
230 3300025920 Ga0207649_10710965 Ga0207649_107109651 176
231 3300025921 Ga0207652_10190705 Ga0207652_101907052 176
232 3300025924 Ga0207694_10257307 Ga0207694_102573072 176
233 3300025928 Ga0207700_10028195 Ga0207700_100281954 176
234 3300025931 Ga0207644_10532257 Ga0207644_105322571 176
235 3300025934 Ga0207686_10403057 Ga0207686_104030572 176
236 3300025939 Ga0207665_10000795 Ga0207665_100007954 176
237 3300025939 Ga0207665_10091896 Ga0207665_100918962 176
238 3300025941 Ga0207711_10104669 Ga0207711_101046692 176
239 3300025944 Ga0207661_10147348 Ga0207661_101473482 176
240 3300025944 Ga0207661_10171992 Ga0207661_101719922 176
241 3300025949 Ga0207667_10317890 Ga0207667_103178902 176
242 3300025949 Ga0207667_11228247 Ga0207667_112282472 176
243 3300025960 Ga0207651_10666322 Ga0207651_106663222 176
244 3300025961 Ga0207712_10347573 Ga0207712_103475731 176
245 3300025961 Ga0207712_10368553 Ga0207712_103685532 176
246 3300025961 Ga0207712_10448338 Ga0207712_104483382 176
247 3300026035 Ga0207703_10195520 Ga0207703_101955202 176
248 3300026035 Ga0207703_11405395 Ga0207703_114053951 176
249 3300026088 Ga0207641_10088780 Ga0207641_100887802 176
250 3300026089 Ga0207648_10325984 Ga0207648_103259842 176
251 3300026118 Ga0207675_100030282 Ga0207675_1000302824 176
252 3300026118 Ga0207675_100182176 Ga0207675_1001821762 176
253 3300026121 Ga0207683_10002715 Ga0207683_100027153 176
254 3300028379 Ga0268266_10006042 Ga0268266_100060422 176
255 3300028379 Ga0268266_10098467 Ga0268266_100984673 176
256 3300028379 Ga0268266_10165965 Ga0268266_101659652 176
257 3300028379 Ga0268266_10310897 Ga0268266_103108971 176
258 3300028380 Ga0268265_10027152 Ga0268265_100271524 176
259 3300028380 Ga0268265_10091484 Ga0268265_100914842 176
260 3300028381 Ga0268264_10011159 Ga0268264_100111592 176
261 3300028794 Ga0307515_10322375 Ga0307515_103223752 176
262 3300028800 Ga0265338_10535443 Ga0265338_105354431 176
263 3300030521 Ga0307511_10000165 Ga0307511_1000016521 176
264 3300030521 Ga0307511_10005693 Ga0307511_100056935 176
265 3300031249 Ga0265339_10115303 Ga0265339_101153031 176
266 3300031507 Ga0307509_10000005 Ga0307509_10000005339 176
267 3300031901 Ga0307406_10710436 Ga0307406_107104361 176
268 3300035113 Ga0373936_0053896 Ga0373936_0053896_864_1406 176
269 3300035113 Ga0373936_0201078 Ga0373936_0201078_199_741 176
270 3300035118 Ga0373954_0024416 Ga0373954_0024416_1260_1808 176
271 3300035120 Ga0373957_0115703 Ga0373957_0115703_367_915 176
272 3300035171 Ga0373946_0015993 Ga0373946_0015993_1347_1895 176
273 3300035695 Ga0373927_0635686 Ga0373927_0635686_49_591 176
274 3300037068 Ga0373925_0086535 Ga0373925_0086535_1247_1795 176
275 3300037471 Ga0395905_0911834 Ga0395905_0911834_229_771 176
276 3300037853 Ga0436364_0123985 Ga0436364_0123985_1164_1709 176
277 3300039437 Ga0436365_0027294 Ga0436365_0027294_2514_3065 176
278 3300039438 Ga0436360_0683286 Ga0436360_0683286_540_1082 176
279 3300039447 Ga0436361_0094519 Ga0436361_0094519_276_863 176
280 3300039447 Ga0436361_0445108 Ga0436361_0445108_697_1236 176
281 3300039450 Ga0436363_0423907 Ga0436363_0423907_351_902 176
282 3300039450 Ga0436363_0928702 Ga0436363_0928702_337_891 176
283 3300042876 Ga0451577_0548557 Ga0451577_0548557_121_666 176
284 3300045051 Ga0451576_0051413 Ga0451576_0051413_2851_3396 176
285 3300046453 Ga0495627_000078 Ga0495627_000078_36530_37087 176
286 3300046460 Ga0495638_0102125 Ga0495638_0102125_30_584 176
287 3300046472 Ga0495580_0002363 Ga0495580_0002363_10942_11490 176
288 3300046472 Ga0495580_0034578 Ga0495580_0034578_2808_3356 176
289 3300046517 Ga0495630_0023715 Ga0495630_0023715_1491_2039 176
290 3300046522 Ga0495643_0061147 Ga0495643_0061147_740_1282 176
291 3300046524 Ga0495648_0094382 Ga0495648_0094382_636_1193 176
292 3300046543 Ga0495645_0128845 Ga0495645_0128845_973_1521 176
293 3300046558 Ga0495633_0096643 Ga0495633_0096643_130_687 176
294 3300046684 Ga0495669_0045943 Ga0495669_0045943_1222_1773 176
295 3300046689 Ga0495613_0266663 Ga0495613_0266663_253_801 176
296 3300046692 Ga0495671_0053953 Ga0495671_0053953_39_584 176
297 3300047319 Ga0495674_0146025 Ga0495674_0146025_79_627 176
298 3300047469 Ga0495673_0019778 Ga0495673_0019778_453_1010 176
299 3300048904 Ga0496101_0002111 Ga0496101_0002111_8465_9013 176
300 3300048906 Ga0496103_0015553 Ga0496103_0015553_561_1106 176
301 3300048906 Ga0496103_0750989 Ga0496103_0750989_57_605 176
302 3300048907 Ga0496104_0318017 Ga0496104_0318017_312_860 176
303 3300048910 Ga0496107_0019177 Ga0496107_0019177_448_996 176
304 3300048912 Ga0496109_0056732 Ga0496109_0056732_1058_1606 176
305 3300048913 Ga0496110_0078126 Ga0496110_0078126_296_844 176
306 3300048914 Ga0496111_0028030 Ga0496111_0028030_1019_1567 176
307 3300048915 Ga0496112_0365550 Ga0496112_0365550_65_613 176
308 3300048917 Ga0496114_0011053 Ga0496114_0011053_6045_6593 176
309 3300048918 Ga0496115_0023032 Ga0496115_0023032_901_1449 176
310 3300048919 Ga0496116_0002812 Ga0496116_0002812_11172_11717 176
311 3300048920 Ga0496117_0001472 Ga0496117_0001472_27977_28522 176
312 3300048921 Ga0496118_0000032 Ga0496118_0000032_324272_324817 176
313 3300048924 Ga0496121_0119462 Ga0496121_0119462_597_1142 176
314 3300048927 Ga0496124_0076769 Ga0496124_0076769_1650_2195 176
315 3300053092 Ga0500583_0146287 Ga0500583_0146287_366_911 176
316 3300053092 Ga0500583_0319918 Ga0500583_0319918_99_653 176
317 3300053096 Ga0500641_0018418 Ga0500641_0018418_1513_2058 176
318 3300053096 Ga0500641_0264420 Ga0500641_0264420_62_616 176
319 3300053104 Ga0500556_0048575 Ga0500556_0048575_450_995 176
320 3300053104 Ga0500556_0060714 Ga0500556_0060714_764_1309 176
321 3300053124 Ga0500617_037042 Ga0500617_037042_419_964 176
322 3300053134 Ga0500658_0043617 Ga0500658_0043617_954_1499 176
323 3300053139 Ga0500568_0188873 Ga0500568_0188873_126_680 176
324 3300053146 Ga0500588_0011761 Ga0500588_0011761_1264_1809 176
325 3300053147 Ga0500589_145958 Ga0500589_145958_198_743 176
326 3300053153 Ga0500616_0063981 Ga0500616_0063981_195_749 176
327 3300053159 Ga0500630_232622 Ga0500630_232622_114_656 176
328 3300053163 Ga0500639_075042 Ga0500639_075042_387_929 176
329 3300053178 Ga0500637_0001266 Ga0500637_0001266_9096_9638 176
330 3300003187 JGI25151J46595_10090150 JGI25151J46595_100901501 177
331 3300003781 Ga0055536_1001904 Ga0055536_10019045 177
332 3300003781 Ga0055536_1003233 Ga0055536_10032338 177
333 3300003781 Ga0055536_1009211 Ga0055536_10092116 177
334 3300003784 Ga0055534_1014513 Ga0055534_10145132 177
335 3300003791 Ga0055530_10000013 Ga0055530_10000013107 177
336 3300003794 Ga0055531_10000627 Ga0055531_1000062722 177
337 3300025291 Ga0209675_1000808 Ga0209675_100080818 177
338 3300025292 Ga0209676_1000221 Ga0209676_1000221105 177
339 3300025292 Ga0209676_1000453 Ga0209676_100045334 177
340 3300025292 Ga0209676_1001788 Ga0209676_100178810 177
341 3300025294 Ga0209025_1008523 Ga0209025_10085234 177
342 3300025294 Ga0209025_1062868 Ga0209025_10628682 177
343 3300025298 Ga0209050_1000042 Ga0209050_1000042282 177
344 3300025298 Ga0209050_1026115 Ga0209050_10261152 177
345 3300025304 Ga0209257_1000135 Ga0209257_1000135105 177
346 3300031911 Ga0307412_10031801 Ga0307412_100318013 177
347 3300031911 Ga0307412_10248443 Ga0307412_102484432 177
348 3300032004 Ga0307414_10005170 Ga0307414_100051705 177
349 3300032004 Ga0307414_10051855 Ga0307414_100518551 177
350 3300032004 Ga0307414_10106918 Ga0307414_101069182 177
351 3300032004 Ga0307414_10226598 Ga0307414_102265982 177
352 3300033180 Ga0307510_10131016 Ga0307510_101310163 177
353 3300039438 Ga0436360_0781012 Ga0436360_0781012_249_842 177
354 3300046616 Ga0495668_0000002 Ga0495668_0000002_93051_93611 177
355 3300048927 Ga0496124_0071730 Ga0496124_0071730_62_613 177
356 3300048928 Ga0496125_0211298 Ga0496125_0211298_22_582 177
357 3300049574 Ga0501038_0034426 Ga0501038_0034426_1214_1789 177
358 3300049579 Ga0501043_0017579 Ga0501043_0017579_2156_2731 177
359 3300049822 Ga0501035_0134601 Ga0501035_0134601_161_736 177
360 3300049823 Ga0501044_0119821 Ga0501044_0119821_810_1385 177
361 3300053118 Ga0500594_0131775 Ga0500594_0131775_122_685 177
362 3300053139 Ga0500568_0008339 Ga0500568_0008339_2136_2696 177
363 3300003203 JGI25406J46586_10160383 JGI25406J46586_101603831 178
364 3300005841 Ga0068863_100043924 Ga0068863_1000439245 178
365 3300005843 Ga0068860_100001431 Ga0068860_10000143110 178
366 3300005844 Ga0068862_100000331 Ga0068862_10000033112 178
367 3300005985 Ga0081539_10005075 Ga0081539_100050755 178
368 3300006846 Ga0075430_100023719 Ga0075430_1000237196 178
369 3300009553 Ga0105249_10000127 Ga0105249_1000012719 178
370 3300025900 Ga0207710_10004351 Ga0207710_100043515 178
371 3300025961 Ga0207712_10000150 Ga0207712_1000015052 178
372 3300026088 Ga0207641_10221287 Ga0207641_102212873 178
373 3300028380 Ga0268265_10001409 Ga0268265_1000140910 178
374 3300028381 Ga0268264_10000504 Ga0268264_1000050413 178
375 3300046530 Ga0495654_0199792 Ga0495654_0199792_112_675 178
376 3300047470 Ga0495681_0138668 Ga0495681_0138668_147_710 178
377 3300048920 Ga0496117_0027981 Ga0496117_0027981_1821_2357 178
378 3300048920 Ga0496117_0084881 Ga0496117_0084881_465_1001 178
379 3300048921 Ga0496118_0017435 Ga0496118_0017435_2691_3227 178
380 3300048921 Ga0496118_0030739 Ga0496118_0030739_3013_3549 178
381 3300048922 Ga0496119_0013703 Ga0496119_0013703_3117_3653 178
382 3300048923 Ga0496120_0027591 Ga0496120_0027591_828_1364 178
383 3300048926 Ga0496123_0023394 Ga0496123_0023394_2179_2715 178
384 3300048928 Ga0496125_0069441 Ga0496125_0069441_980_1516 178
385 3300048929 Ga0496126_0041785 Ga0496126_0041785_2615_3151 178
386 3300048929 Ga0496126_0281068 Ga0496126_0281068_50_586 178
387 3300050509 nmdc:mga0qj67_16510_c1 nmdc:mga0qj67_16510_c1_3531_4109 178
388 3300053116 Ga0500592_000395 Ga0500592_000395_5745_6308 178
389 3300053158 Ga0500627_0000054 Ga0500627_0000054_54243_54806 178
390 3300025933 Ga0207706_10242875 Ga0207706_102428752 179
391 3300031548 Ga0307408_100426972 Ga0307408_1004269721 179
392 3300031911 Ga0307412_10004515 Ga0307412_100045153 179
393 3300032002 Ga0307416_100140489 Ga0307416_1001404892 179
394 3300032004 Ga0307414_10007589 Ga0307414_100075896 179
395 3300037853 Ga0436364_1297790 Ga0436364_1297790_309_881 179
396 3300049571 Ga0501034_0009151 Ga0501034_0009151_3533_4090 179
397 3300049663 Ga0501223_003796 Ga0501223_003796_1182_1721 179
398 3300049664 Ga0501224_000006 Ga0501224_000006_60858_61397 179
399 3300049668 Ga0501233_007846 Ga0501233_007846_506_1045 179
400 3300049669 Ga0501235_010074 Ga0501235_010074_1376_1915 179
401 3300049705 Ga0501225_0000177 Ga0501225_0000177_6823_7362 179
402 3300049853 Ga0501226_000048 Ga0501226_000048_40056_40595 179
403 3300001990 JGI24737J22298_10012581 JGI24737J22298_100125812 180
404 3300002067 JGI24735J21928_10019252 JGI24735J21928_100192522 180
405 3300002075 JGI24738J21930_10005044 JGI24738J21930_100050442 180
406 3300003762 Ga0055542_1005864 Ga0055542_10058642 180
407 3300005457 Ga0070662_100437498 Ga0070662_1004374982 180
408 3300005539 Ga0068853_100027582 Ga0068853_1000275828 180
409 3300005614 Ga0068856_100017668 Ga0068856_1000176684 180
410 3300005616 Ga0068852_100000043 Ga0068852_10000004331 180
411 3300005616 Ga0068852_100353237 Ga0068852_1003532372 180
412 3300013102 Ga0157371_10404094 Ga0157371_104040942 180
413 3300013307 Ga0157372_10028716 Ga0157372_100287164 180
414 3300013307 Ga0157372_10750732 Ga0157372_107507322 180
415 3300025254 Ga0209148_1000074 Ga0209148_1000074212 180
416 3300025904 Ga0207647_10000756 Ga0207647_100007566 180
417 3300025933 Ga0207706_10029402 Ga0207706_100294023 180
418 3300026078 Ga0207702_10024793 Ga0207702_100247937 180
419 3300026116 Ga0207674_11061223 Ga0207674_110612232 180
420 3300026142 Ga0207698_10030305 Ga0207698_100303053 180
421 3300037471 Ga0395905_0012524 Ga0395905_0012524_3101_3643 180
422 3300039437 Ga0436365_0240348 Ga0436365_0240348_464_1015 180
423 3300042005 Ga0439448_0001045 Ga0439448_0001045_5832_6374 180
424 3300042012 Ga0439455_0000109 Ga0439455_0000109_2327_2869 180
425 3300042157 Ga0439458_0000632 Ga0439458_0000632_4146_4688 180
426 3300044658 Ga0466972_0004177 Ga0466972_0004177_84_626 180
427 3300044683 Ga0466965_0039252 Ga0466965_0039252_1683_2291 180
428 3300044693 Ga0466961_0009863 Ga0466961_0009863_5469_6011 180
429 3300044694 Ga0466963_0005703 Ga0466963_0005703_6258_6803 180
430 3300044706 Ga0466964_0065288 Ga0466964_0065288_360_902 180
431 3300044735 Ga0466968_0104968 Ga0466968_0104968_84_626 180
432 3300045049 Ga0466959_0117667 Ga0466959_0117667_60_602 180
433 3300045836 Ga0466958_0004385 Ga0466958_0004385_4906_5451 180
434 3300045836 Ga0466958_0680835 Ga0466958_0680835_47_589 180
435 3300045976 Ga0466967_0002129 Ga0466967_0002129_9290_9835 180
436 3300061719 Ga0466962_0006794 Ga0466962_0006794_3597_4142 180
437 3300061719 Ga0466962_0386895 Ga0466962_0386895_25_633 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

59

187

0.91

PF08534

Redoxin

Redoxin

57

204

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.8975 23 177
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.8919 23 177
4xs4-assembly1.cif.gz_B-2 salmonella typhimurium ahpc c165s mutant 0.8826 25 177
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.8817 22 172
3sbc-assembly1.cif.gz_E crystal structure of saccharomyces cerevisiae tsa1c47s mutant protein 0.8804 24 179
ID Description Score Start End Superfamily
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9118 23 175 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9082 23 173 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9003 23 175 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8986 23 172 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8975 23 177 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0A1H638-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9768 22 178 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A534AC98-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9688 46 180 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A534AC98-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.955 46 180 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A3D0W881-F1-model_v4 3-demethylubiquinone-9 3-O-methyltransferase 0.9474 23 175 GO:0010420
GO:0016209
GO:0016491
GO:0032259
GO:0061542
AF-A0A511XPW8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9441 38 179 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
89.97 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map