F443887

General Info

Members Datasets Scaffolds Average Seq Length
437 284 383 391

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0000075|Ga0500583_0000075_29338_30666
Length 442
Sequence LEEIKQAGKFFNLTLISRVKTGHWSMVIKTALQMIQLMANDRKLMSDTTTCRAKFDELLTCVIIPTYNNATTLAGVIADVADYTDHIIVVNDGSTDNTAAIVKEFPYVQYIGYPKNVGKGWALRKGIAYAIEQRYEYAITIDSDGQHFGKDLPVFMEKLETVKDAIIIGARNMNQASVPGKSSFGNKFSNFWFKVETGITMPDTQSGYRLYPLLILQEMRFVTRKYEFEIEVLVKAAWKGAKVVSVPVTVYYAPKEKRISHFRPFKDFTRISILNTVLVLITFLYIKPRDFFRGLFKIKSWRGVIREHLFSPDQPGHIKAISVAFGVFMGIIPIWGFQLATAIFLAFLLRLNKALVIVAANISIPPMIPLIIFLSYKMGALWMPGNAVAFPFTRNISLHAIRHNLQQYIYGSITLAVVAGAIMGLLVFTLLKLTKRKPTPVS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
7 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
8 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
9 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
10 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
11 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
12 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
13 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
14 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
15 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
16 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
17 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
18 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
19 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
20 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
21 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
22 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
23 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
24 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
25 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
26 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
27 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
28 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
29 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
30 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
31 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
32 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
33 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
34 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
35 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
36 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
37 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
38 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
39 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
40 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
41 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
42 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
43 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
44 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
45 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
46 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
47 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
48 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
49 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
53 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
56 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
57 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
186 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
256 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
257 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
258 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
267 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
280 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
281 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
282 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
283 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
284 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.64
Metatranscriptomes 0
Isolates 12.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.67
Nodule 1.37
Rhizoplane 0.46
Rhizosphere 71.17
Stem 0
Stem Tuber 0
Unclassified 15.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1762647 2162886007 Bacteria 207340
2 JGI24740J21852_10010833 3300001979 Bacteria 3490
3 JGI24739J22299_10003878 3300001989 Bacteria 5715
4 JGI24735J21928_10000020 3300002067 Bacteria 108706
5 JGI25154J39366_1000147 3300002738 Bacteria 55316
6 JGI25153J46596_10000327 3300003215 Bacteria 34410
7 rootH1_10052042 3300003316 Bacteria 7012
8 rootH1_10179212 3300003316 Unclassified 2025
9 rootH2_10023047 3300003320 Bacteria 7720
10 rootH2_10043116 3300003320 Bacteria 3377
11 rootH2_10138852 3300003320 Bacteria 2393
12 rootL2_10069393 3300003322 Bacteria 2488
13 rootL2_10100728 3300003322 Bacteria 7210
14 rootL2_10182715 3300003322 Bacteria 2401
15 rootL2_10198531 3300003322 Bacteria 1608
16 rootL2_10302022 3300003322 Bacteria 2775
17 rootH1_10003867 3300003323 Bacteria 6579
18 rootH1_10016547 3300003323 Bacteria 5519
19 rootH1_10075475 3300003323 Bacteria 11129
20 rootH1_10283573 3300003323 Bacteria 2529
21 JGI25160J50197_1004028 3300003354 Bacteria 6412
22 JGI25160J50197_1004042 3300003354 Bacteria 6399
23 Ga0055526_1006255 3300003771 Bacteria 6521
24 Ga0055526_1018009 3300003771 Bacteria 2661
25 Ga0055536_1016494 3300003781 Bacteria 2467
26 Ga0055528_1000329 3300003790 Bacteria 39909
27 Ga0055530_10001924 3300003791 Bacteria 14165
28 Ga0055531_10000728 3300003794 Bacteria 27843
29 Ga0065165_1000102 3300005262 Bacteria 140917
30 Ga0065165_1000638 3300005262 Bacteria 50713
31 Ga0065165_1007541 3300005262 Bacteria 5317
32 Ga0065714_10003718 3300005288 Bacteria 9007
33 Ga0065714_10009906 3300005288 Bacteria 3414
34 Ga0065714_10070793 3300005288 Bacteria 3763
35 Ga0065714_10071344 3300005288 Bacteria 3585
36 Ga0065704_10070151 3300005289 Bacteria 259038
37 Ga0065704_10112697 3300005289 Bacteria 1920
38 Ga0070676_10000231 3300005328 Bacteria 23863
39 Ga0070670_100066766 3300005331 Bacteria 3087
40 Ga0068869_100004602 3300005334 Bacteria 8596
41 Ga0068869_100023230 3300005334 Unclassified 4280
42 Ga0068869_100091462 3300005334 Bacteria 2289
43 Ga0070666_10000078 3300005335 Bacteria 69922
44 Ga0070680_100004723 3300005336 Bacteria 10253
45 Ga0070682_100000921 3300005337 Bacteria 17144
46 Ga0070682_100020245 3300005337 Bacteria 3913
47 Ga0068868_100021953 3300005338 Bacteria 4812
48 Ga0068868_100032379 3300005338 Unclassified 4021
49 Ga0070691_10002805 3300005341 Bacteria 7777
50 Ga0070668_100021951 3300005347 Unclassified 4822
51 Ga0070668_100029978 3300005347 Bacteria 4133
52 Ga0070668_100066138 3300005347 Unclassified 2804
53 Ga0070669_100106510 3300005353 Unclassified 2122
54 Ga0070669_100159615 3300005353 Bacteria 1751
55 Ga0070675_100231001 3300005354 Unclassified 1614
56 Ga0070671_100011438 3300005355 Bacteria 7135
57 Ga0070674_100015145 3300005356 Unclassified 4808
58 Ga0070673_100002509 3300005364 Bacteria 11199
59 Ga0070673_100011349 3300005364 Bacteria 6078
60 Ga0070673_100011776 3300005364 Bacteria 5982
61 Ga0070673_100092482 3300005364 Bacteria 2474
62 Ga0070667_100003107 3300005367 Bacteria 14285
63 Ga0070667_100022639 3300005367 Bacteria 5211
64 Ga0070700_100146549 3300005441 Bacteria 1610
65 Ga0070678_100038839 3300005456 Bacteria 3354
66 Ga0070681_10023543 3300005458 Bacteria 6194
67 Ga0068867_100000586 3300005459 Bacteria 24122
68 Ga0068867_100180117 3300005459 Bacteria 1680
69 Ga0070679_100002055 3300005530 Bacteria 18077
70 Ga0068855_100042323 3300005563 Bacteria 5397
71 Ga0070664_100059331 3300005564 Bacteria 3255
72 Ga0070664_100108570 3300005564 Unclassified 2420
73 Ga0068854_100080648 3300005578 Unclassified 2402
74 Ga0068852_100000614 3300005616 Bacteria 23382
75 Ga0068852_100004514 3300005616 Bacteria 9846
76 Ga0068859_100000003 3300005617 Bacteria 479218
77 Ga0068859_100036482 3300005617 Bacteria 4936
78 Ga0068861_100010660 3300005719 Bacteria 6384
79 Ga0068851_10002384 3300005834 Bacteria 8255
80 Ga0068870_10033831 3300005840 Unclassified 2612
81 Ga0068863_100035807 3300005841 Unclassified 4726
82 Ga0068863_100393265 3300005841 Bacteria 1355
83 Ga0068858_100004533 3300005842 Bacteria 13613
84 Ga0068860_100005293 3300005843 Bacteria 13095
85 Ga0068860_100006921 3300005843 Bacteria 11364
86 Ga0068860_100020540 3300005843 Bacteria 6397
87 Ga0068860_100219141 3300005843 Unclassified 1848
88 Ga0075366_10005072 3300006195 Bacteria 7120
89 Ga0097621_100009014 3300006237 Bacteria 7223
90 Ga0068871_100000154 3300006358 Bacteria 45466
91 Ga0068871_100012369 3300006358 Bacteria 6288
92 Ga0068865_100000172 3300006881 Bacteria 35866
93 Ga0097620_100000003 3300006931 Bacteria 479218
94 Ga0097620_100036482 3300006931 Bacteria 4936
95 Ga0099824_1000500 3300006942 Bacteria 46562
96 Ga0079104_1000079 3300006946 Bacteria 141480
97 Ga0099826_10000143 3300006948 Bacteria 30506
98 Ga0105244_10000054 3300009036 Bacteria 133715
99 Ga0105240_10000101 3300009093 Bacteria 175584
100 Ga0105240_10004797 3300009093 Bacteria 20382
101 Ga0105240_10050461 3300009093 Bacteria 5245
102 Ga0105245_10379716 3300009098 Bacteria 1407
103 Ga0105247_10001017 3300009101 Bacteria 21132
104 Ga0105241_10001703 3300009174 Bacteria 16728
105 Ga0105241_10004067 3300009174 Bacteria 10808
106 Ga0105241_10006808 3300009174 Bacteria 8402
107 Ga0105242_10011131 3300009176 Bacteria 6912
108 Ga0105242_10019379 3300009176 Bacteria 5331
109 Ga0105242_10127341 3300009176 Bacteria 2193
110 Ga0105248_10518213 3300009177 Unclassified 1344
111 Ga0105237_10001455 3300009545 Bacteria 31241
112 Ga0105237_10003207 3300009545 Bacteria 19592
113 Ga0105237_10023518 3300009545 Bacteria 6313
114 Ga0105237_10071364 3300009545 Unclassified 3468
115 Ga0105238_10015346 3300009551 Bacteria 7758
116 Ga0105238_10284671 3300009551 Bacteria 1635
117 Ga0105249_10008242 3300009553 Bacteria 9076
118 Ga0105239_10000860 3300010375 Bacteria 43145
119 Ga0105239_10006763 3300010375 Bacteria 13239
120 Ga0105239_10089400 3300010375 Unclassified 3396
121 Ga0105239_10100102 3300010375 Bacteria 3205
122 Ga0105239_10104779 3300010375 Bacteria 3132
123 Ga0105239_10257710 3300010375 Unclassified 1960
124 Ga0157373_10000035 3300013100 Bacteria 123284
125 Ga0157371_10008439 3300013102 Bacteria 8203
126 Ga0157370_10000334 3300013104 Bacteria 59226
127 Ga0157370_10001492 3300013104 Bacteria 28987
128 Ga0157370_10002126 3300013104 Bacteria 24195
129 Ga0157370_10011207 3300013104 Bacteria 9401
130 Ga0157370_10011403 3300013104 Bacteria 9298
131 Ga0157370_10275078 3300013104 Bacteria 1556
132 Ga0157369_10151920 3300013105 Bacteria 2447
133 Ga0157369_10252975 3300013105 Bacteria 1838
134 Ga0157369_10308199 3300013105 Bacteria 1646
135 Ga0157374_10000849 3300013296 Bacteria 26704
136 Ga0157378_10005955 3300013297 Bacteria 10688
137 Ga0157378_10036092 3300013297 Bacteria 4375
138 Ga0157378_10384734 3300013297 Unclassified 1378
139 Ga0163162_10000568 3300013306 Bacteria 34113
140 Ga0163162_10004141 3300013306 Bacteria 13924
141 Ga0163162_10020344 3300013306 Bacteria 6519
142 Ga0163162_10021702 3300013306 Bacteria 6324
143 Ga0163162_10069742 3300013306 Bacteria 3567
144 Ga0157372_10007433 3300013307 Bacteria 11650
145 Ga0157372_10017611 3300013307 Bacteria 7668
146 Ga0157375_10003003 3300013308 Bacteria 14649
147 Ga0157375_10019808 3300013308 Bacteria 6131
148 Ga0157375_10072146 3300013308 Bacteria 3468
149 Ga0157375_10086210 3300013308 Bacteria 3191
150 Ga0157375_10144097 3300013308 Unclassified 2512
151 Ga0157375_10168380 3300013308 Unclassified 2337
152 Ga0163163_10167448 3300014325 Bacteria 2244
153 Ga0157380_10003502 3300014326 Bacteria 10783
154 Ga0157380_10014687 3300014326 Bacteria 5734
155 Ga0157377_10056671 3300014745 Unclassified 2226
156 Ga0157379_10024689 3300014968 Bacteria 5335
157 Ga0157376_10004045 3300014969 Bacteria 10141
158 Ga0157376_10246770 3300014969 Unclassified 1666
159 Ga0182006_1005643 3300015261 Bacteria 5933
160 Ga0182005_1000171 3300015265 Bacteria 44781
161 Ga0163161_10000091 3300017792 Bacteria 90927
162 Ga0163161_10009402 3300017792 Bacteria 6768
163 Ga0163161_10073707 3300017792 Bacteria 2502
164 Ga0209436_100701 3300025208 Bacteria 14045
165 Ga0209646_1000002 3300025246 Bacteria 1425781
166 Ga0209026_1000226 3300025250 Bacteria 77076
167 Ga0209026_1000260 3300025250 Bacteria 65544
168 Ga0209673_1000208 3300025273 Bacteria 117755
169 Ga0209130_1000665 3300025284 Bacteria 31274
170 Ga0209676_1000116 3300025292 Bacteria 203383
171 Ga0209564_1003551 3300025295 Bacteria 10472
172 Ga0209564_1006892 3300025295 Bacteria 5990
173 Ga0209758_1000944 3300025297 Bacteria 39134
174 Ga0209758_1003688 3300025297 Bacteria 13612
175 Ga0209758_1012274 3300025297 Bacteria 4813
176 Ga0209050_1000134 3300025298 Bacteria 184417
177 Ga0207426_1000051 3300025302 Bacteria 391700
178 Ga0207426_1000357 3300025302 Bacteria 83200
179 Ga0207426_1001033 3300025302 Bacteria 26579
180 Ga0209051_1011905 3300025303 Bacteria 4252
181 Ga0209257_1000001 3300025304 Bacteria 2274655
182 Ga0209257_1005741 3300025304 Bacteria 8494
183 Ga0207656_10002496 3300025321 Bacteria 6217
184 Ga0207656_10064256 3300025321 Bacteria 1617
185 Ga0207655_1000003 3300025728 Bacteria 1081376
186 Ga0207710_10069209 3300025900 Bacteria 1615
187 Ga0207680_10000216 3300025903 Bacteria 27884
188 Ga0207647_10057214 3300025904 Bacteria 2391
189 Ga0207645_10000146 3300025907 Bacteria 55323
190 Ga0207645_10006683 3300025907 Bacteria 8237
191 Ga0207643_10078197 3300025908 Unclassified 1913
192 Ga0207705_10071573 3300025909 Unclassified 2514
193 Ga0207654_10002633 3300025911 Bacteria 9108
194 Ga0207654_10007322 3300025911 Bacteria 5558
195 Ga0207654_10037091 3300025911 Bacteria 2727
196 Ga0207654_10057681 3300025911 Unclassified 2257
197 Ga0207707_10000611 3300025912 Bacteria 35815
198 Ga0207695_10000020 3300025913 Bacteria 723025
199 Ga0207695_10055913 3300025913 Bacteria 4109
200 Ga0207695_10111560 3300025913 Bacteria 2714
201 Ga0207671_10000443 3300025914 Bacteria 57065
202 Ga0207671_10004807 3300025914 Bacteria 12723
203 Ga0207671_10006331 3300025914 Bacteria 10564
204 Ga0207660_10003274 3300025917 Bacteria 10588
205 Ga0207652_10005280 3300025921 Bacteria 10484
206 Ga0207652_10071435 3300025921 Bacteria 3016
207 Ga0207694_10009457 3300025924 Bacteria 7347
208 Ga0207650_10046169 3300025925 Bacteria 3207
209 Ga0207650_10148659 3300025925 Bacteria 1847
210 Ga0207644_10084568 3300025931 Bacteria 2352
211 Ga0207644_10115559 3300025931 Bacteria 2035
212 Ga0207706_10062940 3300025933 Unclassified 3267
213 Ga0207686_10067981 3300025934 Unclassified 2281
214 Ga0207686_10076878 3300025934 Bacteria 2166
215 Ga0207704_10000205 3300025938 Bacteria 30268
216 Ga0207691_10151353 3300025940 Unclassified 2040
217 Ga0207691_10185780 3300025940 Bacteria 1814
218 Ga0207689_10000466 3300025942 Bacteria 37961
219 Ga0207689_10003377 3300025942 Bacteria 14612
220 Ga0207689_10004188 3300025942 Bacteria 13113
221 Ga0207661_10116995 3300025944 Bacteria 2264
222 Ga0207679_10027839 3300025945 Bacteria 3914
223 Ga0207679_10164707 3300025945 Unclassified 1819
224 Ga0207651_10003541 3300025960 Bacteria 7672
225 Ga0207651_10013215 3300025960 Unclassified 4713
226 Ga0207712_10013778 3300025961 Bacteria 5186
227 Ga0207668_10056945 3300025972 Bacteria 2725
228 Ga0207668_10233151 3300025972 Bacteria 1485
229 Ga0207640_10216376 3300025981 Unclassified 1463
230 Ga0207658_10034567 3300025986 Bacteria 3613
231 Ga0207677_10002126 3300026023 Bacteria 10402
232 Ga0207677_10163505 3300026023 Bacteria 1732
233 Ga0207703_10001847 3300026035 Bacteria 18864
234 Ga0207639_10032498 3300026041 Unclassified 3841
235 Ga0207639_10057912 3300026041 Unclassified 2978
236 Ga0207708_10119287 3300026075 Bacteria 2055
237 Ga0207641_10000015 3300026088 Bacteria 321332
238 Ga0207641_10182192 3300026088 Unclassified 1925
239 Ga0207648_10000747 3300026089 Bacteria 36518
240 Ga0207648_10004023 3300026089 Bacteria 15260
241 Ga0207648_10078502 3300026089 Bacteria 2880
242 Ga0207648_10202158 3300026089 Bacteria 1762
243 Ga0207676_10240503 3300026095 Bacteria 1624
244 Ga0207683_10006913 3300026121 Bacteria 9712
245 Ga0209281_1000045 3300027111 Bacteria 328124
246 Ga0209489_109165 3300027361 Bacteria 12595
247 Ga0209968_1000902 3300027526 Bacteria 4610
248 Ga0209282_1001475 3300027666 Bacteria 12966
249 Ga0268266_10003844 3300028379 Bacteria 14659
250 Ga0268264_10002153 3300028381 Bacteria 17563
251 Ga0268264_10015837 3300028381 Bacteria 6173
252 Ga0265326_10013861 3300028558 Bacteria 2352
253 Ga0265336_10007258 3300028666 Bacteria 3947
254 Ga0307515_10000001 3300028794 Bacteria 4259510
255 Ga0307515_10000031 3300028794 Bacteria 358648
256 Ga0307515_10000077 3300028794 Bacteria 228162
257 Ga0307515_10000318 3300028794 Bacteria 118891
258 Ga0265338_10138304 3300028800 Unclassified 1911
259 Ga0307511_10017314 3300030521 Bacteria 6917
260 Ga0265327_10000009 3300031251 Bacteria 616360
261 Ga0307509_10002733 3300031507 Bacteria 28113
262 Ga0307408_100000692 3300031548 Bacteria 27725
263 Ga0307405_10017611 3300031731 Bacteria 3925
264 Ga0307405_10021751 3300031731 Bacteria 3611
265 Ga0316577_10118473 3300031733 Bacteria 1487
266 Ga0307413_10000001 3300031824 Bacteria 159157
267 Ga0307413_10100859 3300031824 Bacteria 1907
268 Ga0307410_10000024 3300031852 Bacteria 59872
269 Ga0307406_10000028 3300031901 Bacteria 91602
270 Ga0307407_10000286 3300031903 Bacteria 14911
271 Ga0307412_10050387 3300031911 Bacteria 2747
272 Ga0307412_10213026 3300031911 Bacteria 1476
273 Ga0307416_100000066 3300032002 Bacteria 94549
274 Ga0307414_10000017 3300032004 Bacteria 247306
275 Ga0307414_10000022 3300032004 Bacteria 212123
276 Ga0307414_10001030 3300032004 Bacteria 14233
277 Ga0307414_10005650 3300032004 Bacteria 6900
278 Ga0307414_10019128 3300032004 Bacteria 4237
279 Ga0307411_10000003 3300032005 Bacteria 477556
280 Ga0307411_10134015 3300032005 Bacteria 1815
281 Ga0307507_10003974 3300033179 Bacteria 27186
282 Ga0316582_0016262 3300036647 Bacteria 4276
283 Ga0316584_0141690 3300036712 Bacteria 1792
284 Ga0439447_000106 3300041407 Bacteria 28341
285 Ga0439466_0000209 3300041411 Bacteria 23109
286 Ga0439445_0010635 3300042004 Bacteria 2181
287 Ga0451577_0021045 3300042876 Bacteria 5976
288 Ga0453684_0000165 3300044712 Bacteria 294572
289 Ga0453684_0000394 3300044712 Bacteria 179687
290 Ga0453684_0013205 3300044712 Bacteria 13465
291 Ga0453684_0021049 3300044712 Bacteria 9776
292 Ga0453684_0032831 3300044712 Bacteria 7252
293 Ga0453684_0051016 3300044712 Bacteria 5432
294 Ga0453684_0117837 3300044712 Bacteria 3213
295 Ga0453684_0139776 3300044712 Bacteria 2894
296 Ga0466957_0083301 3300044842 Bacteria 1995
297 Ga0466959_0023061 3300045049 Bacteria 4604
298 Ga0451576_0432759 3300045051 Bacteria 1380
299 Ga0495627_044888 3300046453 Bacteria 1347
300 Ga0495638_0032142 3300046460 Bacteria 3367
301 Ga0495650_0000095 3300046471 Bacteria 218020
302 Ga0495585_0000057 3300046492 Bacteria 113069
303 Ga0495585_0002221 3300046492 Bacteria 14066
304 Ga0495583_0023556 3300046506 Bacteria 3112
305 Ga0495606_0000009 3300046507 Bacteria 306313
306 Ga0495606_0002578 3300046507 Bacteria 20756
307 Ga0495610_0019223 3300046512 Bacteria 3830
308 Ga0495616_0000733 3300046513 Bacteria 24135
309 Ga0495609_0006279 3300046538 Bacteria 6087
310 Ga0495622_0094947 3300046557 Bacteria 1369
311 Ga0495633_0000012 3300046558 Bacteria 267875
312 Ga0495633_0000080 3300046558 Bacteria 127703
313 Ga0495633_0004355 3300046558 Bacteria 9041
314 Ga0495668_0000055 3300046616 Bacteria 199412
315 Ga0495668_0000414 3300046616 Bacteria 55752
316 Ga0495625_0000007 3300046660 Bacteria 565749
317 Ga0495625_0001326 3300046660 Bacteria 30769
318 Ga0495625_0001759 3300046660 Bacteria 25032
319 Ga0495661_0000576 3300046665 Bacteria 38166
320 Ga0495671_0036739 3300046692 Bacteria 2481
321 Ga0495649_0000007 3300046694 Bacteria 518037
322 Ga0495672_0019736 3300047320 Bacteria 4440
323 Ga0495672_0075525 3300047320 Bacteria 1895
324 Ga0495687_002624 3300047443 Bacteria 14098
325 Ga0495687_002801 3300047443 Bacteria 13453
326 Ga0495673_0023999 3300047469 Bacteria 2955
327 Ga0495686_0000265 3300047472 Bacteria 93838
328 Ga0496114_0000244 3300048917 Bacteria 39586
329 Ga0496116_0000002 3300048919 Bacteria 920291
330 Ga0496117_0001686 3300048920 Bacteria 30688
331 Ga0496117_0032229 3300048920 Bacteria 3985
332 Ga0496118_0064148 3300048921 Bacteria 2697
333 Ga0496124_0029542 3300048927 Bacteria 4882
334 Ga0496124_0086421 3300048927 Bacteria 2567
335 Ga0496124_0244842 3300048927 Bacteria 1331
336 Ga0496125_0000024 3300048928 Bacteria 442149
337 Ga0496125_0000108 3300048928 Bacteria 196060
338 Ga0496125_0137741 3300048928 Bacteria 1704
339 Ga0496126_0004575 3300048929 Bacteria 16416
340 Ga0496126_0006495 3300048929 Bacteria 13016
341 Ga0496126_0023028 3300048929 Bacteria 6041
342 Ga0495682_0012040 3300049460 Bacteria 3324
343 Ga0501034_0000002 3300049571 Bacteria 565510
344 Ga0501034_0016608 3300049571 Bacteria 7548
345 Ga0501034_0144336 3300049571 Bacteria 2358
346 Ga0501047_0102158 3300049581 Bacteria 2746
347 Ga0501047_0115570 3300049581 Bacteria 2565
348 Ga0501048_0184006 3300049582 Unclassified 1481
349 Ga0501067_0017172 3300049583 Bacteria 4000
350 Ga0501070_0044641 3300049586 Unclassified 3686
351 Ga0501073_0093525 3300049589 Bacteria 2088
352 Ga0501074_0059462 3300049590 Bacteria 2753
353 Ga0501076_0270015 3300049592 Bacteria 1393
354 Ga0501249_000002 3300049679 Bacteria 262756
355 Ga0501249_001081 3300049679 Bacteria 5784
356 Ga0501241_003662 3300049758 Bacteria 2899
357 Ga0501266_000003 3300049763 Bacteria 388836
358 Ga0501280_000247 3300049776 Bacteria 13541
359 Ga0501044_0019463 3300049823 Bacteria 7261
360 Ga0501044_0128741 3300049823 Bacteria 2527
361 nmdc:mga0k408_65_c1 3300050493 Bacteria 52329
362 Ga0500644_0000066 3300053088 Bacteria 61993
363 Ga0500646_0002384 3300053090 Bacteria 4881
364 Ga0500583_0000075 3300053092 Bacteria 59561
365 Ga0500651_0051035 3300053093 Bacteria 2594
366 Ga0500641_0000033 3300053096 Bacteria 78369
367 Ga0500641_0000138 3300053096 Bacteria 27016
368 Ga0500556_0012826 3300053104 Bacteria 2516
369 Ga0500594_0010086 3300053118 Bacteria 2186
370 Ga0500618_000033 3300053125 Bacteria 121886
371 Ga0500618_004643 3300053125 Bacteria 4328
372 Ga0500652_003720 3300053131 Unclassified 4650
373 Ga0500652_005371 3300053131 Unclassified 4029
374 Ga0500658_0000015 3300053134 Bacteria 151134
375 Ga0500559_0001939 3300053136 Bacteria 11199
376 Ga0500559_0015020 3300053136 Bacteria 3274
377 Ga0500589_117338 3300053147 Bacteria 1132
378 Ga0500616_0006587 3300053153 Bacteria 7573
379 Ga0500622_0000787 3300053156 Bacteria 27523
380 Ga0500624_002223 3300053157 Unclassified 2674
381 Ga0500636_0133903 3300053177 Bacteria 1378
382 Ga0500584_022318 3300053726 Bacteria 2942
383 Ga0501084_0009459 3300054114 Bacteria 8064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10043116 rootH2_100431163 339
2 3300013104 Ga0157370_10000334 Ga0157370_1000033456 340
3 3300013306 Ga0163162_10004141 Ga0163162_100041414 340
4 3300053093 Ga0500651_0051035 Ga0500651_0051035_46_1107 347
5 3300032004 Ga0307414_10000017 Ga0307414_10000017152 349
6 3300053147 Ga0500589_117338 Ga0500589_117338_44_1108 349
7 3300044712 Ga0453684_0117837 Ga0453684_0117837_582_1733 350
8 3300005459 Ga0068867_100000586 Ga0068867_10000058614 357
9 3300009176 Ga0105242_10019379 Ga0105242_100193792 357
10 3300009551 Ga0105238_10015346 Ga0105238_100153462 357
11 3300010375 Ga0105239_10257710 Ga0105239_102577102 357
12 3300025924 Ga0207694_10009457 Ga0207694_100094576 357
13 3300025934 Ga0207686_10067981 Ga0207686_100679812 357
14 3300026041 Ga0207639_10032498 Ga0207639_100324982 357
15 3300026089 Ga0207648_10000747 Ga0207648_1000074731 357
16 3300047443 Ga0495687_002801 Ga0495687_002801_301_1497 357
17 3300025295 Ga0209564_1006892 Ga0209564_10068927 358
18 3300025297 Ga0209758_1012274 Ga0209758_10122746 358
19 3300048927 Ga0496124_0244842 Ga0496124_0244842_204_1289 358
20 3300005334 Ga0068869_100091462 Ga0068869_1000914622 359
21 3300013308 Ga0157375_10003003 Ga0157375_100030039 359
22 3300003322 rootL2_10198531 rootL2_101985311 361
23 3300025940 Ga0207691_10185780 Ga0207691_101857802 361
24 3300036647 Ga0316582_0016262 Ga0316582_0016262_2527_3648 362
25 3300044712 Ga0453684_0139776 Ga0453684_0139776_1610_2794 364
26 3300053088 Ga0500644_0000066 Ga0500644_0000066_50036_51247 364
27 3300053136 Ga0500559_0015020 Ga0500559_0015020_1811_3022 364
28 3300053177 Ga0500636_0133903 Ga0500636_0133903_76_1287 364
29 iso_pu_bacteria 2643221725 2644682491 364
30 3300003323 rootH1_10283573 rootH1_102835734 365
31 3300013104 Ga0157370_10002126 Ga0157370_1000212613 365
32 3300046616 Ga0495668_0000414 Ga0495668_0000414_4904_6106 365
33 3300053104 Ga0500556_0012826 Ga0500556_0012826_1011_2213 365
34 3300031733 Ga0316577_10118473 Ga0316577_101184732 367
35 3300001979 JGI24740J21852_10010833 JGI24740J21852_100108335 369
36 3300002738 JGI25154J39366_1000147 JGI25154J39366_100014721 369
37 3300003215 JGI25153J46596_10000327 JGI25153J46596_1000032713 369
38 3300005262 Ga0065165_1007541 Ga0065165_10075417 369
39 3300005328 Ga0070676_10000231 Ga0070676_1000023112 369
40 3300005338 Ga0068868_100021953 Ga0068868_1000219533 369
41 3300005364 Ga0070673_100002509 Ga0070673_1000025094 369
42 3300005616 Ga0068852_100000614 Ga0068852_10000061414 369
43 3300006881 Ga0068865_100000172 Ga0068865_10000017215 369
44 3300009174 Ga0105241_10004067 Ga0105241_100040674 369
45 3300009545 Ga0105237_10003207 Ga0105237_100032073 369
46 3300010375 Ga0105239_10006763 Ga0105239_100067639 369
47 3300013296 Ga0157374_10000849 Ga0157374_1000084913 369
48 3300025246 Ga0209646_1000002 Ga0209646_1000002573 369
49 3300025250 Ga0209026_1000260 Ga0209026_100026022 369
50 3300025297 Ga0209758_1000944 Ga0209758_100094428 369
51 3300025302 Ga0207426_1001033 Ga0207426_10010335 369
52 3300025907 Ga0207645_10000146 Ga0207645_1000014623 369
53 3300025911 Ga0207654_10002633 Ga0207654_100026334 369
54 3300025938 Ga0207704_10000205 Ga0207704_1000020514 369
55 3300025960 Ga0207651_10003541 Ga0207651_100035412 369
56 3300026023 Ga0207677_10002126 Ga0207677_1000212610 369
57 3300036712 Ga0316584_0141690 Ga0316584_0141690_390_1505 369
58 3300053131 Ga0500652_005371 Ga0500652_005371_980_2146 369
59 3300006946 Ga0079104_1000079 Ga0079104_100007976 370
60 3300017792 Ga0163161_10000091 Ga0163161_1000009118 370
61 3300027111 Ga0209281_1000045 Ga0209281_10000452 370
62 3300003320 rootH2_10023047 rootH2_1002304710 372
63 3300005353 Ga0070669_100159615 Ga0070669_1001596151 372
64 iso_pu_bacteria 2919692658 2919694134 372
65 3300003316 rootH1_10052042 rootH1_100520421 373
66 3300044842 Ga0466957_0083301 Ga0466957_0083301_377_1582 373
67 3300003323 rootH1_10016547 rootH1_100165471 374
68 3300003354 JGI25160J50197_1004028 JGI25160J50197_10040289 374
69 3300025208 Ga0209436_100701 Ga0209436_1007012 374
70 3300025284 Ga0209130_1000665 Ga0209130_100066517 374
71 3300025302 Ga0207426_1000051 Ga0207426_1000051284 374
72 3300025909 Ga0207705_10071573 Ga0207705_100715731 374
73 3300009545 Ga0105237_10071364 Ga0105237_100713642 375
74 3300005336 Ga0070680_100004723 Ga0070680_1000047232 376
75 3300005337 Ga0070682_100000921 Ga0070682_1000009217 376
76 3300005341 Ga0070691_10002805 Ga0070691_100028051 376
77 3300005458 Ga0070681_10023543 Ga0070681_100235432 376
78 3300005530 Ga0070679_100002055 Ga0070679_1000020554 376
79 3300009093 Ga0105240_10004797 Ga0105240_100047972 376
80 3300009174 Ga0105241_10006808 Ga0105241_100068082 376
81 3300025911 Ga0207654_10037091 Ga0207654_100370913 376
82 3300025912 Ga0207707_10000611 Ga0207707_1000061114 376
83 3300025913 Ga0207695_10111560 Ga0207695_101115602 376
84 3300025917 Ga0207660_10003274 Ga0207660_100032746 376
85 3300025921 Ga0207652_10005280 Ga0207652_100052803 376
86 3300046460 Ga0495638_0032142 Ga0495638_0032142_109_1251 376
87 3300048920 Ga0496117_0001686 Ga0496117_0001686_1030_2202 377
88 3300048927 Ga0496124_0086421 Ga0496124_0086421_1050_2222 377
89 3300048928 Ga0496125_0137741 Ga0496125_0137741_242_1414 377
90 3300053156 Ga0500622_0000787 Ga0500622_0000787_3581_4780 377
91 iso_pu_bacteria 2522125168 2522548906 378
92 3300005288 Ga0065714_10003718 Ga0065714_100037182 379
93 3300047320 Ga0495672_0075525 Ga0495672_0075525_665_1873 379
94 3300053153 Ga0500616_0006587 Ga0500616_0006587_4308_5510 379
95 iso_pu_bacteria 8036736890 8036736920 379
96 3300001989 JGI24739J22299_10003878 JGI24739J22299_100038782 380
97 3300003316 rootH1_10179212 rootH1_101792122 380
98 3300003354 JGI25160J50197_1004042 JGI25160J50197_10040422 380
99 3300003771 Ga0055526_1006255 Ga0055526_10062551 380
100 3300003771 Ga0055526_1018009 Ga0055526_10180091 380
101 3300003790 Ga0055528_1000329 Ga0055528_100032918 380
102 3300003791 Ga0055530_10001924 Ga0055530_100019249 380
103 3300005262 Ga0065165_1000102 Ga0065165_100010263 380
104 3300015265 Ga0182005_1000171 Ga0182005_100017120 380
105 3300025273 Ga0209673_1000208 Ga0209673_100020862 380
106 3300025295 Ga0209564_1003551 Ga0209564_10035517 380
107 3300025297 Ga0209758_1003688 Ga0209758_10036886 380
108 3300025298 Ga0209050_1000134 Ga0209050_100013488 380
109 3300025302 Ga0207426_1000357 Ga0207426_100035760 380
110 3300025303 Ga0209051_1011905 Ga0209051_10119052 380
111 3300025304 Ga0209257_1005741 Ga0209257_10057413 380
112 iso_pu_bacteria 2881247448 2881248707 380
113 3300009176 Ga0105242_10127341 Ga0105242_101273412 381
114 3300017792 Ga0163161_10009402 Ga0163161_100094021 381
115 3300025934 Ga0207686_10076878 Ga0207686_100768783 381
116 3300046507 Ga0495606_0002578 Ga0495606_0002578_10486_11667 381
117 3300048928 Ga0496125_0000024 Ga0496125_0000024_317814_318995 381
118 3300048929 Ga0496126_0006495 Ga0496126_0006495_2315_3496 381
119 iso_pu_bacteria 2929921140 2929923297 381
120 iso_pu_bacteria 8003151029 8003152168 381
121 3300003322 rootL2_10302022 rootL2_103020223 382
122 3300003781 Ga0055536_1016494 Ga0055536_10164942 382
123 3300005262 Ga0065165_1000638 Ga0065165_100063835 382
124 3300013104 Ga0157370_10275078 Ga0157370_102750782 382
125 3300025292 Ga0209676_1000116 Ga0209676_100011631 382
126 3300031731 Ga0307405_10017611 Ga0307405_100176113 382
127 3300031911 Ga0307412_10213026 Ga0307412_102130261 382
128 3300032004 Ga0307414_10019128 Ga0307414_100191282 382
129 3300044712 Ga0453684_0051016 Ga0453684_0051016_1083_2243 382
130 iso_pu_bacteria 2519899754 2520880484 382
131 iso_pu_bacteria 2802428842 2802651263 382
132 iso_pu_bacteria 2816332280 2817414149 382
133 iso_pu_bacteria 2896317667 2896320467 382
134 iso_pu_bacteria 2903895155 2903895227 382
135 iso_pu_bacteria 2958458903 2958459573 382
136 iso_pu_bacteria 2965320100 2965322531 382
137 iso_pu_bacteria 2977268062 2977272677 382
138 iso_pu_bacteria 3003233435 3003234904 382
139 iso_pu_bacteria 8055419101 8055420104 382
140 iso_pu_bacteria 8055592153 8055596993 382
141 iso_pu_bacteria 8056440228 8056440913 382
142 3300006942 Ga0099824_1000500 Ga0099824_100050017 383
143 3300006948 Ga0099826_10000143 Ga0099826_1000014314 383
144 3300013100 Ga0157373_10000035 Ga0157373_1000003564 383
145 3300013104 Ga0157370_10001492 Ga0157370_1000149227 383
146 3300015261 Ga0182006_1005643 Ga0182006_10056433 383
147 3300027361 Ga0209489_109165 Ga0209489_1091652 383
148 3300027666 Ga0209282_1001475 Ga0209282_100147510 383
149 3300032002 Ga0307416_100000066 Ga0307416_10000006665 383
150 3300044712 Ga0453684_0021049 Ga0453684_0021049_5677_6834 383
151 3300045051 Ga0451576_0432759 Ga0451576_0432759_111_1277 383
152 3300048927 Ga0496124_0029542 Ga0496124_0029542_3483_4652 383
153 iso_pu_bacteria 2513020052 2513234723 383
154 iso_pu_bacteria 2643221600 2644012115 383
155 iso_pu_bacteria 2643221667 2644371304 383
156 iso_pu_bacteria 2643221716 2644641391 383
157 iso_pu_bacteria 2738541279 2738733896 383
158 iso_pu_bacteria 2738541285 2738766147 383
159 iso_pu_bacteria 2738543007 2739215477 383
160 iso_pu_bacteria 2739367857 2740000337 383
161 iso_pu_bacteria 2739367858 2740005153 383
162 iso_pu_bacteria 2857613821 2857617777 383
163 iso_pu_bacteria 2857618242 2857621407 383
164 iso_pu_bacteria 2881359912 2881361451 383
165 iso_pu_bacteria 2904419702 2904420377 383
166 iso_pu_bacteria 2904555929 2904557777 383
167 iso_pu_bacteria 2919191525 2919192419 383
168 iso_pu_bacteria 2919509842 2919509914 383
169 iso_pu_bacteria 2919683626 2919684174 383
170 iso_pu_bacteria 2929150217 2929151302 383
171 iso_pu_bacteria 8054307821 8054310852 383
172 3300045049 Ga0466959_0023061 Ga0466959_0023061_1890_3050 384
173 3300005288 Ga0065714_10009906 Ga0065714_100099062 385
174 3300005288 Ga0065714_10070793 Ga0065714_100707932 385
175 3300005288 Ga0065714_10071344 Ga0065714_100713442 385
176 3300005289 Ga0065704_10112697 Ga0065704_101126971 385
177 3300005337 Ga0070682_100020245 Ga0070682_1000202452 385
178 3300009036 Ga0105244_10000054 Ga0105244_1000005468 385
179 3300013102 Ga0157371_10008439 Ga0157371_100084392 385
180 3300013104 Ga0157370_10011207 Ga0157370_1001120711 385
181 3300013104 Ga0157370_10011403 Ga0157370_100114032 385
182 3300013308 Ga0157375_10072146 Ga0157375_100721465 385
183 3300017792 Ga0163161_10073707 Ga0163161_100737072 385
184 3300025728 Ga0207655_1000003 Ga0207655_1000003272 385
185 3300027526 Ga0209968_1000902 Ga0209968_10009022 385
186 3300028558 Ga0265326_10013861 Ga0265326_100138612 385
187 3300028666 Ga0265336_10007258 Ga0265336_100072582 385
188 3300028800 Ga0265338_10138304 Ga0265338_101383042 385
189 3300031548 Ga0307408_100000692 Ga0307408_10000069233 385
190 3300031731 Ga0307405_10021751 Ga0307405_100217513 385
191 3300031824 Ga0307413_10000001 Ga0307413_1000000134 385
192 3300031824 Ga0307413_10100859 Ga0307413_101008591 385
193 3300031852 Ga0307410_10000024 Ga0307410_1000002432 385
194 3300031901 Ga0307406_10000028 Ga0307406_1000002818 385
195 3300031903 Ga0307407_10000286 Ga0307407_100002865 385
196 3300031911 Ga0307412_10050387 Ga0307412_100503872 385
197 3300032004 Ga0307414_10000022 Ga0307414_1000002276 385
198 3300032004 Ga0307414_10001030 Ga0307414_100010302 385
199 3300032005 Ga0307411_10000003 Ga0307411_10000003248 385
200 3300032005 Ga0307411_10134015 Ga0307411_101340152 385
201 3300041407 Ga0439447_000106 Ga0439447_000106_2984_4162 385
202 3300041411 Ga0439466_0000209 Ga0439466_0000209_17910_19088 385
203 3300042004 Ga0439445_0010635 Ga0439445_0010635_568_1746 385
204 3300046692 Ga0495671_0036739 Ga0495671_0036739_313_1500 385
205 3300048919 Ga0496116_0000002 Ga0496116_0000002_845918_847105 385
206 3300048920 Ga0496117_0032229 Ga0496117_0032229_284_1471 385
207 3300048921 Ga0496118_0064148 Ga0496118_0064148_394_1581 385
208 3300048928 Ga0496125_0000108 Ga0496125_0000108_69745_70932 385
209 3300048929 Ga0496126_0023028 Ga0496126_0023028_3914_5101 385
210 3300049571 Ga0501034_0016608 Ga0501034_0016608_5823_7007 385
211 3300049679 Ga0501249_000002 Ga0501249_000002_24556_25737 385
212 3300049679 Ga0501249_001081 Ga0501249_001081_4243_5424 385
213 3300049763 Ga0501266_000003 Ga0501266_000003_175299_176480 385
214 3300049776 Ga0501280_000247 Ga0501280_000247_1562_2740 385
215 3300053090 Ga0500646_0002384 Ga0500646_0002384_108_1295 385
216 3300053096 Ga0500641_0000033 Ga0500641_0000033_7035_8222 385
217 3300053096 Ga0500641_0000138 Ga0500641_0000138_19636_20826 385
218 3300053118 Ga0500594_0010086 Ga0500594_0010086_429_1607 385
219 3300053134 Ga0500658_0000015 Ga0500658_0000015_88732_89913 385
220 3300053136 Ga0500559_0001939 Ga0500559_0001939_7085_8269 385
221 3300053726 Ga0500584_022318 Ga0500584_022318_1673_2854 385
222 3300003320 rootH2_10138852 rootH2_101388523 386
223 3300032004 Ga0307414_10005650 Ga0307414_100056505 386
224 3300044712 Ga0453684_0032831 Ga0453684_0032831_4450_5622 386
225 iso_pu_bacteria 2599185184 2599481257 386
226 iso_pu_bacteria 2928078545 2928081854 386
227 iso_pu_bacteria 2928147474 2928151877 386
228 iso_pu_bacteria 2932082852 2932087185 386
229 3300003322 rootL2_10182715 rootL2_101827153 387
230 3300005347 Ga0070668_100029978 Ga0070668_1000299784 387
231 3300005459 Ga0068867_100180117 Ga0068867_1001801171 387
232 3300005719 Ga0068861_100010660 Ga0068861_1000106606 387
233 3300006195 Ga0075366_10005072 Ga0075366_100050727 387
234 3300013306 Ga0163162_10069742 Ga0163162_100697422 387
235 3300025942 Ga0207689_10004188 Ga0207689_1000418813 387
236 3300025972 Ga0207668_10233151 Ga0207668_102331512 387
237 3300026088 Ga0207641_10182192 Ga0207641_101821922 387
238 3300028794 Ga0307515_10000077 Ga0307515_10000077117 387
239 3300028794 Ga0307515_10000318 Ga0307515_1000031866 387
240 3300033179 Ga0307507_10003974 Ga0307507_1000397417 387
241 3300046492 Ga0495585_0002221 Ga0495585_0002221_2181_3368 387
242 3300046538 Ga0495609_0006279 Ga0495609_0006279_3724_4911 387
243 3300046557 Ga0495622_0094947 Ga0495622_0094947_92_1279 387
244 3300046558 Ga0495633_0000012 Ga0495633_0000012_76716_77903 387
245 3300046616 Ga0495668_0000055 Ga0495668_0000055_57244_58431 387
246 3300046660 Ga0495625_0001326 Ga0495625_0001326_10235_11422 387
247 3300046660 Ga0495625_0001759 Ga0495625_0001759_1694_2881 387
248 3300049460 Ga0495682_0012040 Ga0495682_0012040_117_1304 387
249 3300049571 Ga0501034_0000002 Ga0501034_0000002_149260_150453 387
250 3300050493 nmdc:mga0k408_65_c1 nmdc:mga0k408_65_c1_29522_30709 387
251 3300053125 Ga0500618_000033 Ga0500618_000033_79706_80893 387
252 3300053157 Ga0500624_002223 Ga0500624_002223_479_1669 387
253 iso_pu_bacteria 2818991442 2819573677 387
254 iso_pu_bacteria 2818991460 2819680821 387
255 iso_pu_bacteria 2821136567 2821137010 387
256 iso_pu_bacteria 2883068021 2883072634 387
257 iso_pu_bacteria 2884791551 2884795578 387
258 iso_pu_bacteria 2896109856 2896112494 387
259 iso_pu_bacteria 2904467357 2904468248 387
260 iso_pu_bacteria 2929177148 2929178850 387
261 iso_pu_bacteria 2929239360 2929241291 387
262 iso_pu_bacteria 2945977869 2945981254 387
263 iso_pu_bacteria 2946013367 2946019345 387
264 3300002067 JGI24735J21928_10000020 JGI24735J21928_1000002065 388
265 3300003323 rootH1_10003867 rootH1_100038677 388
266 3300005334 Ga0068869_100023230 Ga0068869_1000232302 388
267 3300005347 Ga0070668_100066138 Ga0070668_1000661381 388
268 3300005353 Ga0070669_100106510 Ga0070669_1001065102 388
269 3300005354 Ga0070675_100231001 Ga0070675_1002310011 388
270 3300005356 Ga0070674_100015145 Ga0070674_1000151452 388
271 3300005364 Ga0070673_100011349 Ga0070673_1000113492 388
272 3300005441 Ga0070700_100146549 Ga0070700_1001465492 388
273 3300005563 Ga0068855_100042323 Ga0068855_1000423232 388
274 3300005564 Ga0070664_100108570 Ga0070664_1001085702 388
275 3300005578 Ga0068854_100080648 Ga0068854_1000806482 388
276 3300005617 Ga0068859_100036482 Ga0068859_1000364822 388
277 3300005840 Ga0068870_10033831 Ga0068870_100338312 388
278 3300005843 Ga0068860_100219141 Ga0068860_1002191412 388
279 3300006931 Ga0097620_100036482 Ga0097620_1000364822 388
280 3300009176 Ga0105242_10011131 Ga0105242_100111312 388
281 3300009177 Ga0105248_10518213 Ga0105248_105182131 388
282 3300010375 Ga0105239_10000860 Ga0105239_1000086038 388
283 3300013105 Ga0157369_10151920 Ga0157369_101519201 388
284 3300013297 Ga0157378_10384734 Ga0157378_103847342 388
285 3300013306 Ga0163162_10021702 Ga0163162_100217026 388
286 3300013307 Ga0157372_10007433 Ga0157372_100074336 388
287 3300013308 Ga0157375_10144097 Ga0157375_101440973 388
288 3300014326 Ga0157380_10003502 Ga0157380_100035027 388
289 3300014745 Ga0157377_10056671 Ga0157377_100566713 388
290 3300025907 Ga0207645_10006683 Ga0207645_100066838 388
291 3300025908 Ga0207643_10078197 Ga0207643_100781972 388
292 3300025911 Ga0207654_10057681 Ga0207654_100576812 388
293 3300025933 Ga0207706_10062940 Ga0207706_100629402 388
294 3300025942 Ga0207689_10000466 Ga0207689_1000046638 388
295 3300025945 Ga0207679_10164707 Ga0207679_101647072 388
296 3300025981 Ga0207640_10216376 Ga0207640_102163762 388
297 3300026041 Ga0207639_10057912 Ga0207639_100579122 388
298 3300026089 Ga0207648_10004023 Ga0207648_1000402315 388
299 3300026089 Ga0207648_10078502 Ga0207648_100785022 388
300 3300026089 Ga0207648_10202158 Ga0207648_102021581 388
301 3300042876 Ga0451577_0021045 Ga0451577_0021045_3234_4436 388
302 3300044712 Ga0453684_0000165 Ga0453684_0000165_41860_43053 388
303 3300044712 Ga0453684_0000394 Ga0453684_0000394_105275_106477 388
304 3300044712 Ga0453684_0013205 Ga0453684_0013205_12047_13240 388
305 3300046453 Ga0495627_044888 Ga0495627_044888_63_1259 388
306 3300046471 Ga0495650_0000095 Ga0495650_0000095_834_2030 388
307 3300046492 Ga0495585_0000057 Ga0495585_0000057_14776_15972 388
308 3300046506 Ga0495583_0023556 Ga0495583_0023556_1550_2746 388
309 3300046507 Ga0495606_0000009 Ga0495606_0000009_242912_244108 388
310 3300046512 Ga0495610_0019223 Ga0495610_0019223_1750_2946 388
311 3300046513 Ga0495616_0000733 Ga0495616_0000733_21402_22598 388
312 3300046558 Ga0495633_0000080 Ga0495633_0000080_58341_59537 388
313 3300046558 Ga0495633_0004355 Ga0495633_0004355_176_1372 388
314 3300046660 Ga0495625_0000007 Ga0495625_0000007_85594_86790 388
315 3300046665 Ga0495661_0000576 Ga0495661_0000576_3901_5097 388
316 3300046694 Ga0495649_0000007 Ga0495649_0000007_348628_349824 388
317 3300047443 Ga0495687_002624 Ga0495687_002624_3699_4895 388
318 3300047469 Ga0495673_0023999 Ga0495673_0023999_871_2067 388
319 3300053125 Ga0500618_004643 Ga0500618_004643_2687_3883 388
320 3300003322 rootL2_10069393 rootL2_100693931 389
321 3300003322 rootL2_10100728 rootL2_101007284 389
322 3300003323 rootH1_10075475 rootH1_100754754 389
323 3300003794 Ga0055531_10000728 Ga0055531_1000072813 389
324 3300005331 Ga0070670_100066766 Ga0070670_1000667662 389
325 3300005334 Ga0068869_100004602 Ga0068869_1000046022 389
326 3300005335 Ga0070666_10000078 Ga0070666_1000007815 389
327 3300005338 Ga0068868_100032379 Ga0068868_1000323792 389
328 3300005347 Ga0070668_100021951 Ga0070668_1000219512 389
329 3300005355 Ga0070671_100011438 Ga0070671_1000114382 389
330 3300005364 Ga0070673_100011776 Ga0070673_1000117762 389
331 3300005364 Ga0070673_100092482 Ga0070673_1000924822 389
332 3300005367 Ga0070667_100003107 Ga0070667_1000031072 389
333 3300005367 Ga0070667_100022639 Ga0070667_1000226391 389
334 3300005456 Ga0070678_100038839 Ga0070678_1000388392 389
335 3300005564 Ga0070664_100059331 Ga0070664_1000593312 389
336 3300005616 Ga0068852_100004514 Ga0068852_1000045144 389
337 3300005617 Ga0068859_100000003 Ga0068859_100000003269 389
338 3300005834 Ga0068851_10002384 Ga0068851_100023846 389
339 3300005841 Ga0068863_100035807 Ga0068863_1000358072 389
340 3300005841 Ga0068863_100393265 Ga0068863_1003932651 389
341 3300005842 Ga0068858_100004533 Ga0068858_1000045338 389
342 3300005843 Ga0068860_100005293 Ga0068860_1000052932 389
343 3300005843 Ga0068860_100006921 Ga0068860_10000692111 389
344 3300005843 Ga0068860_100020540 Ga0068860_1000205401 389
345 3300006237 Ga0097621_100009014 Ga0097621_1000090143 389
346 3300006358 Ga0068871_100000154 Ga0068871_10000015416 389
347 3300006358 Ga0068871_100012369 Ga0068871_1000123692 389
348 3300006931 Ga0097620_100000003 Ga0097620_100000003269 389
349 3300009093 Ga0105240_10000101 Ga0105240_1000010124 389
350 3300009093 Ga0105240_10050461 Ga0105240_100504612 389
351 3300009098 Ga0105245_10379716 Ga0105245_103797162 389
352 3300009101 Ga0105247_10001017 Ga0105247_100010177 389
353 3300009174 Ga0105241_10001703 Ga0105241_100017039 389
354 3300009545 Ga0105237_10001455 Ga0105237_1000145515 389
355 3300009545 Ga0105237_10023518 Ga0105237_100235182 389
356 3300009551 Ga0105238_10284671 Ga0105238_102846712 389
357 3300009553 Ga0105249_10008242 Ga0105249_100082422 389
358 3300010375 Ga0105239_10089400 Ga0105239_100894004 389
359 3300010375 Ga0105239_10100102 Ga0105239_101001022 389
360 3300010375 Ga0105239_10104779 Ga0105239_101047792 389
361 3300013105 Ga0157369_10252975 Ga0157369_102529752 389
362 3300013105 Ga0157369_10308199 Ga0157369_103081992 389
363 3300013297 Ga0157378_10005955 Ga0157378_100059554 389
364 3300013297 Ga0157378_10036092 Ga0157378_100360922 389
365 3300013306 Ga0163162_10000568 Ga0163162_1000056813 389
366 3300013306 Ga0163162_10020344 Ga0163162_100203442 389
367 3300013308 Ga0157375_10019808 Ga0157375_100198082 389
368 3300013308 Ga0157375_10086210 Ga0157375_100862101 389
369 3300013308 Ga0157375_10168380 Ga0157375_101683802 389
370 3300014325 Ga0163163_10167448 Ga0163163_101674481 389
371 3300014326 Ga0157380_10014687 Ga0157380_100146872 389
372 3300014968 Ga0157379_10024689 Ga0157379_100246892 389
373 3300014969 Ga0157376_10004045 Ga0157376_100040452 389
374 3300014969 Ga0157376_10246770 Ga0157376_102467702 389
375 3300025250 Ga0209026_1000226 Ga0209026_100022629 389
376 3300025304 Ga0209257_1000001 Ga0209257_10000011397 389
377 3300025321 Ga0207656_10002496 Ga0207656_100024962 389
378 3300025321 Ga0207656_10064256 Ga0207656_100642562 389
379 3300025900 Ga0207710_10069209 Ga0207710_100692092 389
380 3300025903 Ga0207680_10000216 Ga0207680_1000021615 389
381 3300025904 Ga0207647_10057214 Ga0207647_100572142 389
382 3300025911 Ga0207654_10007322 Ga0207654_100073222 389
383 3300025913 Ga0207695_10000020 Ga0207695_10000020675 389
384 3300025913 Ga0207695_10055913 Ga0207695_100559133 389
385 3300025914 Ga0207671_10000443 Ga0207671_100004432 389
386 3300025914 Ga0207671_10004807 Ga0207671_100048075 389
387 3300025914 Ga0207671_10006331 Ga0207671_100063312 389
388 3300025921 Ga0207652_10071435 Ga0207652_100714352 389
389 3300025925 Ga0207650_10046169 Ga0207650_100461692 389
390 3300025925 Ga0207650_10148659 Ga0207650_101486591 389
391 3300025931 Ga0207644_10084568 Ga0207644_100845682 389
392 3300025931 Ga0207644_10115559 Ga0207644_101155592 389
393 3300025940 Ga0207691_10151353 Ga0207691_101513532 389
394 3300025942 Ga0207689_10003377 Ga0207689_100033776 389
395 3300025944 Ga0207661_10116995 Ga0207661_101169952 389
396 3300025945 Ga0207679_10027839 Ga0207679_100278393 389
397 3300025960 Ga0207651_10013215 Ga0207651_100132152 389
398 3300025961 Ga0207712_10013778 Ga0207712_100137782 389
399 3300025972 Ga0207668_10056945 Ga0207668_100569452 389
400 3300025986 Ga0207658_10034567 Ga0207658_100345672 389
401 3300026023 Ga0207677_10163505 Ga0207677_101635052 389
402 3300026035 Ga0207703_10001847 Ga0207703_1000184715 389
403 3300026075 Ga0207708_10119287 Ga0207708_101192872 389
404 3300026088 Ga0207641_10000015 Ga0207641_10000015253 389
405 3300026095 Ga0207676_10240503 Ga0207676_102405031 389
406 3300026121 Ga0207683_10006913 Ga0207683_100069132 389
407 3300028379 Ga0268266_10003844 Ga0268266_100038447 389
408 3300028381 Ga0268264_10002153 Ga0268264_1000215311 389
409 3300028381 Ga0268264_10015837 Ga0268264_100158373 389
410 3300028794 Ga0307515_10000001 Ga0307515_100000012356 389
411 3300028794 Ga0307515_10000031 Ga0307515_10000031147 389
412 3300030521 Ga0307511_10017314 Ga0307511_100173143 389
413 3300031251 Ga0265327_10000009 Ga0265327_1000000998 389
414 3300031507 Ga0307509_10002733 Ga0307509_1000273316 389
415 3300048917 Ga0496114_0000244 Ga0496114_0000244_6335_7537 389
416 3300048929 Ga0496126_0004575 Ga0496126_0004575_11097_12302 389
417 3300049571 Ga0501034_0144336 Ga0501034_0144336_1024_2220 389
418 3300049581 Ga0501047_0102158 Ga0501047_0102158_294_1589 389
419 3300049581 Ga0501047_0115570 Ga0501047_0115570_1256_2452 389
420 3300049582 Ga0501048_0184006 Ga0501048_0184006_28_1224 389
421 3300049583 Ga0501067_0017172 Ga0501067_0017172_1823_3019 389
422 3300049586 Ga0501070_0044641 Ga0501070_0044641_1246_2442 389
423 3300049589 Ga0501073_0093525 Ga0501073_0093525_109_1305 389
424 3300049590 Ga0501074_0059462 Ga0501074_0059462_1396_2592 389
425 3300049592 Ga0501076_0270015 Ga0501076_0270015_146_1342 389
426 3300049758 Ga0501241_003662 Ga0501241_003662_1001_2206 389
427 3300049823 Ga0501044_0019463 Ga0501044_0019463_1686_2882 389
428 3300049823 Ga0501044_0128741 Ga0501044_0128741_1300_2499 389
429 3300053092 Ga0500583_0000075 Ga0500583_0000075_29338_30666 389
430 3300053131 Ga0500652_003720 Ga0500652_003720_3058_4386 389
431 3300054114 Ga0501084_0009459 Ga0501084_0009459_1582_2778 389
432 iso_pu_bacteria 2881955468 2881957490 389
433 3300013307 Ga0157372_10017611 Ga0157372_100176117 390
434 3300047320 Ga0495672_0019736 Ga0495672_0019736_1508_2707 390
435 3300047472 Ga0495686_0000265 Ga0495686_0000265_79183_80451 390
436 2162886007 SwRhRL2b_contig_1762647 SwRhRL2b_0716.00004990 393
437 3300005289 Ga0065704_10070151 Ga0065704_10070151181 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09835

DUF2062

Uncharacterized protein conserved in bacteria (DUF2062)

301

439

0.89

PF00535

Glycos_transf_2

Glycosyl transferase family 2

61

218

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4j-assembly1.cif.gz_A mannosylglycerate synthase in complex with lactate 0.7757 14 210
2bo7-assembly2.cif.gz_F dissection of mannosylglycerate synthase: an archetypal mannosyltransferase 0.7604 14 206
7pho-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.7463 6 235
7qoq-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 in complex with ump and magnesium 0.7235 6 235
4de7-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mg2+ and uridine-diphosphate (udp) 0.723 5 235
ID Description Score Start End Superfamily
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8711 10 228 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8424 15 234 3.90.550.10
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8177 13 237 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8122 15 234 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.806 10 228 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D3MP82-F1-model_v4 Glycosyltransferase 0.955 5 250 GO:0016020
GO:0016740
AF-A0A7X8FLX7-F1-model_v4 deleted 0.9418 5 245
AF-A0A1F9IWF1-F1-model_v4 deleted 0.9309 13 231
AF-A0A1G0XUR7-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9261 11 241 GO:0016757
AF-A0A3D3MP82-F1-model_v4 Glycosyltransferase 0.9258 5 250 GO:0016020
GO:0016740

Feature Viewer

pLDDT pTM Quality
86.3 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map