F443873

General Info

Members Datasets Scaffolds Average Seq Length
437 259 874 233

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0192996|Ga0496125_0192996_86_871
Length 261
Sequence MAAPSTGHAGPSVISSLASPRVESDIVGMREIVFDTETTGLNPATGDRLVEIGCVELVNRVETGATFHCYFNPQRSMPYEAEQVHGLSERFLSDKPLFADQVEALMTFIGDSPLVAHNASFDFGFLNWELGACGRPIVDLSRMVDTLQIARKMHPGAKHSLDALCSRYGIDRSHRVKHGALLDAQLLAQLYVELTGGRQIGLSMDAVLVEEVVVVATQRTTVADRILRAARPHFASEEELERHKAFVEKLDAPLWLEGAKG

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
243 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
251 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
252 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
253 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
256 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
257 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
258 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
259 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.38
Nodule 0
Rhizoplane 5.03
Rhizosphere 78.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0192996 3300048928 Bacteria 1343
2 SwRhRL2b_contig_1656465 2162886007 Bacteria 1895
3 JGI24741J21665_1001678 3300001915 Bacteria 6143
4 JGI24752J21851_1000123 3300001976 Bacteria 10617
5 JGI24740J21852_10002101 3300001979 Bacteria 9111
6 JGI24740J21852_10003772 3300001979 Bacteria 6600
7 JGI24740J21852_10017434 3300001979 Bacteria 2569
8 JGI24739J22299_10001042 3300001989 Bacteria 10286
9 JGI24739J22299_10006459 3300001989 Bacteria 4427
10 JGI24737J22298_10002929 3300001990 Bacteria 6049
11 JGI24735J21928_10061010 3300002067 Bacteria 1083
12 JGI24750J21931_1000433 3300002070 Bacteria 6808
13 JGI24748J21848_1000060 3300002074 Bacteria 43952
14 JGI24738J21930_10003724 3300002075 Bacteria 3811
15 JGI24738J21930_10012988 3300002075 Bacteria 1810
16 JGI24034J26672_10000010 3300002239 Bacteria 150746
17 JGI24742J22300_10000743 3300002244 Bacteria 4936
18 JGI24742J22300_10017247 3300002244 Bacteria 1221
19 JGI24751J29686_10005832 3300002459 Bacteria 2513
20 JGI25153J46596_10001130 3300003215 Bacteria 16141
21 Ga0055525_1000118 3300003759 Bacteria 120652
22 Ga0055542_1000076 3300003762 Bacteria 139662
23 Ga0055529_1000004 3300003763 Bacteria 433331
24 Ga0065165_1034173 3300005262 Bacteria 1575
25 Ga0065704_10071035 3300005289 Bacteria 13600
26 Ga0065707_10081714 3300005295 Bacteria 75872
27 Ga0065707_10089356 3300005295 Bacteria 4393
28 Ga0065707_10117631 3300005295 Bacteria 2181
29 Ga0070658_10001706 3300005327 Bacteria 18546
30 Ga0070690_100000034 3300005330 Bacteria 62831
31 Ga0070670_100000027 3300005331 Bacteria 186072
32 Ga0070670_100002129 3300005331 Bacteria 16246
33 Ga0070677_10105969 3300005333 Bacteria 1247
34 Ga0070666_10000009 3300005335 Bacteria 279209
35 Ga0070666_10024671 3300005335 Bacteria 3919
36 Ga0068868_100000924 3300005338 Bacteria 20001
37 Ga0068868_100138288 3300005338 Bacteria 1998
38 Ga0070660_100001100 3300005339 Bacteria 18179
39 Ga0070660_100012462 3300005339 Bacteria 6072
40 Ga0070689_100006132 3300005340 Bacteria 8284
41 Ga0070689_100379622 3300005340 Bacteria 1191
42 Ga0070661_100007093 3300005344 Bacteria 7728
43 Ga0070668_100000001 3300005347 Bacteria 275905
44 Ga0070668_100034767 3300005347 Bacteria 3841
45 Ga0070668_100074972 3300005347 Bacteria 2640
46 Ga0070668_100108352 3300005347 Bacteria 2209
47 Ga0070669_100000017 3300005353 Bacteria 195995
48 Ga0070669_100011473 3300005353 Bacteria 6292
49 Ga0070675_100008791 3300005354 Bacteria 7845
50 Ga0070675_100057816 3300005354 Bacteria 3197
51 Ga0070671_100000106 3300005355 Bacteria 53385
52 Ga0070671_100547712 3300005355 Bacteria 997
53 Ga0070674_100126793 3300005356 Bacteria 1897
54 Ga0070673_100085818 3300005364 Bacteria 2564
55 Ga0070688_100000672 3300005365 Bacteria 17030
56 Ga0070659_100000005 3300005366 Bacteria 259902
57 Ga0070667_100000006 3300005367 Bacteria 336732
58 Ga0070667_100000066 3300005367 Bacteria 134529
59 Ga0070667_100000280 3300005367 Bacteria 58186
60 Ga0070667_100032118 3300005367 Bacteria 4378
61 Ga0070667_100042094 3300005367 Bacteria 3832
62 Ga0070663_100159881 3300005455 Bacteria 1733
63 Ga0070678_100010458 3300005456 Bacteria 5672
64 Ga0070662_100028024 3300005457 Bacteria 3917
65 Ga0070662_100203968 3300005457 Bacteria 1570
66 Ga0068867_100191799 3300005459 Bacteria 1631
67 Ga0070685_10000274 3300005466 Bacteria 33246
68 Ga0068853_100002208 3300005539 Bacteria 14538
69 Ga0068853_100029785 3300005539 Bacteria 4605
70 Ga0068853_100132637 3300005539 Bacteria 2231
71 Ga0070672_100042238 3300005543 Bacteria 3510
72 Ga0070686_100000018 3300005544 Bacteria 140685
73 Ga0070665_100000043 3300005548 Bacteria 279774
74 Ga0070665_100000071 3300005548 Bacteria 200675
75 Ga0068855_100277200 3300005563 Bacteria 1863
76 Ga0068855_100422963 3300005563 Bacteria 1457
77 Ga0068855_100526022 3300005563 Bacteria 1282
78 Ga0070664_100028798 3300005564 Bacteria 4625
79 Ga0068857_100019222 3300005577 Bacteria 5998
80 Ga0068857_100024654 3300005577 Bacteria 5297
81 Ga0068857_100024821 3300005577 Bacteria 5279
82 Ga0068857_100091699 3300005577 Bacteria 2720
83 Ga0068854_100030979 3300005578 Bacteria 3714
84 Ga0068856_100274186 3300005614 Bacteria 1703
85 Ga0068852_100024322 3300005616 Bacteria 4894
86 Ga0068859_100004549 3300005617 Bacteria 14141
87 Ga0068859_100009268 3300005617 Bacteria 9941
88 Ga0068859_100033910 3300005617 Bacteria 5125
89 Ga0068859_100249239 3300005617 Bacteria 1866
90 Ga0068864_100000083 3300005618 Bacteria 100972
91 Ga0068864_100007374 3300005618 Bacteria 9051
92 Ga0068861_100004424 3300005719 Bacteria 9424
93 Ga0068861_100192891 3300005719 Bacteria 1704
94 Ga0068851_10002233 3300005834 Bacteria 8521
95 Ga0068863_100000025 3300005841 Bacteria 186072
96 Ga0068863_100000197 3300005841 Bacteria 64182
97 Ga0068863_100008301 3300005841 Bacteria 10148
98 Ga0068863_100046477 3300005841 Bacteria 4120
99 Ga0068863_100078264 3300005841 Bacteria 3131
100 Ga0068858_100000348 3300005842 Bacteria 48656
101 Ga0068858_100003670 3300005842 Bacteria 15204
102 Ga0068860_100000013 3300005843 Bacteria 323055
103 Ga0068860_100000022 3300005843 Bacteria 279209
104 Ga0068860_100000074 3300005843 Bacteria 173022
105 Ga0068860_100042030 3300005843 Bacteria 4368
106 Ga0068862_100000027 3300005844 Bacteria 186072
107 Ga0068862_100000070 3300005844 Bacteria 122289
108 Ga0068862_100000898 3300005844 Bacteria 28838
109 Ga0081455_10000244 3300005937 Bacteria 70746
110 Ga0075368_10110281 3300006042 Bacteria 1134
111 Ga0075364_10236678 3300006051 Bacteria 1240
112 Ga0075369_10009966 3300006186 Bacteria 3709
113 Ga0075366_10045582 3300006195 Bacteria 2598
114 Ga0097621_100042657 3300006237 Bacteria 3655
115 Ga0068871_100066034 3300006358 Bacteria 2965
116 Ga0097620_100004549 3300006931 Bacteria 14141
117 Ga0097620_100009268 3300006931 Bacteria 9941
118 Ga0097620_100033910 3300006931 Bacteria 5125
119 Ga0097620_100249234 3300006931 Bacteria 1866
120 Ga0105251_10000138 3300009011 Bacteria 74430
121 Ga0105250_10104734 3300009092 Bacteria 1156
122 Ga0105245_10234477 3300009098 Bacteria 1776
123 Ga0105245_10472461 3300009098 Bacteria 1266
124 Ga0105243_10000490 3300009148 Bacteria 40402
125 Ga0105241_10006458 3300009174 Bacteria 8643
126 Ga0105242_10333534 3300009176 Bacteria 1395
127 Ga0105248_10000026 3300009177 Bacteria 257155
128 Ga0105248_10000081 3300009177 Bacteria 111105
129 Ga0105248_10002998 3300009177 Bacteria 18724
130 Ga0105237_10095815 3300009545 Bacteria 2957
131 Ga0105238_10082740 3300009551 Bacteria 3200
132 Ga0105238_10180295 3300009551 Bacteria 2089
133 Ga0105249_10000014 3300009553 Bacteria 283274
134 Ga0105249_10000123 3300009553 Bacteria 104747
135 Ga0105249_10317136 3300009553 Bacteria 1569
136 Ga0105249_10410000 3300009553 Bacteria 1387
137 Ga0105249_10456963 3300009553 Bacteria 1316
138 Ga0105249_10585076 3300009553 Bacteria 1170
139 Ga0105239_10225635 3300010375 Bacteria 2101
140 Ga0105246_10251867 3300011119 Bacteria 1402
141 Ga0157373_10211305 3300013100 Bacteria 1368
142 Ga0157371_10000062 3300013102 Bacteria 169669
143 Ga0157369_10283458 3300013105 Bacteria 1725
144 Ga0157374_10036669 3300013296 Bacteria 4493
145 Ga0157378_10007952 3300013297 Bacteria 9255
146 Ga0163162_10230793 3300013306 Bacteria 1981
147 Ga0157372_10133497 3300013307 Bacteria 2858
148 Ga0157372_10185617 3300013307 Bacteria 2408
149 Ga0163163_10070722 3300014325 Bacteria 3475
150 Ga0163163_10407025 3300014325 Bacteria 1419
151 Ga0157380_10000040 3300014326 Bacteria 76401
152 Ga0157380_10000292 3300014326 Bacteria 30110
153 Ga0157380_10977836 3300014326 Bacteria 878
154 Ga0157377_10049334 3300014745 Bacteria 2366
155 Ga0157379_10013441 3300014968 Bacteria 7170
156 Ga0157379_10063028 3300014968 Bacteria 3315
157 Ga0163161_10000057 3300017792 Bacteria 114339
158 Ga0163161_10248759 3300017792 Bacteria 1385
159 Ga0163161_10461893 3300017792 Bacteria 1028
160 Ga0213876_10246210 3300021384 Bacteria 950
161 Ga0213875_10000166 3300021388 Bacteria 68786
162 Ga0209674_103795 3300025226 Bacteria 2663
163 Ga0209563_100070 3300025230 Bacteria 249779
164 Ga0209677_109035 3300025253 Bacteria 1841
165 Ga0209148_1000008 3300025254 Bacteria 1504371
166 Ga0209233_1009456 3300025261 Bacteria 2964
167 Ga0209455_1000002 3300025272 Bacteria 1505459
168 Ga0209758_1000007 3300025297 Bacteria 1270410
169 Ga0207656_10000493 3300025321 Bacteria 13053
170 Ga0207713_1002556 3300025735 Bacteria 13146
171 Ga0207688_10012285 3300025901 Bacteria 4659
172 Ga0207688_10076101 3300025901 Bacteria 1911
173 Ga0207680_10000007 3300025903 Bacteria 623574
174 Ga0207680_10065924 3300025903 Bacteria 2225
175 Ga0207680_10126412 3300025903 Bacteria 1679
176 Ga0207647_10179313 3300025904 Bacteria 1231
177 Ga0207645_10014676 3300025907 Bacteria 5230
178 Ga0207654_10000226 3300025911 Bacteria 34521
179 Ga0207695_10016920 3300025913 Bacteria 8508
180 Ga0207671_10012542 3300025914 Bacteria 6807
181 Ga0207662_10129771 3300025918 Bacteria 1588
182 Ga0207657_10005712 3300025919 Bacteria 12985
183 Ga0207657_10009722 3300025919 Bacteria 9644
184 Ga0207649_10048437 3300025920 Bacteria 2621
185 Ga0207681_10000074 3300025923 Bacteria 89861
186 Ga0207681_10031885 3300025923 Bacteria 3445
187 Ga0207694_10014069 3300025924 Bacteria 6031
188 Ga0207650_10000056 3300025925 Bacteria 157972
189 Ga0207650_10003426 3300025925 Bacteria 10905
190 Ga0207650_10012381 3300025925 Bacteria 5889
191 Ga0207659_10003816 3300025926 Bacteria 9086
192 Ga0207659_10044203 3300025926 Bacteria 3133
193 Ga0207687_10149347 3300025927 Bacteria 1781
194 Ga0207644_10000047 3300025931 Bacteria 103158
195 Ga0207644_10002467 3300025931 Bacteria 11927
196 Ga0207690_10000020 3300025932 Bacteria 218439
197 Ga0207690_10003226 3300025932 Bacteria 9791
198 Ga0207690_10411547 3300025932 Bacteria 1080
199 Ga0207706_10004328 3300025933 Bacteria 13327
200 Ga0207706_10128036 3300025933 Bacteria 2233
201 Ga0207709_10000005 3300025935 Bacteria 806813
202 Ga0207670_10009088 3300025936 Bacteria 5646
203 Ga0207711_10000004 3300025941 Bacteria 870636
204 Ga0207711_10004385 3300025941 Bacteria 12034
205 Ga0207711_10018542 3300025941 Bacteria 5787
206 Ga0207661_10183826 3300025944 Bacteria 1828
207 Ga0207679_10075982 3300025945 Bacteria 2551
208 Ga0207667_10000001 3300025949 Bacteria 1178522
209 Ga0207667_10068993 3300025949 Bacteria 3680
210 Ga0207667_10458560 3300025949 Bacteria 1295
211 Ga0207712_10000004 3300025961 Bacteria 614655
212 Ga0207712_10000102 3300025961 Bacteria 96444
213 Ga0207712_10228753 3300025961 Bacteria 1491
214 Ga0207712_10302342 3300025961 Bacteria 1313
215 Ga0207668_10000009 3300025972 Bacteria 188071
216 Ga0207668_10024009 3300025972 Bacteria 3929
217 Ga0207668_10092959 3300025972 Bacteria 2221
218 Ga0207668_10100260 3300025972 Bacteria 2150
219 Ga0207640_10002461 3300025981 Bacteria 9912
220 Ga0207640_10062990 3300025981 Bacteria 2463
221 Ga0207658_10000010 3300025986 Bacteria 240224
222 Ga0207658_10000132 3300025986 Bacteria 80078
223 Ga0207658_10000712 3300025986 Bacteria 28818
224 Ga0207658_10001639 3300025986 Bacteria 17148
225 Ga0207677_10000100 3300026023 Bacteria 70908
226 Ga0207677_10241270 3300026023 Bacteria 1462
227 Ga0207703_10000368 3300026035 Bacteria 48197
228 Ga0207703_10003639 3300026035 Bacteria 12848
229 Ga0207639_10000504 3300026041 Bacteria 27007
230 Ga0207639_10010030 3300026041 Bacteria 6548
231 Ga0207639_10055673 3300026041 Bacteria 3028
232 Ga0207678_10007090 3300026067 Bacteria 9943
233 Ga0207678_10015229 3300026067 Bacteria 6765
234 Ga0207702_10000862 3300026078 Bacteria 31638
235 Ga0207641_10000018 3300026088 Bacteria 298209
236 Ga0207641_10000192 3300026088 Bacteria 83746
237 Ga0207641_10001281 3300026088 Bacteria 25019
238 Ga0207641_10004714 3300026088 Bacteria 11760
239 Ga0207641_10009028 3300026088 Bacteria 8235
240 Ga0207648_10064656 3300026089 Bacteria 3188
241 Ga0207676_10000027 3300026095 Bacteria 245868
242 Ga0207676_10004831 3300026095 Bacteria 9557
243 Ga0207674_10010801 3300026116 Bacteria 10296
244 Ga0207674_10013140 3300026116 Bacteria 9215
245 Ga0207674_10019828 3300026116 Bacteria 7276
246 Ga0207674_10020546 3300026116 Bacteria 7131
247 Ga0207675_100001487 3300026118 Bacteria 23519
248 Ga0207683_10002482 3300026121 Bacteria 16096
249 Ga0207683_10387919 3300026121 Bacteria 1284
250 Ga0207698_10001942 3300026142 Bacteria 12137
251 Ga0207698_10154015 3300026142 Bacteria 1999
252 Ga0209813_10097125 3300027866 Bacteria 997
253 Ga0268266_10000002 3300028379 Bacteria 3059047
254 Ga0268266_10000040 3300028379 Bacteria 323843
255 Ga0268265_10000042 3300028380 Bacteria 186086
256 Ga0268265_10001721 3300028380 Bacteria 17706
257 Ga0268265_10002177 3300028380 Bacteria 15159
258 Ga0268264_10000003 3300028381 Bacteria 1141976
259 Ga0268264_10000039 3300028381 Bacteria 376641
260 Ga0268264_10000070 3300028381 Bacteria 268524
261 Ga0268264_10030098 3300028381 Bacteria 4451
262 Ga0307517_10020979 3300028786 Bacteria 8286
263 Ga0307408_100008291 3300031548 Bacteria 6860
264 Ga0307408_100022549 3300031548 Bacteria 4280
265 Ga0307405_10003917 3300031731 Bacteria 6951
266 Ga0307405_10011962 3300031731 Bacteria 4573
267 Ga0307413_10004948 3300031824 Bacteria 5873
268 Ga0307413_10114596 3300031824 Bacteria 1812
269 Ga0307413_10237323 3300031824 Bacteria 1343
270 Ga0307413_10316778 3300031824 Bacteria 1190
271 Ga0307410_10172743 3300031852 Bacteria 1630
272 Ga0307406_10018370 3300031901 Bacteria 4085
273 Ga0307407_10414674 3300031903 Bacteria 969
274 Ga0307412_10004837 3300031911 Bacteria 7515
275 Ga0307412_10016556 3300031911 Bacteria 4395
276 Ga0307412_10074066 3300031911 Bacteria 2332
277 Ga0307412_10104795 3300031911 Bacteria 2007
278 Ga0307409_100066065 3300031995 Bacteria 2850
279 Ga0307416_100018028 3300032002 Bacteria 4960
280 Ga0307414_10000567 3300032004 Bacteria 19287
281 Ga0307414_10041877 3300032004 Bacteria 3106
282 Ga0307411_10049197 3300032005 Bacteria 2738
283 Ga0307411_10125430 3300032005 Bacteria 1866
284 Ga0307411_10550743 3300032005 Bacteria 984
285 Ga0307415_100075837 3300032126 Bacteria 2381
286 Ga0307415_100213900 3300032126 Bacteria 1540
287 Ga0307510_10040429 3300033180 Bacteria 5120
288 Ga0373937_0137931 3300036401 Bacteria 2281
289 Ga0395899_0183352 3300037312 Bacteria 1468
290 Ga0395905_0321393 3300037471 Bacteria 1437
291 Ga0395905_0447918 3300037471 Bacteria 1189
292 Ga0436364_0545952 3300037853 Bacteria 79385
293 Ga0395901_0035103 3300038443 Bacteria 5182
294 Ga0436365_1521972 3300039437 Bacteria 2494
295 Ga0439465_0178474 3300041413 Bacteria 768
296 Ga0439448_0033433 3300042005 Bacteria 1641
297 Ga0439432_027535 3300042006 Bacteria 1855
298 Ga0439449_0210924 3300042007 Bacteria 727
299 Ga0450912_003877 3300042116 Bacteria 1088
300 Ga0495617_005689 3300046452 Bacteria 4407
301 Ga0495617_107108 3300046452 Bacteria 906
302 Ga0495629_0160457 3300046459 Bacteria 1562
303 Ga0495650_0000995 3300046471 Bacteria 32148
304 Ga0495639_0100852 3300046475 Bacteria 1363
305 Ga0495584_0004717 3300046491 Bacteria 7301
306 Ga0495585_0015690 3300046492 Bacteria 4399
307 Ga0495596_0120866 3300046500 Bacteria 1017
308 Ga0495583_0001362 3300046506 Bacteria 25203
309 Ga0495583_0002364 3300046506 Bacteria 16292
310 Ga0495606_0155831 3300046507 Bacteria 1336
311 Ga0495606_0242743 3300046507 Bacteria 1003
312 Ga0495606_0330534 3300046507 Bacteria 815
313 Ga0495616_0000010 3300046513 Bacteria 224378
314 Ga0495616_0127527 3300046513 Bacteria 1169
315 Ga0495631_0059676 3300046518 Bacteria 1656
316 Ga0495631_0098522 3300046518 Bacteria 1258
317 Ga0495643_0001994 3300046522 Bacteria 17059
318 Ga0495648_0000323 3300046524 Bacteria 53106
319 Ga0495648_0232430 3300046524 Bacteria 902
320 Ga0495663_0001470 3300046525 Bacteria 7417
321 Ga0495642_0003213 3300046528 Bacteria 6481
322 Ga0495654_0002383 3300046530 Bacteria 12125
323 Ga0495587_0454305 3300046536 Bacteria 710
324 Ga0495622_0003174 3300046557 Bacteria 7782
325 Ga0495622_0004311 3300046557 Bacteria 6626
326 Ga0495633_0000494 3300046558 Bacteria 39797
327 Ga0495633_0093877 3300046558 Bacteria 1394
328 Ga0495633_0110590 3300046558 Bacteria 1274
329 Ga0495668_0000059 3300046616 Bacteria 194951
330 Ga0495668_0001218 3300046616 Bacteria 26031
331 Ga0495668_0004413 3300046616 Bacteria 10000
332 Ga0495668_0005147 3300046616 Bacteria 8979
333 Ga0495668_0008222 3300046616 Bacteria 6545
334 Ga0495611_0005927 3300046648 Bacteria 5213
335 Ga0495625_0000559 3300046660 Bacteria 54547
336 Ga0495625_0009358 3300046660 Bacteria 8205
337 Ga0495625_0416434 3300046660 Bacteria 836
338 Ga0495661_0052001 3300046665 Bacteria 2471
339 Ga0495669_0000628 3300046684 Bacteria 15338
340 Ga0495670_0073147 3300046691 Bacteria 1737
341 Ga0495671_0040280 3300046692 Bacteria 2356
342 Ga0495649_0072619 3300046694 Bacteria 1844
343 Ga0495600_0006647 3300046809 Bacteria 7044
344 Ga0495660_0013474 3300046810 Bacteria 4738
345 Ga0495660_0194054 3300046810 Bacteria 974
346 Ga0495636_0026407 3300047318 Bacteria 2363
347 Ga0495683_0018248 3300047323 Bacteria 3629
348 Ga0495683_0088093 3300047323 Bacteria 1507
349 Ga0495687_000152 3300047443 Bacteria 105602
350 Ga0495687_000517 3300047443 Bacteria 46300
351 Ga0495677_0003238 3300047445 Bacteria 6350
352 Ga0495679_036525 3300047446 Bacteria 1551
353 Ga0495685_084437 3300047447 Bacteria 1056
354 Ga0495673_0045412 3300047469 Bacteria 1953
355 Ga0495681_0006423 3300047470 Bacteria 7729
356 Ga0495681_0040983 3300047470 Bacteria 2251
357 Ga0495686_0000209 3300047472 Bacteria 108972
358 Ga0495615_0019092 3300048090 Bacteria 1518
359 Ga0496101_0140396 3300048904 Bacteria 1841
360 Ga0496102_0000010 3300048905 Bacteria 324617
361 Ga0496102_0000184 3300048905 Bacteria 84568
362 Ga0496102_0002152 3300048905 Bacteria 16913
363 Ga0496102_0237706 3300048905 Bacteria 1718
364 Ga0496103_0000082 3300048906 Bacteria 109451
365 Ga0496103_0000099 3300048906 Bacteria 94046
366 Ga0496103_0004744 3300048906 Bacteria 8222
367 Ga0496103_0050060 3300048906 Bacteria 2584
368 Ga0496104_0002902 3300048907 Bacteria 14768
369 Ga0496104_0107098 3300048907 Bacteria 2679
370 Ga0496104_0432745 3300048907 Bacteria 1227
371 Ga0496105_0000589 3300048908 Bacteria 24200
372 Ga0496105_0078145 3300048908 Bacteria 2733
373 Ga0496105_0226257 3300048908 Bacteria 1521
374 Ga0496107_0037533 3300048910 Bacteria 3477
375 Ga0496107_0174105 3300048910 Bacteria 1597
376 Ga0496110_0007569 3300048913 Bacteria 8677
377 Ga0496111_0020647 3300048914 Bacteria 4588
378 Ga0496113_0038296 3300048916 Bacteria 3525
379 Ga0496114_0016017 3300048917 Bacteria 6032
380 Ga0496115_0000066 3300048918 Bacteria 95550
381 Ga0496116_0004459 3300048919 Bacteria 13338
382 Ga0496116_0020607 3300048919 Bacteria 5002
383 Ga0496117_0000037 3300048920 Bacteria 324960
384 Ga0496117_0001024 3300048920 Bacteria 42696
385 Ga0496117_0004510 3300048920 Bacteria 15302
386 Ga0496118_0000034 3300048921 Bacteria 322764
387 Ga0496118_0000154 3300048921 Bacteria 122224
388 Ga0496118_0000262 3300048921 Bacteria 92154
389 Ga0496118_0023380 3300048921 Bacteria 5369
390 Ga0496118_0255758 3300048921 Bacteria 992
391 Ga0496119_0065063 3300048922 Bacteria 2162
392 Ga0496119_0133522 3300048922 Bacteria 1349
393 Ga0496120_0008887 3300048923 Bacteria 7196
394 Ga0496120_0024327 3300048923 Bacteria 3778
395 Ga0496121_0010925 3300048924 Bacteria 10142
396 Ga0496123_0007685 3300048926 Bacteria 10076
397 Ga0496124_0000033 3300048927 Bacteria 330586
398 Ga0496124_0000291 3300048927 Bacteria 94493
399 Ga0496124_0110754 3300048927 Bacteria 2210
400 Ga0496125_0001248 3300048928 Bacteria 37996
401 Ga0496125_0035714 3300048928 Bacteria 4354
402 Ga0496125_0136440 3300048928 Bacteria 1715
403 Ga0496126_0001079 3300048929 Bacteria 45863
404 Ga0501046_0293108 3300049580 Bacteria 1190
405 Ga0501047_0001071 3300049581 Bacteria 27278
406 Ga0501047_0276995 3300049581 Bacteria 1523
407 Ga0501249_032319 3300049679 Bacteria 1170
408 Ga0501044_0359087 3300049823 Bacteria 1375
409 Ga0501044_0379516 3300049823 Bacteria 1329
410 nmdc:mga00v17_191493_c1 3300050491 Bacteria 1321
411 nmdc:mga0k408_21209_c1 3300050493 Bacteria 3648
412 nmdc:mga0k408_5427_c1 3300050493 Bacteria 6783
413 Ga0500610_0000222 3300053079 Bacteria 17254
414 Ga0500643_000336 3300053087 Bacteria 37374
415 Ga0500643_000578 3300053087 Bacteria 25456
416 Ga0500643_002054 3300053087 Bacteria 10775
417 Ga0500643_036749 3300053087 Bacteria 1462
418 Ga0500647_0165473 3300053091 Bacteria 1024
419 Ga0500583_0213752 3300053092 Bacteria 957
420 Ga0500594_0001095 3300053118 Bacteria 5806
421 Ga0500595_001305 3300053119 Bacteria 13559
422 Ga0500607_011812 3300053121 Bacteria 5150
423 Ga0500618_001796 3300053125 Bacteria 9055
424 Ga0500642_0000830 3300053130 Bacteria 9013
425 Ga0500568_0026101 3300053139 Bacteria 2455
426 Ga0500604_0015190 3300053151 Bacteria 2106
427 Ga0500604_0041798 3300053151 Bacteria 1388
428 Ga0500619_000548 3300053154 Bacteria 6441
429 Ga0500627_0003656 3300053158 Bacteria 4806
430 Ga0500627_0076433 3300053158 Bacteria 1489
431 Ga0500611_000762 3300053727 Bacteria 3317
432 Ga0500645_002663 3300053730 Bacteria 7780
433 Ga0500661_000145 3300055283 Bacteria 12118
434 2643726802 2643221541 Bacteria 5498788
435 2644046157 2643221606 Bacteria 5588032
436 2644393032 2643221671 Bacteria 5496681
437 2882809266 2882806704 Bacteria 3007728
438 Ga0496125_0192996
439 SwRhRL2b_contig_1656465
440 JGI24741J21665_1001678
441 JGI24752J21851_1000123
442 JGI24740J21852_10002101
443 JGI24740J21852_10003772
444 JGI24740J21852_10017434
445 JGI24739J22299_10001042
446 JGI24739J22299_10006459
447 JGI24737J22298_10002929
448 JGI24735J21928_10061010
449 JGI24750J21931_1000433
450 JGI24748J21848_1000060
451 JGI24738J21930_10003724
452 JGI24738J21930_10012988
453 JGI24034J26672_10000010
454 JGI24742J22300_10000743
455 JGI24742J22300_10017247
456 JGI24751J29686_10005832
457 JGI25153J46596_10001130
458 Ga0055525_1000118
459 Ga0055542_1000076
460 Ga0055529_1000004
461 Ga0065165_1034173
462 Ga0065704_10071035
463 Ga0065707_10081714
464 Ga0065707_10089356
465 Ga0065707_10117631
466 Ga0070658_10001706
467 Ga0070690_100000034
468 Ga0070670_100000027
469 Ga0070670_100002129
470 Ga0070677_10105969
471 Ga0070666_10000009
472 Ga0070666_10024671
473 Ga0068868_100000924
474 Ga0068868_100138288
475 Ga0070660_100001100
476 Ga0070660_100012462
477 Ga0070689_100006132
478 Ga0070689_100379622
479 Ga0070661_100007093
480 Ga0070668_100000001
481 Ga0070668_100034767
482 Ga0070668_100074972
483 Ga0070668_100108352
484 Ga0070669_100000017
485 Ga0070669_100011473
486 Ga0070675_100008791
487 Ga0070675_100057816
488 Ga0070671_100000106
489 Ga0070671_100547712
490 Ga0070674_100126793
491 Ga0070673_100085818
492 Ga0070688_100000672
493 Ga0070659_100000005
494 Ga0070667_100000006
495 Ga0070667_100000066
496 Ga0070667_100000280
497 Ga0070667_100032118
498 Ga0070667_100042094
499 Ga0070663_100159881
500 Ga0070678_100010458
501 Ga0070662_100028024
502 Ga0070662_100203968
503 Ga0068867_100191799
504 Ga0070685_10000274
505 Ga0068853_100002208
506 Ga0068853_100029785
507 Ga0068853_100132637
508 Ga0070672_100042238
509 Ga0070686_100000018
510 Ga0070665_100000043
511 Ga0070665_100000071
512 Ga0068855_100277200
513 Ga0068855_100422963
514 Ga0068855_100526022
515 Ga0070664_100028798
516 Ga0068857_100019222
517 Ga0068857_100024654
518 Ga0068857_100024821
519 Ga0068857_100091699
520 Ga0068854_100030979
521 Ga0068856_100274186
522 Ga0068852_100024322
523 Ga0068859_100004549
524 Ga0068859_100009268
525 Ga0068859_100033910
526 Ga0068859_100249239
527 Ga0068864_100000083
528 Ga0068864_100007374
529 Ga0068861_100004424
530 Ga0068861_100192891
531 Ga0068851_10002233
532 Ga0068863_100000025
533 Ga0068863_100000197
534 Ga0068863_100008301
535 Ga0068863_100046477
536 Ga0068863_100078264
537 Ga0068858_100000348
538 Ga0068858_100003670
539 Ga0068860_100000013
540 Ga0068860_100000022
541 Ga0068860_100000074
542 Ga0068860_100042030
543 Ga0068862_100000027
544 Ga0068862_100000070
545 Ga0068862_100000898
546 Ga0081455_10000244
547 Ga0075368_10110281
548 Ga0075364_10236678
549 Ga0075369_10009966
550 Ga0075366_10045582
551 Ga0097621_100042657
552 Ga0068871_100066034
553 Ga0097620_100004549
554 Ga0097620_100009268
555 Ga0097620_100033910
556 Ga0097620_100249234
557 Ga0105251_10000138
558 Ga0105250_10104734
559 Ga0105245_10234477
560 Ga0105245_10472461
561 Ga0105243_10000490
562 Ga0105241_10006458
563 Ga0105242_10333534
564 Ga0105248_10000026
565 Ga0105248_10000081
566 Ga0105248_10002998
567 Ga0105237_10095815
568 Ga0105238_10082740
569 Ga0105238_10180295
570 Ga0105249_10000014
571 Ga0105249_10000123
572 Ga0105249_10317136
573 Ga0105249_10410000
574 Ga0105249_10456963
575 Ga0105249_10585076
576 Ga0105239_10225635
577 Ga0105246_10251867
578 Ga0157373_10211305
579 Ga0157371_10000062
580 Ga0157369_10283458
581 Ga0157374_10036669
582 Ga0157378_10007952
583 Ga0163162_10230793
584 Ga0157372_10133497
585 Ga0157372_10185617
586 Ga0163163_10070722
587 Ga0163163_10407025
588 Ga0157380_10000040
589 Ga0157380_10000292
590 Ga0157380_10977836
591 Ga0157377_10049334
592 Ga0157379_10013441
593 Ga0157379_10063028
594 Ga0163161_10000057
595 Ga0163161_10248759
596 Ga0163161_10461893
597 Ga0213876_10246210
598 Ga0213875_10000166
599 Ga0209674_103795
600 Ga0209563_100070
601 Ga0209677_109035
602 Ga0209148_1000008
603 Ga0209233_1009456
604 Ga0209455_1000002
605 Ga0209758_1000007
606 Ga0207656_10000493
607 Ga0207713_1002556
608 Ga0207688_10012285
609 Ga0207688_10076101
610 Ga0207680_10000007
611 Ga0207680_10065924
612 Ga0207680_10126412
613 Ga0207647_10179313
614 Ga0207645_10014676
615 Ga0207654_10000226
616 Ga0207695_10016920
617 Ga0207671_10012542
618 Ga0207662_10129771
619 Ga0207657_10005712
620 Ga0207657_10009722
621 Ga0207649_10048437
622 Ga0207681_10000074
623 Ga0207681_10031885
624 Ga0207694_10014069
625 Ga0207650_10000056
626 Ga0207650_10003426
627 Ga0207650_10012381
628 Ga0207659_10003816
629 Ga0207659_10044203
630 Ga0207687_10149347
631 Ga0207644_10000047
632 Ga0207644_10002467
633 Ga0207690_10000020
634 Ga0207690_10003226
635 Ga0207690_10411547
636 Ga0207706_10004328
637 Ga0207706_10128036
638 Ga0207709_10000005
639 Ga0207670_10009088
640 Ga0207711_10000004
641 Ga0207711_10004385
642 Ga0207711_10018542
643 Ga0207661_10183826
644 Ga0207679_10075982
645 Ga0207667_10000001
646 Ga0207667_10068993
647 Ga0207667_10458560
648 Ga0207712_10000004
649 Ga0207712_10000102
650 Ga0207712_10228753
651 Ga0207712_10302342
652 Ga0207668_10000009
653 Ga0207668_10024009
654 Ga0207668_10092959
655 Ga0207668_10100260
656 Ga0207640_10002461
657 Ga0207640_10062990
658 Ga0207658_10000010
659 Ga0207658_10000132
660 Ga0207658_10000712
661 Ga0207658_10001639
662 Ga0207677_10000100
663 Ga0207677_10241270
664 Ga0207703_10000368
665 Ga0207703_10003639
666 Ga0207639_10000504
667 Ga0207639_10010030
668 Ga0207639_10055673
669 Ga0207678_10007090
670 Ga0207678_10015229
671 Ga0207702_10000862
672 Ga0207641_10000018
673 Ga0207641_10000192
674 Ga0207641_10001281
675 Ga0207641_10004714
676 Ga0207641_10009028
677 Ga0207648_10064656
678 Ga0207676_10000027
679 Ga0207676_10004831
680 Ga0207674_10010801
681 Ga0207674_10013140
682 Ga0207674_10019828
683 Ga0207674_10020546
684 Ga0207675_100001487
685 Ga0207683_10002482
686 Ga0207683_10387919
687 Ga0207698_10001942
688 Ga0207698_10154015
689 Ga0209813_10097125
690 Ga0268266_10000002
691 Ga0268266_10000040
692 Ga0268265_10000042
693 Ga0268265_10001721
694 Ga0268265_10002177
695 Ga0268264_10000003
696 Ga0268264_10000039
697 Ga0268264_10000070
698 Ga0268264_10030098
699 Ga0307517_10020979
700 Ga0307408_100008291
701 Ga0307408_100022549
702 Ga0307405_10003917
703 Ga0307405_10011962
704 Ga0307413_10004948
705 Ga0307413_10114596
706 Ga0307413_10237323
707 Ga0307413_10316778
708 Ga0307410_10172743
709 Ga0307406_10018370
710 Ga0307407_10414674
711 Ga0307412_10004837
712 Ga0307412_10016556
713 Ga0307412_10074066
714 Ga0307412_10104795
715 Ga0307409_100066065
716 Ga0307416_100018028
717 Ga0307414_10000567
718 Ga0307414_10041877
719 Ga0307411_10049197
720 Ga0307411_10125430
721 Ga0307411_10550743
722 Ga0307415_100075837
723 Ga0307415_100213900
724 Ga0307510_10040429
725 Ga0373937_0137931
726 Ga0395899_0183352
727 Ga0395905_0321393
728 Ga0395905_0447918
729 Ga0436364_0545952
730 Ga0395901_0035103
731 Ga0436365_1521972
732 Ga0439465_0178474
733 Ga0439448_0033433
734 Ga0439432_027535
735 Ga0439449_0210924
736 Ga0450912_003877
737 Ga0495617_005689
738 Ga0495617_107108
739 Ga0495629_0160457
740 Ga0495650_0000995
741 Ga0495639_0100852
742 Ga0495584_0004717
743 Ga0495585_0015690
744 Ga0495596_0120866
745 Ga0495583_0001362
746 Ga0495583_0002364
747 Ga0495606_0155831
748 Ga0495606_0242743
749 Ga0495606_0330534
750 Ga0495616_0000010
751 Ga0495616_0127527
752 Ga0495631_0059676
753 Ga0495631_0098522
754 Ga0495643_0001994
755 Ga0495648_0000323
756 Ga0495648_0232430
757 Ga0495663_0001470
758 Ga0495642_0003213
759 Ga0495654_0002383
760 Ga0495587_0454305
761 Ga0495622_0003174
762 Ga0495622_0004311
763 Ga0495633_0000494
764 Ga0495633_0093877
765 Ga0495633_0110590
766 Ga0495668_0000059
767 Ga0495668_0001218
768 Ga0495668_0004413
769 Ga0495668_0005147
770 Ga0495668_0008222
771 Ga0495611_0005927
772 Ga0495625_0000559
773 Ga0495625_0009358
774 Ga0495625_0416434
775 Ga0495661_0052001
776 Ga0495669_0000628
777 Ga0495670_0073147
778 Ga0495671_0040280
779 Ga0495649_0072619
780 Ga0495600_0006647
781 Ga0495660_0013474
782 Ga0495660_0194054
783 Ga0495636_0026407
784 Ga0495683_0018248
785 Ga0495683_0088093
786 Ga0495687_000152
787 Ga0495687_000517
788 Ga0495677_0003238
789 Ga0495679_036525
790 Ga0495685_084437
791 Ga0495673_0045412
792 Ga0495681_0006423
793 Ga0495681_0040983
794 Ga0495686_0000209
795 Ga0495615_0019092
796 Ga0496101_0140396
797 Ga0496102_0000010
798 Ga0496102_0000184
799 Ga0496102_0002152
800 Ga0496102_0237706
801 Ga0496103_0000082
802 Ga0496103_0000099
803 Ga0496103_0004744
804 Ga0496103_0050060
805 Ga0496104_0002902
806 Ga0496104_0107098
807 Ga0496104_0432745
808 Ga0496105_0000589
809 Ga0496105_0078145
810 Ga0496105_0226257
811 Ga0496107_0037533
812 Ga0496107_0174105
813 Ga0496110_0007569
814 Ga0496111_0020647
815 Ga0496113_0038296
816 Ga0496114_0016017
817 Ga0496115_0000066
818 Ga0496116_0004459
819 Ga0496116_0020607
820 Ga0496117_0000037
821 Ga0496117_0001024
822 Ga0496117_0004510
823 Ga0496118_0000034
824 Ga0496118_0000154
825 Ga0496118_0000262
826 Ga0496118_0023380
827 Ga0496118_0255758
828 Ga0496119_0065063
829 Ga0496119_0133522
830 Ga0496120_0008887
831 Ga0496120_0024327
832 Ga0496121_0010925
833 Ga0496123_0007685
834 Ga0496124_0000033
835 Ga0496124_0000291
836 Ga0496124_0110754
837 Ga0496125_0001248
838 Ga0496125_0035714
839 Ga0496125_0136440
840 Ga0496126_0001079
841 Ga0501046_0293108
842 Ga0501047_0001071
843 Ga0501047_0276995
844 Ga0501249_032319
845 Ga0501044_0359087
846 Ga0501044_0379516
847 nmdc:mga00v17_191493_c1
848 nmdc:mga0k408_21209_c1
849 nmdc:mga0k408_5427_c1
850 Ga0500610_0000222
851 Ga0500643_000336
852 Ga0500643_000578
853 Ga0500643_002054
854 Ga0500643_036749
855 Ga0500647_0165473
856 Ga0500583_0213752
857 Ga0500594_0001095
858 Ga0500595_001305
859 Ga0500607_011812
860 Ga0500618_001796
861 Ga0500642_0000830
862 Ga0500568_0026101
863 Ga0500604_0015190
864 Ga0500604_0041798
865 Ga0500619_000548
866 Ga0500627_0003656
867 Ga0500627_0076433
868 Ga0500611_000762
869 Ga0500645_002663
870 Ga0500661_000145
871 2643726802
872 2644046157
873 2644393032
874 2882809266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

32

191

0.96

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

18

179

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.9517 3 168
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.9301 1 168
1j53-assembly1.cif.gz_A structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5 0.9041 3 168
2ido-assembly1.cif.gz_A structure of the e. coli pol iii epsilon-hot proofreading complex 0.904 1 168
8h2f-assembly1.cif.gz_A crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710 0.899 2 167
ID Description Score Start End Superfamily
1j54A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9511 3 168 3.30.420.10
af_B0G161_292_467_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9406 2 166 3.30.420.10
af_Q2FYH5_2_169_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9274 2 167 3.30.420.10
af_O69678_9_183_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9237 2 167 3.30.420.10
af_Q4D4F6_97_312_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9185 6 167 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3M2DS00-F1-model_v4 DNA polymerase III subunit epsilon 0.9953 1 127 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A6L7KNI7-F1-model_v4 DNA polymerase III subunit epsilon 0.9933 1 107 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A2R7RZC3-F1-model_v4 deleted 0.9899 2 169
AF-A0A1M3A6X5-F1-model_v4 deleted 0.9876 1 161
AF-A0A3M2DS00-F1-model_v4 DNA polymerase III subunit epsilon 0.9875 1 127 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004

Map