F444030

General Info

Members Datasets Scaffolds Average Seq Length
438 259 877 168

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0963109|Ga0395900_0963109_171_668
Length 155
Sequence MQQRKDPVDAIIDQWARVRPDLDTRAMEVFGRIHRLSRAIGDRMEKAYEPYGISRGEFDVLATLRRSGSATLMLTTGGMTGRLDKLERAGLLRRSPDPHDRRGLRVTLTDAGLRLIDEAVGAGLAQQQDALSALDDEQAGQLADLLRNLLRATAK

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
28 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
63 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
67 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
68 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
69 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
70 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
71 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
76 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
77 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
78 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
79 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
80 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
81 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
197 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
198 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
199 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
205 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
206 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
207 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
208 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
209 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
212 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
213 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
214 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
215 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
216 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
217 2643221647 Streptomyces sp. Root369 Isolate Unclassified
218 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
219 2643221714 Streptomyces sp. Root264 Isolate Unclassified
220 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
221 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
222 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
223 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
224 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
225 2808606448 Streptomyces sp. 193411 Isolate Unclassified
226 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
227 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
228 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
229 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
230 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
231 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
232 2862574272 Streptomyces sp. AcE210 Isolate Nodule
233 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
234 2867428634 Streptomyces sp. RP5T Isolate Unclassified
235 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
236 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
237 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
238 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
239 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
240 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
241 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
242 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
243 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
244 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
245 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
246 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
247 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
248 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
249 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
250 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
251 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
252 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
253 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
254 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
255 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
256 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
257 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
258 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
259 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.13
Metatranscriptomes 0.46
Isolates 11.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0.68
Rhizoplane 0.68
Rhizosphere 76.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0963109 3300037418 Bacteria 774
2 JGI24740J21852_10103897 3300001979 Bacteria 721
3 JGI24739J22299_10057482 3300001989 Bacteria 1238
4 JGI24738J21930_10027298 3300002075 Bacteria 1169
5 rootH1_10006639 3300003316 Bacteria 5095
6 rootH1_10042572 3300003316 Bacteria 4385
7 rootH2_10073039 3300003320 Bacteria 6487
8 rootL2_10013683 3300003322 Bacteria 5430
9 rootL2_10053244 3300003322 Bacteria 5716
10 rootH1_10000263 3300003323 Bacteria 6409
11 rootH1_10012842 3300003323 Bacteria 4603
12 rootH1_10014374 3300003316 Bacteria 3533
13 rootH1_10014374 3300003323 Bacteria 1764
14 rootH1_10098050 3300003323 Bacteria 1239
15 Ga0006562J51391_1076924 3300003578 Bacteria 6000
16 Ga0006562J51391_1076925 3300003578 Bacteria 10670
17 Ga0070668_100000137 3300005347 Bacteria 46061
18 Ga0070675_100392250 3300005354 Bacteria 1237
19 Ga0070713_100605359 3300005436 Bacteria 1041
20 Ga0070710_10594689 3300005437 Bacteria 769
21 Ga0070706_101209086 3300005467 Bacteria 694
22 Ga0068853_100817351 3300005539 Bacteria 893
23 Ga0068855_100483704 3300005563 Bacteria 1347
24 Ga0068852_101543923 3300005616 Bacteria 686
25 Ga0068861_100515250 3300005719 Bacteria 1084
26 Ga0068860_100902658 3300005843 Bacteria 900
27 Ga0081539_10000192 3300005985 Bacteria 141686
28 Ga0081539_10153199 3300005985 Bacteria 1107
29 Ga0075365_10259903 3300006038 Bacteria 1221
30 Ga0105245_11064608 3300009098 Bacteria 854
31 Ga0105249_11984278 3300009553 Bacteria 655
32 Ga0105246_10023851 3300011119 Bacteria 3965
33 Ga0105246_10957793 3300011119 Bacteria 772
34 Ga0157369_10547160 3300013105 Bacteria 1197
35 Ga0157372_10543084 3300013307 Bacteria 1355
36 Ga0182007_10000820 3300015262 Bacteria 17338
37 Ga0183367_1006 3300015688 Bacteria 648044
38 Ga0207426_1058563 3300025302 Bacteria 1117
39 Ga0207647_10171537 3300025904 Bacteria 1263
40 Ga0207659_10381751 3300025926 Bacteria 1175
41 Ga0207687_10339762 3300025927 Bacteria 1220
42 Ga0207667_11016236 3300025949 Bacteria 816
43 Ga0207668_10031633 3300025972 Bacteria 3487
44 Ga0207683_11515875 3300026121 Bacteria 619
45 Ga0207698_11332683 3300026142 Bacteria 733
46 Ga0209371_1050729 3300027312 Bacteria 797
47 Ga0268265_10140813 3300028380 Bacteria 2019
48 Ga0268264_10478858 3300028381 Bacteria 1210
49 Ga0307515_10000044 3300028794 Bacteria 303041
50 Ga0307515_10021178 3300028794 Bacteria 11544
51 Ga0307515_10023740 3300028794 Bacteria 10729
52 Ga0307515_10177827 3300028794 Bacteria 2091
53 Ga0307515_10342829 3300028794 Bacteria 1145
54 Ga0268256_1057124 3300030500 Bacteria 797
55 Ga0307511_10000836 3300030521 Bacteria 32726
56 Ga0307511_10041079 3300030521 Bacteria 3912
57 Ga0307511_10047962 3300030521 Bacteria 3485
58 Ga0307512_10011696 3300030522 Bacteria 8299
59 Ga0307512_10017823 3300030522 Bacteria 6501
60 Ga0307512_10033049 3300030522 Bacteria 4456
61 Ga0307512_10203711 3300030522 Bacteria 1066
62 Ga0307513_10022232 3300031456 Bacteria 7459
63 Ga0307513_10023841 3300031456 Bacteria 7137
64 Ga0307509_10009223 3300031507 Bacteria 12383
65 Ga0307509_10032989 3300031507 Bacteria 5701
66 Ga0307509_10080545 3300031507 Bacteria 3367
67 Ga0307408_100436130 3300031548 Bacteria 1133
68 Ga0307408_100659739 3300031548 Bacteria 936
69 Ga0307508_10019786 3300031616 Bacteria 6118
70 Ga0307508_10033552 3300031616 Bacteria 4633
71 Ga0307508_10037700 3300031616 Bacteria 4346
72 Ga0307508_10246052 3300031616 Bacteria 1385
73 Ga0307514_10003374 3300031649 Bacteria 15413
74 Ga0307514_10065841 3300031649 Bacteria 2743
75 Ga0307514_10223771 3300031649 Bacteria 1150
76 Ga0307514_10228829 3300031649 Bacteria 1130
77 Ga0307514_10248863 3300031649 Bacteria 1055
78 Ga0307516_10000267 3300031730 Bacteria 67005
79 Ga0307516_10030972 3300031730 Bacteria 5396
80 Ga0307516_10056209 3300031730 Bacteria 3838
81 Ga0307516_10062973 3300031730 Bacteria 3592
82 Ga0307405_10244091 3300031731 Bacteria 1332
83 Ga0307405_10591264 3300031731 Bacteria 904
84 Ga0307518_10014597 3300031838 Bacteria 5612
85 Ga0307410_10025595 3300031852 Bacteria 3705
86 Ga0326468_10000448 3300031889 Bacteria 4397
87 Ga0307406_10020921 3300031901 Bacteria 3862
88 Ga0307407_10117882 3300031903 Bacteria 1678
89 Ga0307409_100022827 3300031995 Bacteria 4320
90 Ga0307409_100923941 3300031995 Bacteria 887
91 Ga0307416_100585818 3300032002 Bacteria 1193
92 Ga0307411_10085811 3300032005 Bacteria 2182
93 Ga0307415_100041419 3300032126 Bacteria 3058
94 Ga0307415_100094923 3300032126 Bacteria 2170
95 Ga0307507_10020284 3300033179 Bacteria 7448
96 Ga0307507_10146466 3300033179 Bacteria 1792
97 Ga0307510_10013144 3300033180 Bacteria 9819
98 Ga0307510_10061583 3300033180 Bacteria 3845
99 Ga0307510_10082021 3300033180 Bacteria 3122
100 Ga0307510_10227256 3300033180 Bacteria 1372
101 Ga0373951_0001731 3300035091 Bacteria 5704
102 Ga0373939_0049746 3300035114 Bacteria 1297
103 Ga0395898_0077057 3300037466 Bacteria 3219
104 Ga0395901_0192557 3300038443 Bacteria 2138
105 Ga0395901_0623740 3300038443 Bacteria 1085
106 Ga0439436_0004544 3300041404 Bacteria 4255
107 Ga0439439_0003593 3300041406 Bacteria 3432
108 Ga0439439_0015498 3300041406 Bacteria 1862
109 Ga0451800_0584569 3300041459 Bacteria 1762
110 Ga0451807_0679181 3300041486 Bacteria 588
111 Ga0451841_0903561 3300041498 Bacteria 1401
112 Ga0451841_0990381 3300041498 Bacteria 897
113 Ga0451851_1087189 3300041507 Bacteria 1066
114 Ga0451853_0604484 3300041512 Bacteria 1799
115 Ga0451853_1273788 3300041512 Bacteria 2384
116 Ga0451853_1400810 3300041512 Bacteria 1158
117 Ga0451853_3215495 3300041512 Bacteria 813
118 Ga0439448_0099581 3300042005 Bacteria 987
119 Ga0439449_0029289 3300042007 Bacteria 2051
120 Ga0439449_0058491 3300042007 Bacteria 1423
121 Ga0439455_0023840 3300042012 Bacteria 1476
122 Ga0439457_000183 3300042014 Bacteria 16447
123 Ga0439457_005022 3300042014 Bacteria 3380
124 Ga0450920_051369 3300042122 Bacteria 827
125 Ga0450894_000115 3300042131 Bacteria 13602
126 Ga0450896_000855 3300042133 Bacteria 3476
127 Ga0450898_038370 3300042134 Bacteria 899
128 Ga0450903_000433 3300042138 Bacteria 8974
129 Ga0450906_007513 3300042145 Bacteria 2151
130 Ga0439458_0096147 3300042157 Bacteria 766
131 Ga0450908_002846 3300042184 Bacteria 3366
132 Ga0439459_0063505 3300042438 Bacteria 839
133 Ga0466969_0010698 3300044656 Bacteria 4861
134 Ga0466969_0044695 3300044656 Bacteria 2202
135 Ga0466972_0014595 3300044658 Bacteria 3933
136 Ga0466972_0015374 3300044658 Bacteria 3826
137 Ga0466965_0002412 3300044683 Bacteria 7933
138 Ga0466966_0013343 3300044684 Bacteria 5438
139 Ga0466966_0032344 3300044684 Bacteria 3390
140 Ga0466966_0037340 3300044684 Bacteria 3133
141 Ga0466961_0003943 3300044693 Bacteria 9277
142 Ga0466961_0008296 3300044693 Bacteria 6615
143 Ga0466961_0028343 3300044693 Bacteria 3600
144 Ga0466961_0169523 3300044693 Bacteria 1358
145 Ga0466963_0009544 3300044694 Bacteria 5844
146 Ga0466963_0202594 3300044694 Bacteria 1388
147 Ga0466963_0638395 3300044694 Bacteria 752
148 Ga0466964_0003003 3300044706 Bacteria 6111
149 Ga0466971_0001649 3300044719 Bacteria 9436
150 Ga0466971_0037516 3300044719 Bacteria 2172
151 Ga0466968_0144289 3300044735 Bacteria 1091
152 Ga0466970_0001497 3300044765 Bacteria 11238
153 Ga0466970_0070713 3300044765 Bacteria 1876
154 Ga0466970_0133443 3300044765 Bacteria 1365
155 Ga0466957_0003092 3300044842 Bacteria 9061
156 Ga0466960_0340055 3300044901 Bacteria 854
157 Ga0466959_0045844 3300045049 Bacteria 3218
158 Ga0466959_0076433 3300045049 Bacteria 2417
159 Ga0466958_0003769 3300045836 Bacteria 7916
160 Ga0466958_0027269 3300045836 Bacteria 3381
161 Ga0466967_0002444 3300045976 Bacteria 11561
162 Ga0466967_0005882 3300045976 Bacteria 8590
163 Ga0466967_0066164 3300045976 Bacteria 3219
164 Ga0495627_072918 3300046453 Bacteria 1001
165 Ga0495592_0007025 3300046454 Bacteria 8418
166 Ga0495592_0063675 3300046454 Bacteria 2704
167 Ga0495603_0013426 3300046455 Bacteria 4954
168 Ga0495603_0017761 3300046455 Bacteria 4305
169 Ga0495603_0334784 3300046455 Bacteria 869
170 Ga0495590_0019508 3300046457 Bacteria 2415
171 Ga0495590_0041242 3300046457 Bacteria 1609
172 Ga0495629_0005173 3300046459 Bacteria 9760
173 Ga0495629_0014785 3300046459 Bacteria 5615
174 Ga0495629_0363864 3300046459 Bacteria 985
175 Ga0495638_0410560 3300046460 Bacteria 700
176 Ga0495651_0000439 3300046462 Bacteria 32028
177 Ga0495651_0002722 3300046462 Bacteria 13711
178 Ga0495651_0042124 3300046462 Bacteria 3546
179 Ga0495582_0019399 3300046473 Bacteria 3717
180 Ga0495582_0195658 3300046473 Bacteria 1154
181 Ga0495605_0004131 3300046474 Bacteria 8556
182 Ga0495639_0306331 3300046475 Bacteria 793
183 Ga0495662_0000218 3300046476 Bacteria 23951
184 Ga0495662_0001409 3300046476 Bacteria 11911
185 Ga0495662_0038095 3300046476 Bacteria 2323
186 Ga0495662_0105946 3300046476 Bacteria 1376
187 Ga0495664_0026985 3300046477 Bacteria 3346
188 Ga0495664_0070389 3300046477 Bacteria 2089
189 Ga0495664_0491311 3300046477 Bacteria 733
190 Ga0495585_0024594 3300046492 Bacteria 3452
191 Ga0495594_0391340 3300046499 Bacteria 791
192 Ga0495596_0079243 3300046500 Bacteria 1275
193 Ga0495607_0028860 3300046501 Bacteria 3417
194 Ga0495607_0072743 3300046501 Bacteria 1913
195 Ga0495583_0010997 3300046506 Bacteria 5221
196 Ga0495583_0049448 3300046506 Bacteria 1926
197 Ga0495583_0142669 3300046506 Bacteria 996
198 Ga0495583_0155010 3300046506 Bacteria 948
199 Ga0495606_0001734 3300046507 Bacteria 28009
200 Ga0495606_0008751 3300046507 Bacteria 8702
201 Ga0495608_0714525 3300046511 Bacteria 595
202 Ga0495610_0018314 3300046512 Bacteria 3961
203 Ga0495610_0065271 3300046512 Bacteria 1718
204 Ga0495616_0003134 3300046513 Bacteria 10684
205 Ga0495618_0007931 3300046514 Bacteria 6427
206 Ga0495618_0037198 3300046514 Bacteria 3056
207 Ga0495620_0012810 3300046515 Bacteria 4313
208 Ga0495620_0017890 3300046515 Bacteria 3521
209 Ga0495620_0250196 3300046515 Bacteria 676
210 Ga0495628_0094213 3300046516 Bacteria 2315
211 Ga0495628_0286284 3300046516 Bacteria 1222
212 Ga0495630_0062283 3300046517 Bacteria 2802
213 Ga0495630_0156668 3300046517 Bacteria 1734
214 Ga0495643_0034797 3300046522 Bacteria 2776
215 Ga0495644_0131931 3300046523 Bacteria 952
216 Ga0495666_0091004 3300046526 Bacteria 1439
217 Ga0495666_0153932 3300046526 Bacteria 1068
218 Ga0495642_0035339 3300046528 Bacteria 2016
219 Ga0495652_0001811 3300046529 Bacteria 22721
220 Ga0495652_0036585 3300046529 Bacteria 4266
221 Ga0495652_0972780 3300046529 Bacteria 556
222 Ga0495640_0044453 3300046533 Bacteria 3088
223 Ga0495586_0528695 3300046535 Bacteria 681
224 Ga0495587_0002262 3300046536 Bacteria 12874
225 Ga0495587_0125349 3300046536 Bacteria 1470
226 Ga0495587_0372940 3300046536 Bacteria 794
227 Ga0495609_0099787 3300046538 Bacteria 1258
228 Ga0495609_0145495 3300046538 Bacteria 1010
229 Ga0495597_0009613 3300046542 Bacteria 4767
230 Ga0495597_0035059 3300046542 Bacteria 2265
231 Ga0495645_0010199 3300046543 Bacteria 6582
232 Ga0495645_0030517 3300046543 Bacteria 3925
233 Ga0495645_0046733 3300046543 Bacteria 3155
234 Ga0495622_0026903 3300046557 Bacteria 2684
235 Ga0495622_0045227 3300046557 Bacteria 2045
236 Ga0495622_0120515 3300046557 Bacteria 1198
237 Ga0495633_0023056 3300046558 Bacteria 3086
238 Ga0495633_0386453 3300046558 Bacteria 633
239 Ga0495667_0040143 3300046559 Bacteria 3109
240 Ga0495667_0364921 3300046559 Bacteria 912
241 Ga0495668_0001255 3300046616 Bacteria 25323
242 Ga0495668_0013071 3300046616 Bacteria 4912
243 Ga0495668_0616065 3300046616 Bacteria 600
244 Ga0495634_0010281 3300046642 Bacteria 6857
245 Ga0495634_0081288 3300046642 Bacteria 2119
246 Ga0495634_0793277 3300046642 Bacteria 540
247 Ga0495611_0024086 3300046648 Bacteria 2646
248 Ga0495611_0440321 3300046648 Bacteria 594
249 Ga0495625_0020482 3300046660 Bacteria 5105
250 Ga0495625_0021971 3300046660 Bacteria 4899
251 Ga0495625_0048656 3300046660 Bacteria 3052
252 Ga0495625_0109969 3300046660 Bacteria 1885
253 Ga0495625_0111731 3300046660 Bacteria 1867
254 Ga0495625_0495017 3300046660 Bacteria 748
255 Ga0495635_0004021 3300046663 Bacteria 10211
256 Ga0495635_0004044 3300046663 Bacteria 10179
257 Ga0495635_0043693 3300046663 Bacteria 3092
258 Ga0495635_0061696 3300046663 Bacteria 2574
259 Ga0495661_0102207 3300046665 Bacteria 1611
260 Ga0495657_0008356 3300046675 Bacteria 7930
261 Ga0495657_0016885 3300046675 Bacteria 5307
262 Ga0495657_0025861 3300046675 Bacteria 4164
263 Ga0495657_0034427 3300046675 Bacteria 3517
264 Ga0495599_0320327 3300046678 Bacteria 933
265 Ga0495623_0005639 3300046679 Bacteria 8170
266 Ga0495623_0032635 3300046679 Bacteria 3346
267 Ga0495646_0006975 3300046680 Bacteria 7175
268 Ga0495646_0023886 3300046680 Bacteria 3848
269 Ga0495646_0251625 3300046680 Bacteria 946
270 Ga0495658_0008912 3300046683 Bacteria 4989
271 Ga0495613_0016122 3300046689 Bacteria 5563
272 Ga0495613_0021963 3300046689 Bacteria 4757
273 Ga0495613_0052694 3300046689 Bacteria 2995
274 Ga0495613_0060180 3300046689 Bacteria 2782
275 Ga0495613_0068525 3300046689 Bacteria 2587
276 Ga0495613_0074849 3300046689 Bacteria 2465
277 Ga0495613_0196470 3300046689 Bacteria 1424
278 Ga0495624_0133199 3300046690 Bacteria 1523
279 Ga0495624_0364806 3300046690 Bacteria 868
280 Ga0495670_0086281 3300046691 Bacteria 1603
281 Ga0495671_0306074 3300046692 Bacteria 764
282 Ga0495649_0005957 3300046694 Bacteria 7642
283 Ga0495649_0382161 3300046694 Bacteria 708
284 Ga0495589_0004087 3300046794 Bacteria 7815
285 Ga0495589_0010809 3300046794 Bacteria 4743
286 Ga0495589_0015040 3300046794 Bacteria 3982
287 Ga0495589_0019687 3300046794 Bacteria 3455
288 Ga0495589_0023798 3300046794 Bacteria 3117
289 Ga0495600_0043225 3300046809 Bacteria 2938
290 Ga0495600_0102455 3300046809 Bacteria 1865
291 Ga0495581_0012744 3300047315 Bacteria 4870
292 Ga0495581_0038380 3300047315 Bacteria 2772
293 Ga0495581_0335688 3300047315 Bacteria 882
294 Ga0495604_0004849 3300047317 Bacteria 10656
295 Ga0495604_0017884 3300047317 Bacteria 5671
296 Ga0495604_0045318 3300047317 Bacteria 3432
297 Ga0495604_0590935 3300047317 Bacteria 713
298 Ga0495636_0011837 3300047318 Bacteria 3456
299 Ga0495636_0037407 3300047318 Bacteria 2005
300 Ga0495636_0123657 3300047318 Bacteria 1146
301 Ga0495636_0125329 3300047318 Bacteria 1139
302 Ga0495636_0166671 3300047318 Bacteria 995
303 Ga0495636_0176749 3300047318 Bacteria 967
304 Ga0495674_0153057 3300047319 Bacteria 1933
305 Ga0495674_0471794 3300047319 Bacteria 1006
306 Ga0495676_0001998 3300047321 Bacteria 17957
307 Ga0495676_0007209 3300047321 Bacteria 10198
308 Ga0495676_0023801 3300047321 Bacteria 5308
309 Ga0495676_0198883 3300047321 Bacteria 1393
310 Ga0495676_0235234 3300047321 Bacteria 1257
311 Ga0495676_0236188 3300047321 Bacteria 1253
312 Ga0495680_0026059 3300047322 Bacteria 4828
313 Ga0495683_0040401 3300047323 Bacteria 2357
314 Ga0495687_008682 3300047443 Bacteria 5788
315 Ga0495687_020773 3300047443 Bacteria 3194
316 Ga0495687_021836 3300047443 Bacteria 3085
317 Ga0495675_0043147 3300047444 Bacteria 2874
318 Ga0495675_0364868 3300047444 Bacteria 847
319 Ga0495675_0799300 3300047444 Bacteria 522
320 Ga0495677_0092016 3300047445 Bacteria 1143
321 Ga0495677_0099209 3300047445 Bacteria 1102
322 Ga0495685_002864 3300047447 Bacteria 5446
323 Ga0495685_018338 3300047447 Bacteria 2401
324 Ga0495685_022729 3300047447 Bacteria 2158
325 Ga0495685_034563 3300047447 Bacteria 1737
326 Ga0495673_0291615 3300047469 Bacteria 587
327 Ga0495681_0002976 3300047470 Bacteria 11937
328 Ga0495681_0045243 3300047470 Bacteria 2108
329 Ga0495684_0244919 3300047471 Bacteria 1306
330 Ga0495686_0041446 3300047472 Bacteria 2931
331 Ga0495686_0082138 3300047472 Bacteria 1967
332 Ga0495593_0000464 3300047673 Bacteria 22779
333 Ga0495593_0009667 3300047673 Bacteria 5596
334 Ga0495602_0003322 3300048088 Bacteria 16611
335 Ga0495602_0112553 3300048088 Bacteria 2209
336 Ga0495602_0269797 3300048088 Bacteria 1258
337 Ga0495614_0005399 3300048089 Bacteria 5767
338 Ga0495614_0035951 3300048089 Bacteria 2127
339 Ga0495614_0037293 3300048089 Bacteria 2085
340 Ga0495614_0110891 3300048089 Bacteria 1204
341 Ga0495626_0000942 3300048091 Bacteria 25310
342 Ga0495626_0015075 3300048091 Bacteria 3962
343 Ga0495626_0091003 3300048091 Bacteria 1341
344 Ga0496105_1007201 3300048908 Bacteria 623
345 Ga0495678_022370 3300049459 Bacteria 2765
346 Ga0501032_0736150 3300049569 Bacteria 624
347 Ga0501033_0025408 3300049570 Bacteria 4462
348 Ga0501034_1496700 3300049571 Bacteria 549
349 Ga0501036_0521426 3300049572 Bacteria 988
350 Ga0501037_0022989 3300049573 Bacteria 4611
351 Ga0501047_0000025 3300049581 Bacteria 225560
352 Ga0501047_0029733 3300049581 Bacteria 5266
353 Ga0501047_0553869 3300049581 Bacteria 974
354 Ga0501047_1196261 3300049581 Bacteria 574
355 Ga0501070_0517124 3300049586 Bacteria 958
356 Ga0501035_0037035 3300049822 Bacteria 4419
357 Ga0501035_0281913 3300049822 Bacteria 1404
358 Ga0501044_0106683 3300049823 Bacteria 2813
359 Ga0501044_0138596 3300049823 Bacteria 2422
360 Ga0501044_0415068 3300049823 Bacteria 1257
361 nmdc:mga06z11_20908_c1 3300050494 Bacteria 3032
362 Ga0495601_0016534 3300053077 Bacteria 4471
363 Ga0495601_0105783 3300053077 Bacteria 1819
364 Ga0495612_0002323 3300053078 Bacteria 7835
365 Ga0495612_0136657 3300053078 Bacteria 1061
366 Ga0495619_0141601 3300053085 Bacteria 1656
367 Ga0500644_0065542 3300053088 Bacteria 1293
368 Ga0500644_0107136 3300053088 Bacteria 1071
369 Ga0500646_0148921 3300053090 Bacteria 774
370 Ga0500640_040937 3300053095 Bacteria 2035
371 Ga0500641_0045935 3300053096 Bacteria 1780
372 Ga0500650_0019261 3300053098 Bacteria 2974
373 Ga0500553_037071 3300053101 Bacteria 2409
374 Ga0500560_024890 3300053107 Bacteria 1752
375 Ga0500569_044797 3300053109 Bacteria 1311
376 Ga0500572_055278 3300053111 Bacteria 1193
377 Ga0500614_046411 3300053123 Bacteria 1125
378 Ga0500652_001932 3300053131 Bacteria 6242
379 Ga0500573_0052732 3300053140 Bacteria 2338
380 Ga0500588_0165148 3300053146 Bacteria 808
381 Ga0500600_0053332 3300053149 Bacteria 2284
382 Ga0500600_0359235 3300053149 Bacteria 595
383 Ga0500624_001379 3300053157 Bacteria 4049
384 Ga0500630_167139 3300053159 Bacteria 907
385 Ga0500634_0136249 3300053161 Bacteria 1170
386 Ga0500565_010301 3300053734 Bacteria 951
387 Ga0466962_0002683 3300061719 Bacteria 8470
388 Ga0466962_0059580 3300061719 Bacteria 1822
389 Ga0466962_0110507 3300061719 Bacteria 1323
390 2547406881 2547132111 Bacteria 8013147
391 2585309120 2582581313 Bacteria 10042643
392 2585319325 2582581314 Bacteria 11452267
393 2616700801 2616644814 Bacteria 11555299
394 2644018738 2643221601 Bacteria 7493239
395 2644179873 2643221631 Bacteria 8168043
396 2644263116 2643221647 Bacteria 10741251
397 2644436444 2643221678 Bacteria 9540101
398 2644625716 2643221714 Bacteria 9015452
399 2784587907 2784132148 Bacteria 8627943
400 2785344228 2784746763 Bacteria 9783172
401 2786669760 2786546132 Bacteria 10419719
402 2808841329 2808606359 Bacteria 9866990
403 2808919861 2808606375 Bacteria 9466072
404 2809231502 2808606448 Bacteria 8656184
405 2812358922 2811994879 Bacteria 9313447
406 2812481188 2811994917 Bacteria 7761064
407 2852642163 2852635781 Bacteria 8251373
408 2862184845 2862178590 Bacteria 8583590
409 2862288083 2862281513 Bacteria 9621493
410 2862384882 2862382967 Bacteria 10317375
411 2862579949 2862574272 Bacteria 10567477
412 2863405479 2863404153 Bacteria 9672205
413 2867432901 2867428634 Bacteria 9590268
414 2877681860 2877676314 Bacteria 9512378
415 2887480573 2887478801 Bacteria 8972725
416 2887483360 2887478801 Bacteria 8972725
417 2919468726 2919468124 Bacteria 9133025
418 2935392328 2935390628 Bacteria 7043367
419 2946066962 2946064051 Bacteria 8957905
420 2947230273 2947224130 Bacteria 9938529
421 2954003601 2954002825 Bacteria 9173742
422 2954387000 2954380949 Bacteria 10050426
423 2954676186 2954673503 Bacteria 9685905
424 2954687982 2954682443 Bacteria 9862841
425 2954697833 2954691527 Bacteria 10720516
426 2954704383 2954701450 Bacteria 10834262
427 2954716948 2954711539 Bacteria 10867210
428 2954726898 2954721474 Bacteria 10456478
429 2954734899 2954731030 Bacteria 10243860
430 2954745818 2954740390 Bacteria 10229294
431 2954753770 2954749733 Bacteria 10366972
432 2954764793 2954759201 Bacteria 9358192
433 2990064796 2990059506 Bacteria 9321252
434 3006321796 3006321560 Bacteria 8247479
435 3006489129 3006486233 Bacteria 8157040
436 3006501818 3006493962 Bacteria 8825450
437 8008559592 8008558824 Bacteria 10610750
438 8023624501 8023623736 Bacteria 8593882
439 8048409258 8048406513 Bacteria 8936924
440 Ga0395900_0963109
441 JGI24740J21852_10103897
442 JGI24739J22299_10057482
443 JGI24738J21930_10027298
444 rootH1_10006639
445 rootH1_10042572
446 rootH2_10073039
447 rootL2_10013683
448 rootL2_10053244
449 rootH1_10000263
450 rootH1_10012842
451 rootH1_10014374
452 rootH1_10098050
453 Ga0006562J51391_1076924
454 Ga0006562J51391_1076925
455 Ga0070668_100000137
456 Ga0070675_100392250
457 Ga0070713_100605359
458 Ga0070710_10594689
459 Ga0070706_101209086
460 Ga0068853_100817351
461 Ga0068855_100483704
462 Ga0068852_101543923
463 Ga0068861_100515250
464 Ga0068860_100902658
465 Ga0081539_10000192
466 Ga0081539_10153199
467 Ga0075365_10259903
468 Ga0105245_11064608
469 Ga0105249_11984278
470 Ga0105246_10023851
471 Ga0105246_10957793
472 Ga0157369_10547160
473 Ga0157372_10543084
474 Ga0182007_10000820
475 Ga0183367_1006
476 Ga0207426_1058563
477 Ga0207647_10171537
478 Ga0207659_10381751
479 Ga0207687_10339762
480 Ga0207667_11016236
481 Ga0207668_10031633
482 Ga0207683_11515875
483 Ga0207698_11332683
484 Ga0209371_1050729
485 Ga0268265_10140813
486 Ga0268264_10478858
487 Ga0307515_10000044
488 Ga0307515_10021178
489 Ga0307515_10023740
490 Ga0307515_10177827
491 Ga0307515_10342829
492 Ga0268256_1057124
493 Ga0307511_10000836
494 Ga0307511_10041079
495 Ga0307511_10047962
496 Ga0307512_10011696
497 Ga0307512_10017823
498 Ga0307512_10033049
499 Ga0307512_10203711
500 Ga0307513_10022232
501 Ga0307513_10023841
502 Ga0307509_10009223
503 Ga0307509_10032989
504 Ga0307509_10080545
505 Ga0307408_100436130
506 Ga0307408_100659739
507 Ga0307508_10019786
508 Ga0307508_10033552
509 Ga0307508_10037700
510 Ga0307508_10246052
511 Ga0307514_10003374
512 Ga0307514_10065841
513 Ga0307514_10223771
514 Ga0307514_10228829
515 Ga0307514_10248863
516 Ga0307516_10000267
517 Ga0307516_10030972
518 Ga0307516_10056209
519 Ga0307516_10062973
520 Ga0307405_10244091
521 Ga0307405_10591264
522 Ga0307518_10014597
523 Ga0307410_10025595
524 Ga0326468_10000448
525 Ga0307406_10020921
526 Ga0307407_10117882
527 Ga0307409_100022827
528 Ga0307409_100923941
529 Ga0307416_100585818
530 Ga0307411_10085811
531 Ga0307415_100041419
532 Ga0307415_100094923
533 Ga0307507_10020284
534 Ga0307507_10146466
535 Ga0307510_10013144
536 Ga0307510_10061583
537 Ga0307510_10082021
538 Ga0307510_10227256
539 Ga0373951_0001731
540 Ga0373939_0049746
541 Ga0395898_0077057
542 Ga0395901_0192557
543 Ga0395901_0623740
544 Ga0439436_0004544
545 Ga0439439_0003593
546 Ga0439439_0015498
547 Ga0451800_0584569
548 Ga0451807_0679181
549 Ga0451841_0903561
550 Ga0451841_0990381
551 Ga0451851_1087189
552 Ga0451853_0604484
553 Ga0451853_1273788
554 Ga0451853_1400810
555 Ga0451853_3215495
556 Ga0439448_0099581
557 Ga0439449_0029289
558 Ga0439449_0058491
559 Ga0439455_0023840
560 Ga0439457_000183
561 Ga0439457_005022
562 Ga0450920_051369
563 Ga0450894_000115
564 Ga0450896_000855
565 Ga0450898_038370
566 Ga0450903_000433
567 Ga0450906_007513
568 Ga0439458_0096147
569 Ga0450908_002846
570 Ga0439459_0063505
571 Ga0466969_0010698
572 Ga0466969_0044695
573 Ga0466972_0014595
574 Ga0466972_0015374
575 Ga0466965_0002412
576 Ga0466966_0013343
577 Ga0466966_0032344
578 Ga0466966_0037340
579 Ga0466961_0003943
580 Ga0466961_0008296
581 Ga0466961_0028343
582 Ga0466961_0169523
583 Ga0466963_0009544
584 Ga0466963_0202594
585 Ga0466963_0638395
586 Ga0466964_0003003
587 Ga0466971_0001649
588 Ga0466971_0037516
589 Ga0466968_0144289
590 Ga0466970_0001497
591 Ga0466970_0070713
592 Ga0466970_0133443
593 Ga0466957_0003092
594 Ga0466960_0340055
595 Ga0466959_0045844
596 Ga0466959_0076433
597 Ga0466958_0003769
598 Ga0466958_0027269
599 Ga0466967_0002444
600 Ga0466967_0005882
601 Ga0466967_0066164
602 Ga0495627_072918
603 Ga0495592_0007025
604 Ga0495592_0063675
605 Ga0495603_0013426
606 Ga0495603_0017761
607 Ga0495603_0334784
608 Ga0495590_0019508
609 Ga0495590_0041242
610 Ga0495629_0005173
611 Ga0495629_0014785
612 Ga0495629_0363864
613 Ga0495638_0410560
614 Ga0495651_0000439
615 Ga0495651_0002722
616 Ga0495651_0042124
617 Ga0495582_0019399
618 Ga0495582_0195658
619 Ga0495605_0004131
620 Ga0495639_0306331
621 Ga0495662_0000218
622 Ga0495662_0001409
623 Ga0495662_0038095
624 Ga0495662_0105946
625 Ga0495664_0026985
626 Ga0495664_0070389
627 Ga0495664_0491311
628 Ga0495585_0024594
629 Ga0495594_0391340
630 Ga0495596_0079243
631 Ga0495607_0028860
632 Ga0495607_0072743
633 Ga0495583_0010997
634 Ga0495583_0049448
635 Ga0495583_0142669
636 Ga0495583_0155010
637 Ga0495606_0001734
638 Ga0495606_0008751
639 Ga0495608_0714525
640 Ga0495610_0018314
641 Ga0495610_0065271
642 Ga0495616_0003134
643 Ga0495618_0007931
644 Ga0495618_0037198
645 Ga0495620_0012810
646 Ga0495620_0017890
647 Ga0495620_0250196
648 Ga0495628_0094213
649 Ga0495628_0286284
650 Ga0495630_0062283
651 Ga0495630_0156668
652 Ga0495643_0034797
653 Ga0495644_0131931
654 Ga0495666_0091004
655 Ga0495666_0153932
656 Ga0495642_0035339
657 Ga0495652_0001811
658 Ga0495652_0036585
659 Ga0495652_0972780
660 Ga0495640_0044453
661 Ga0495586_0528695
662 Ga0495587_0002262
663 Ga0495587_0125349
664 Ga0495587_0372940
665 Ga0495609_0099787
666 Ga0495609_0145495
667 Ga0495597_0009613
668 Ga0495597_0035059
669 Ga0495645_0010199
670 Ga0495645_0030517
671 Ga0495645_0046733
672 Ga0495622_0026903
673 Ga0495622_0045227
674 Ga0495622_0120515
675 Ga0495633_0023056
676 Ga0495633_0386453
677 Ga0495667_0040143
678 Ga0495667_0364921
679 Ga0495668_0001255
680 Ga0495668_0013071
681 Ga0495668_0616065
682 Ga0495634_0010281
683 Ga0495634_0081288
684 Ga0495634_0793277
685 Ga0495611_0024086
686 Ga0495611_0440321
687 Ga0495625_0020482
688 Ga0495625_0021971
689 Ga0495625_0048656
690 Ga0495625_0109969
691 Ga0495625_0111731
692 Ga0495625_0495017
693 Ga0495635_0004021
694 Ga0495635_0004044
695 Ga0495635_0043693
696 Ga0495635_0061696
697 Ga0495661_0102207
698 Ga0495657_0008356
699 Ga0495657_0016885
700 Ga0495657_0025861
701 Ga0495657_0034427
702 Ga0495599_0320327
703 Ga0495623_0005639
704 Ga0495623_0032635
705 Ga0495646_0006975
706 Ga0495646_0023886
707 Ga0495646_0251625
708 Ga0495658_0008912
709 Ga0495613_0016122
710 Ga0495613_0021963
711 Ga0495613_0052694
712 Ga0495613_0060180
713 Ga0495613_0068525
714 Ga0495613_0074849
715 Ga0495613_0196470
716 Ga0495624_0133199
717 Ga0495624_0364806
718 Ga0495670_0086281
719 Ga0495671_0306074
720 Ga0495649_0005957
721 Ga0495649_0382161
722 Ga0495589_0004087
723 Ga0495589_0010809
724 Ga0495589_0015040
725 Ga0495589_0019687
726 Ga0495589_0023798
727 Ga0495600_0043225
728 Ga0495600_0102455
729 Ga0495581_0012744
730 Ga0495581_0038380
731 Ga0495581_0335688
732 Ga0495604_0004849
733 Ga0495604_0017884
734 Ga0495604_0045318
735 Ga0495604_0590935
736 Ga0495636_0011837
737 Ga0495636_0037407
738 Ga0495636_0123657
739 Ga0495636_0125329
740 Ga0495636_0166671
741 Ga0495636_0176749
742 Ga0495674_0153057
743 Ga0495674_0471794
744 Ga0495676_0001998
745 Ga0495676_0007209
746 Ga0495676_0023801
747 Ga0495676_0198883
748 Ga0495676_0235234
749 Ga0495676_0236188
750 Ga0495680_0026059
751 Ga0495683_0040401
752 Ga0495687_008682
753 Ga0495687_020773
754 Ga0495687_021836
755 Ga0495675_0043147
756 Ga0495675_0364868
757 Ga0495675_0799300
758 Ga0495677_0092016
759 Ga0495677_0099209
760 Ga0495685_002864
761 Ga0495685_018338
762 Ga0495685_022729
763 Ga0495685_034563
764 Ga0495673_0291615
765 Ga0495681_0002976
766 Ga0495681_0045243
767 Ga0495684_0244919
768 Ga0495686_0041446
769 Ga0495686_0082138
770 Ga0495593_0000464
771 Ga0495593_0009667
772 Ga0495602_0003322
773 Ga0495602_0112553
774 Ga0495602_0269797
775 Ga0495614_0005399
776 Ga0495614_0035951
777 Ga0495614_0037293
778 Ga0495614_0110891
779 Ga0495626_0000942
780 Ga0495626_0015075
781 Ga0495626_0091003
782 Ga0496105_1007201
783 Ga0495678_022370
784 Ga0501032_0736150
785 Ga0501033_0025408
786 Ga0501034_1496700
787 Ga0501036_0521426
788 Ga0501037_0022989
789 Ga0501047_0000025
790 Ga0501047_0029733
791 Ga0501047_0553869
792 Ga0501047_1196261
793 Ga0501070_0517124
794 Ga0501035_0037035
795 Ga0501035_0281913
796 Ga0501044_0106683
797 Ga0501044_0138596
798 Ga0501044_0415068
799 nmdc:mga06z11_20908_c1
800 Ga0495601_0016534
801 Ga0495601_0105783
802 Ga0495612_0002323
803 Ga0495612_0136657
804 Ga0495619_0141601
805 Ga0500644_0065542
806 Ga0500644_0107136
807 Ga0500646_0148921
808 Ga0500640_040937
809 Ga0500641_0045935
810 Ga0500650_0019261
811 Ga0500553_037071
812 Ga0500560_024890
813 Ga0500569_044797
814 Ga0500572_055278
815 Ga0500614_046411
816 Ga0500652_001932
817 Ga0500573_0052732
818 Ga0500588_0165148
819 Ga0500600_0053332
820 Ga0500600_0359235
821 Ga0500624_001379
822 Ga0500630_167139
823 Ga0500634_0136249
824 Ga0500565_010301
825 Ga0466962_0002683
826 Ga0466962_0059580
827 Ga0466962_0110507
828 2547406881
829 2585309120
830 2585319325
831 2616700801
832 2644018738
833 2644179873
834 2644263116
835 2644436444
836 2644625716
837 2784587907
838 2785344228
839 2786669760
840 2808841329
841 2808919861
842 2809231502
843 2812358922
844 2812481188
845 2852642163
846 2862184845
847 2862288083
848 2862384882
849 2862579949
850 2863405479
851 2867432901
852 2877681860
853 2887480573
854 2887483360
855 2919468726
856 2935392328
857 2946066962
858 2947230273
859 2954003601
860 2954387000
861 2954676186
862 2954687982
863 2954697833
864 2954704383
865 2954716948
866 2954726898
867 2954734899
868 2954745818
869 2954753770
870 2954764793
871 2990064796
872 3006321796
873 3006489129
874 3006501818
875 8008559592
876 8023624501
877 8048409258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13463

HTH_27

Winged helix DNA-binding domain

81

112

0.96

PF12802

MarR_2

MarR family

51

103

0.92

PF01047

MarR

MarR family

53

104

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f2e-assembly1.cif.gz_A crystal structure of pa1607, a putative transcription factor 0.9008 74 130
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.8792 54 127
3hrm-assembly1.cif.gz_B crystal structure of staphylococcus aureus protein sarz in sulfenic acid form 0.8753 27 139
3bja-assembly1.cif.gz_A-2 crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution 0.8678 24 154
5hso-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with dna 0.8608 34 148
ID Description Score Start End Superfamily
af_Q4DKK4_76_138_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.898 59 120 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8921 54 117 1.10.10.10
af_K7LWV0_206_275_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8915 73 103 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.888 57 118 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8878 72 118 3.30.230.130
ID Description Score Start End GO Terms
AF-A0A428XH99-F1-model_v4 MarR family transcriptional regulator 0.9383 30 152 GO:0003677
GO:0003700
GO:0006950
AF-A0A522ZHY9-F1-model_v4 MarR family transcriptional regulator 0.9289 7 148 GO:0003700
GO:0006950
AF-A0A7K2JB13-F1-model_v4 MarR family transcriptional regulator 0.9243 31 152 GO:0003677
GO:0003700
GO:0006950
AF-G4QGB2-F1-model_v4 Transcriptional regulator protein 0.9209 7 148 GO:0003677
GO:0003700
AF-A0A1Q4VHE7-F1-model_v4 Transcriptional regulator 0.9202 23 153 GO:0003677
GO:0003700

Map