F444034

General Info

Members Datasets Scaffolds Average Seq Length
438 265 874 267

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0022048|Ga0439465_0022048_117_1091
Length 324
Sequence MAPIRVLAQRLAGYWARLGDSLRGGSKARRLAMAACMQQLRSSLDRKRSLDRSIQENSMSKAKVLVVGSNATQIEIQGGGTGPTGQYLNETVVPAMALVEAGYDIVLATPNGTKPYIDPVSDVAQHFDGDEAAYQRGRAFFDDYPAMVDVRTLRSAIDGGLDSYAGLFVPGGQAPVVDLMQDADLGEILRHFHARGKPTAFLCHGPIASLAALPRAKEYRAALIAGDLSKASELGKGWQYAGYKMTVFSASEEKPIEENVLHGKLYFNMPDALRGAGGDVTTGKIDFAPHVVVDRELITGQNPRSDHPLAAKLVEALDRATAAA

Samples

Sample ID Description Type Environment
1 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
105 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
106 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
111 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
112 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
160 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
161 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
162 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
163 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
167 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
174 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
175 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
178 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
179 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
180 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
181 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
182 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
183 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
184 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
185 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
186 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
187 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
188 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
189 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
190 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
191 2791355199
192 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
193 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
194 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
195 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
196 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
197 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
198 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
199 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
200 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
201 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
202 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
203 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
204 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
205 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
206 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
207 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
208 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
209 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
210 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
211 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
212 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
213 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
214 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
215 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
216 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
217 2922368715
218 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
219 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
220 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
221 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
222 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
223 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
224 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
225 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
226 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
227 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
228 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
229 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
230 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
231 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
232 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
233 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
234 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
235 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
236 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
237 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
238 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
239 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
240 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
241 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
242 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
243 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
244 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
245 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
246 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
247 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
248 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
249 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
250 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
251 2936381700 Rhizobium chutanense C16 Isolate Unclassified
252 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
253 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
254 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
255 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
256 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
257 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
258 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
259 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
260 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
261 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
262 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
263 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
264 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
265 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.59
Metatranscriptomes 0
Isolates 20.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.2
Nodule 15.3
Rhizoplane 2.74
Rhizosphere 38.81
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439465_0022048 3300041413 Bacteria 2000
2 SwRhRL2b_contig_282692 2162886007 Bacteria 4508
3 JGI25158J39367_1000058 3300002739 Bacteria 24608
4 JGI25152J39213_1002178 3300002773 Bacteria 7668
5 JGI25150J39212_1000059 3300002774 Bacteria 65863
6 JGI25159J45721_1000684 3300002987 Bacteria 14894
7 JGI25151J46595_10043098 3300003187 Bacteria 1619
8 JGI25153J46596_10000080 3300003215 Bacteria 113263
9 JGI25153J46596_10002161 3300003215 Bacteria 11500
10 rootH1_10081177 3300003316 Bacteria 3456
11 rootH1_10190196 3300003316 Bacteria 1586
12 rootH2_10059461 3300003320 Bacteria 2018
13 rootH2_10080421 3300003320 Bacteria 3319
14 rootL2_10112127 3300003322 Bacteria 9697
15 rootL2_10116084 3300003322 Bacteria 2112
16 rootL2_10265445 3300003322 Bacteria 2229
17 rootL2_10270642 3300003322 Bacteria 1684
18 rootH1_10043892 3300003323 Bacteria 37623
19 rootH1_10227338 3300003323 Bacteria 1592
20 JGI25160J50197_1001646 3300003354 Bacteria 10948
21 JGI25161J50226_1000027 3300003374 Bacteria 145847
22 JGI25404J52841_10000234 3300003659 Bacteria 6922
23 JGI25404J52841_10001078 3300003659 Bacteria 4574
24 JGI25404J52841_10002115 3300003659 Bacteria 3692
25 JGI25404J52841_10005240 3300003659 Bacteria 2675
26 JGI25404J52841_10005851 3300003659 Bacteria 2550
27 JGI25404J52841_10010786 3300003659 Bacteria 1966
28 JGI25404J52841_10047597 3300003659 Unclassified 904
29 Ga0055542_1005540 3300003762 Bacteria 2830
30 Ga0055542_1005862 3300003762 Bacteria 2699
31 Ga0055526_1000338 3300003771 Bacteria 38466
32 Ga0055537_1001246 3300003773 Bacteria 10636
33 Ga0055524_1001477 3300003775 Bacteria 13410
34 Ga0055524_1010890 3300003775 Bacteria 3591
35 Ga0055524_1011900 3300003775 Bacteria 3370
36 Ga0055536_1003109 3300003781 Bacteria 9028
37 Ga0055528_1000788 3300003790 Bacteria 21984
38 Ga0055530_10000355 3300003791 Bacteria 41390
39 Ga0055530_10009036 3300003791 Bacteria 3885
40 Ga0055530_10032445 3300003791 Bacteria 1358
41 Ga0055540_1000238 3300003792 Bacteria 50223
42 Ga0055531_10000462 3300003794 Bacteria 37593
43 Ga0055531_10001400 3300003794 Bacteria 17849
44 Ga0055531_10004115 3300003794 Bacteria 8991
45 Ga0065165_1002793 3300005262 Bacteria 13765
46 Ga0065704_10075366 3300005289 Bacteria 5632
47 Ga0070666_10270286 3300005335 Bacteria 1206
48 Ga0070668_100018326 3300005347 Bacteria 5255
49 Ga0070668_100026011 3300005347 Bacteria 4438
50 Ga0070669_100124674 3300005353 Bacteria 1970
51 Ga0070669_100132363 3300005353 Bacteria 1915
52 Ga0070671_100306912 3300005355 Bacteria 1351
53 Ga0070667_100002325 3300005367 Bacteria 16641
54 Ga0070667_100206308 3300005367 Bacteria 1745
55 Ga0070700_100325181 3300005441 Bacteria 1131
56 Ga0070708_100275584 3300005445 Bacteria 1583
57 Ga0070663_100191891 3300005455 Bacteria 1590
58 Ga0068867_100124316 3300005459 Bacteria 1997
59 Ga0070706_100077637 3300005467 Bacteria 3074
60 Ga0070698_100212720 3300005471 Bacteria 1867
61 Ga0070699_100027177 3300005518 Bacteria 4935
62 Ga0070699_100238642 3300005518 Bacteria 1622
63 Ga0070679_100061470 3300005530 Bacteria 3744
64 Ga0070697_100055505 3300005536 Bacteria 3221
65 Ga0070697_100076447 3300005536 Bacteria 2753
66 Ga0068853_100030626 3300005539 Bacteria 4547
67 Ga0068852_100140560 3300005616 Bacteria 2234
68 Ga0068859_100501296 3300005617 Bacteria 1309
69 Ga0068863_100001669 3300005841 Bacteria 21942
70 Ga0068863_100014024 3300005841 Bacteria 7721
71 Ga0068862_100087772 3300005844 Bacteria 2705
72 Ga0068862_100164654 3300005844 Bacteria 1981
73 Ga0081455_10010384 3300005937 Bacteria 9461
74 Ga0081455_10031989 3300005937 Bacteria 4748
75 Ga0081540_1000094 3300005983 Bacteria 93201
76 Ga0081540_1000180 3300005983 Bacteria 65914
77 Ga0081540_1000195 3300005983 Bacteria 62863
78 Ga0081540_1000653 3300005983 Bacteria 32747
79 Ga0081540_1001489 3300005983 Bacteria 20223
80 Ga0081540_1001970 3300005983 Bacteria 17130
81 Ga0081540_1004497 3300005983 Bacteria 10591
82 Ga0081540_1005512 3300005983 Bacteria 9439
83 Ga0081540_1005631 3300005983 Bacteria 9330
84 Ga0081540_1005691 3300005983 Bacteria 9250
85 Ga0081540_1006224 3300005983 Bacteria 8748
86 Ga0081540_1007206 3300005983 Bacteria 7977
87 Ga0081540_1007656 3300005983 Bacteria 7660
88 Ga0081540_1009969 3300005983 Bacteria 6477
89 Ga0081540_1010740 3300005983 Bacteria 6165
90 Ga0081540_1014560 3300005983 Bacteria 5030
91 Ga0081540_1015355 3300005983 Bacteria 4851
92 Ga0081540_1018055 3300005983 Bacteria 4342
93 Ga0081540_1018212 3300005983 Bacteria 4317
94 Ga0081540_1021783 3300005983 Bacteria 3803
95 Ga0081540_1038774 3300005983 Bacteria 2507
96 Ga0081540_1045498 3300005983 Bacteria 2228
97 Ga0081540_1051121 3300005983 Bacteria 2046
98 Ga0081540_1094221 3300005983 Bacteria 1309
99 Ga0081540_1098609 3300005983 Bacteria 1265
100 Ga0081540_1134718 3300005983 Bacteria 1002
101 Ga0070717_10270886 3300006028 Bacteria 1504
102 Ga0075365_10074464 3300006038 Bacteria 2290
103 Ga0075367_10108916 3300006178 Bacteria 1699
104 Ga0075369_10020456 3300006186 Bacteria 2710
105 Ga0075366_10031097 3300006195 Bacteria 3141
106 Ga0097620_100008745 3300006931 Bacteria 10232
107 Ga0097620_100501252 3300006931 Bacteria 1309
108 Ga0079104_1000010 3300006946 Bacteria 366021
109 Ga0105247_10131723 3300009101 Bacteria 1630
110 Ga0105248_10001374 3300009177 Bacteria 27145
111 Ga0105248_10043306 3300009177 Bacteria 5048
112 Ga0105248_10123881 3300009177 Bacteria 2915
113 Ga0105248_10878624 3300009177 Bacteria 1012
114 Ga0105237_10012252 3300009545 Bacteria 9038
115 Ga0105238_10001053 3300009551 Bacteria 27882
116 Ga0105238_10007525 3300009551 Bacteria 10906
117 Ga0105239_10009289 3300010375 Bacteria 11113
118 Ga0163162_10192913 3300013306 Bacteria 2165
119 Ga0157379_10446799 3300014968 Unclassified 1193
120 Ga0163161_10078407 3300017792 Bacteria 2428
121 Ga0213872_10002060 3300021361 Bacteria 12187
122 Ga0213872_10005918 3300021361 Bacteria 6206
123 Ga0213872_10021319 3300021361 Bacteria 2984
124 Ga0213876_10000089 3300021384 Bacteria 104386
125 Ga0213871_10062809 3300021441 Bacteria 1037
126 Ga0209436_100009 3300025208 Bacteria 143684
127 Ga0207425_1000019 3300025245 Bacteria 399942
128 Ga0209148_1000809 3300025254 Bacteria 22723
129 Ga0209148_1001896 3300025254 Bacteria 8596
130 Ga0209129_1001259 3300025258 Bacteria 14526
131 Ga0209129_1002116 3300025258 Bacteria 10102
132 Ga0209233_1003927 3300025261 Bacteria 5163
133 Ga0209233_1009883 3300025261 Bacteria 2883
134 Ga0209565_1000052 3300025263 Bacteria 212056
135 Ga0209455_1000809 3300025272 Bacteria 17075
136 Ga0209455_1001126 3300025272 Bacteria 12988
137 Ga0209673_1000054 3300025273 Bacteria 279116
138 Ga0209673_1001339 3300025273 Bacteria 24643
139 Ga0209673_1019098 3300025273 Bacteria 2472
140 Ga0209130_1000031 3300025284 Bacteria 322932
141 Ga0209130_1015791 3300025284 Bacteria 1848
142 Ga0209676_1000430 3300025292 Bacteria 72819
143 Ga0209676_1000878 3300025292 Bacteria 38502
144 Ga0209676_1008193 3300025292 Bacteria 4716
145 Ga0209025_1000268 3300025294 Bacteria 121656
146 Ga0209025_1007265 3300025294 Bacteria 8323
147 Ga0209564_1000750 3300025295 Bacteria 45965
148 Ga0209564_1000952 3300025295 Bacteria 37023
149 Ga0209758_1000019 3300025297 Bacteria 743682
150 Ga0209758_1002736 3300025297 Bacteria 17345
151 Ga0209758_1015224 3300025297 Bacteria 4005
152 Ga0209758_1020704 3300025297 Bacteria 3097
153 Ga0209758_1069209 3300025297 Bacteria 1120
154 Ga0209050_1000001 3300025298 Bacteria 3563507
155 Ga0209050_1000166 3300025298 Bacteria 152073
156 Ga0209050_1001051 3300025298 Bacteria 33998
157 Ga0209050_1004528 3300025298 Bacteria 9343
158 Ga0209050_1027700 3300025298 Bacteria 1860
159 Ga0209256_1003106 3300025299 Bacteria 12152
160 Ga0209256_1003228 3300025299 Bacteria 11763
161 Ga0207426_1000042 3300025302 Bacteria 433289
162 Ga0207426_1001359 3300025302 Bacteria 20741
163 Ga0207426_1020686 3300025302 Bacteria 2284
164 Ga0209051_1000364 3300025303 Bacteria 66340
165 Ga0209051_1015260 3300025303 Bacteria 3544
166 Ga0209257_1000155 3300025304 Bacteria 182928
167 Ga0209257_1000535 3300025304 Bacteria 65964
168 Ga0209257_1000543 3300025304 Bacteria 64840
169 Ga0209257_1000850 3300025304 Bacteria 43660
170 Ga0207684_10476980 3300025910 Bacteria 1070
171 Ga0207671_10012450 3300025914 Bacteria 6834
172 Ga0207652_10045409 3300025921 Bacteria 3746
173 Ga0207646_10389839 3300025922 Bacteria 1258
174 Ga0207681_10151509 3300025923 Bacteria 1738
175 Ga0207694_10000011 3300025924 Bacteria 417640
176 Ga0207694_10247620 3300025924 Bacteria 1457
177 Ga0207711_10001991 3300025941 Bacteria 18517
178 Ga0207668_10003652 3300025972 Bacteria 9042
179 Ga0207658_10004748 3300025986 Bacteria 9408
180 Ga0207678_10009491 3300026067 Bacteria 8557
181 Ga0207641_10000645 3300026088 Bacteria 37951
182 Ga0207641_10017071 3300026088 Bacteria 5938
183 Ga0207675_100626985 3300026118 Unclassified 1080
184 Ga0209281_1000078 3300027111 Bacteria 261622
185 Ga0268266_10195575 3300028379 Bacteria 1848
186 Ga0268266_10306741 3300028379 Bacteria 1482
187 Ga0268266_10361689 3300028379 Bacteria 1366
188 Ga0268265_10052345 3300028380 Bacteria 3087
189 Ga0268265_10434466 3300028380 Bacteria 1222
190 Ga0268264_10373619 3300028381 Bacteria 1363
191 Ga0307406_10037031 3300031901 Bacteria 3010
192 Ga0436365_1738066 3300039437 Bacteria 103785
193 Ga0436360_0602373 3300039438 Bacteria 2805
194 Ga0436360_0682032 3300039438 Bacteria 7281
195 Ga0436360_1114013 3300039438 Bacteria 1938
196 Ga0436361_0242276 3300039447 Bacteria 1326
197 Ga0436361_0305675 3300039447 Bacteria 7329
198 Ga0436361_0354778 3300039447 Bacteria 18501
199 Ga0436361_0715355 3300039447 Bacteria 2126
200 Ga0436361_0967428 3300039447 Bacteria 5742
201 Ga0436361_1005487 3300039447 Bacteria 948
202 Ga0439465_0000241 3300041413 Bacteria 14979
203 Ga0439465_0022183 3300041413 Bacteria 1994
204 Ga0439465_0030523 3300041413 Bacteria 1715
205 Ga0451802_0049085 3300041460 Bacteria 1764
206 Ga0451806_135301 3300041462 Bacteria 5010
207 Ga0451845_0561346 3300041501 Bacteria 2843
208 Ga0439431_0000436 3300041997 Bacteria 8839
209 Ga0439431_0006063 3300041997 Bacteria 2669
210 Ga0439445_0001063 3300042004 Bacteria 5865
211 Ga0439445_0020381 3300042004 Bacteria 1659
212 Ga0439449_0021656 3300042007 Bacteria 2407
213 Ga0450909_018686 3300042185 Bacteria 1030
214 Ga0439435_0043678 3300042436 Bacteria 1262
215 Ga0495627_000464 3300046453 Bacteria 35052
216 Ga0495638_0000629 3300046460 Bacteria 38947
217 Ga0495638_0049543 3300046460 Plasmid 2626
218 Ga0495638_0155358 3300046460 Bacteria 1324
219 Ga0495650_0000007 3300046471 Bacteria 718072
220 Ga0495582_0136848 3300046473 Bacteria 1387
221 Ga0495607_0004609 3300046501 Bacteria 10095
222 Ga0495607_0083294 3300046501 Unclassified 1752
223 Ga0495606_0028744 3300046507 Bacteria 3916
224 Ga0495606_0033000 3300046507 Bacteria 3577
225 Ga0495608_0119466 3300046511 Bacteria 1691
226 Ga0495610_0000063 3300046512 Bacteria 127282
227 Ga0495610_0019096 3300046512 Bacteria 3846
228 Ga0495610_0130189 3300046512 Bacteria 1093
229 Ga0495628_0241619 3300046516 Bacteria 1351
230 Ga0495643_0000007 3300046522 Bacteria 383435
231 Ga0495643_0022391 3300046522 Bacteria 3606
232 Ga0495625_0007872 3300046660 Bacteria 9181
233 Ga0495625_0049179 3300046660 Bacteria 3032
234 Ga0495625_0202090 3300046660 Bacteria 1311
235 Ga0495635_0043440 3300046663 Bacteria 3101
236 Ga0495613_0042716 3300046689 Bacteria 3354
237 Ga0495649_0017298 3300046694 Bacteria 4069
238 Ga0495649_0089263 3300046694 Bacteria 1644
239 Ga0495604_0027517 3300047317 Bacteria 4521
240 Ga0495673_0003692 3300047469 Bacteria 9974
241 Ga0495681_0066358 3300047470 Bacteria 1647
242 Ga0495626_0057016 3300048091 Bacteria 1788
243 Ga0496100_0288664 3300048903 Bacteria 1225
244 Ga0496102_0065310 3300048905 Bacteria 3335
245 Ga0496102_0672624 3300048905 Bacteria 958
246 Ga0496104_0010168 3300048907 Bacteria 8397
247 Ga0496105_0008275 3300048908 Bacteria 8088
248 Ga0496106_0086418 3300048909 Bacteria 2415
249 Ga0496112_0652151 3300048915 Bacteria 982
250 Ga0496113_0015219 3300048916 Bacteria 5278
251 Ga0496114_0097430 3300048917 Bacteria 2505
252 Ga0496116_0011360 3300048919 Bacteria 7384
253 Ga0496116_0020945 3300048919 Bacteria 4946
254 Ga0496116_0048244 3300048919 Bacteria 2859
255 Ga0496117_0013228 3300048920 Bacteria 7213
256 Ga0496117_0013854 3300048920 Bacteria 6993
257 Ga0496117_0016719 3300048920 Bacteria 6169
258 Ga0496117_0045968 3300048920 Bacteria 3146
259 Ga0496117_0143331 3300048920 Bacteria 1427
260 Ga0496118_0002332 3300048921 Bacteria 25731
261 Ga0496118_0018597 3300048921 Bacteria 6257
262 Ga0496118_0025470 3300048921 Bacteria 5071
263 Ga0496118_0041658 3300048921 Bacteria 3632
264 Ga0496118_0058363 3300048921 Bacteria 2884
265 Ga0496118_0126250 3300048921 Bacteria 1655
266 Ga0496121_0000125 3300048924 Bacteria 169274
267 Ga0496121_0003347 3300048924 Bacteria 22997
268 Ga0496121_0009953 3300048924 Bacteria 10824
269 Ga0496121_0011173 3300048924 Bacteria 10012
270 Ga0496121_0016701 3300048924 Bacteria 7553
271 Ga0496121_0039090 3300048924 Bacteria 4188
272 Ga0496121_0046837 3300048924 Bacteria 3696
273 Ga0496121_0049995 3300048924 Bacteria 3537
274 Ga0496121_0052359 3300048924 Bacteria 3429
275 Ga0496121_0099425 3300048924 Bacteria 2248
276 Ga0496121_0101890 3300048924 Bacteria 2213
277 Ga0496121_0177548 3300048924 Bacteria 1541
278 Ga0496121_0180094 3300048924 Bacteria 1526
279 Ga0496121_0333422 3300048924 Bacteria 1017
280 Ga0496122_0002563 3300048925 Bacteria 25535
281 Ga0496122_0009424 3300048925 Bacteria 10291
282 Ga0496122_0017180 3300048925 Bacteria 6783
283 Ga0496122_0097854 3300048925 Bacteria 1973
284 Ga0496123_0002105 3300048926 Bacteria 25563
285 Ga0496123_0016045 3300048926 Bacteria 6107
286 Ga0496123_0063907 3300048926 Bacteria 2348
287 Ga0496124_0000043 3300048927 Bacteria 300907
288 Ga0496124_0002530 3300048927 Bacteria 23729
289 Ga0496124_0011381 3300048927 Bacteria 8897
290 Ga0496124_0025089 3300048927 Bacteria 5405
291 Ga0496124_0041577 3300048927 Bacteria 3965
292 Ga0496124_0078998 3300048927 Bacteria 2710
293 Ga0496125_0000525 3300048928 Bacteria 66539
294 Ga0496125_0002260 3300048928 Bacteria 25563
295 Ga0496125_0012943 3300048928 Bacteria 8237
296 Ga0496125_0024876 3300048928 Bacteria 5495
297 Ga0496125_0038891 3300048928 Bacteria 4107
298 Ga0496125_0196494 3300048928 Bacteria 1326
299 Ga0496126_0002132 3300048929 Bacteria 27592
300 Ga0496126_0014610 3300048929 Bacteria 7929
301 Ga0496126_0031745 3300048929 Bacteria 4984
302 Ga0496126_0046296 3300048929 Bacteria 3991
303 Ga0496126_0061365 3300048929 Bacteria 3378
304 Ga0496126_0105441 3300048929 Bacteria 2461
305 Ga0496126_0328832 3300048929 Bacteria 1255
306 Ga0496126_0331366 3300048929 Unclassified 1249
307 Ga0495682_0074072 3300049460 Bacteria 1225
308 Ga0501073_0066162 3300049589 Bacteria 2520
309 Ga0501224_002613 3300049664 Bacteria 2470
310 Ga0501249_000045 3300049679 Bacteria 51759
311 Ga0501083_0058894 3300049744 Bacteria 2569
312 Ga0501044_0154623 3300049823 Bacteria 2274
313 Ga0501204_001436 3300049850 Bacteria 2332
314 nmdc:mga0yw44_15556_c1 3300050492 Bacteria 3060
315 nmdc:mga0yw44_2906_c1 3300050492 Bacteria 7449
316 nmdc:mga06z11_200430_c1 3300050494 Bacteria 1159
317 nmdc:mga0sz30_19085_c1 3300050516 Bacteria 1898
318 nmdc:mga0sz30_28594_c1 3300050516 Bacteria 2295
319 Ga0500578_0205530 3300053086 Bacteria 1203
320 Ga0500651_0034908 3300053093 Bacteria 3170
321 Ga0500555_000139 3300053103 Bacteria 34376
322 Ga0500569_001631 3300053109 Bacteria 4269
323 Ga0500572_008057 3300053111 Bacteria 2454
324 Ga0500595_001411 3300053119 Bacteria 12897
325 Ga0500608_000477 3300053122 Bacteria 14980
326 Ga0500618_000007 3300053125 Bacteria 226268
327 Ga0500618_008314 3300053125 Bacteria 2903
328 Ga0500642_0004845 3300053130 Bacteria 4264
329 Ga0500655_010873 3300053133 Bacteria 1646
330 Ga0500559_0006718 3300053136 Bacteria 5167
331 Ga0500559_0074678 3300053136 Bacteria 1532
332 Ga0500568_0000688 3300053139 Bacteria 24395
333 Ga0500568_0009561 3300053139 Bacteria 4594
334 Ga0500568_0016250 3300053139 Bacteria 3315
335 Ga0500568_0056901 3300053139 Bacteria 1523
336 Ga0500577_0000237 3300053142 Bacteria 14653
337 Ga0500604_0000039 3300053151 Bacteria 50663
338 Ga0500616_0002680 3300053153 Bacteria 14474
339 Ga0500622_0000117 3300053156 Bacteria 82720
340 Ga0500622_0003423 3300053156 Bacteria 10638
341 Ga0500622_0023190 3300053156 Bacteria 3288
342 Ga0500627_0000416 3300053158 Bacteria 11500
343 Ga0500627_0004113 3300053158 Bacteria 4619
344 Ga0500601_000630 3300053737 Bacteria 4978
345 Ga0500661_019957 3300055283 Bacteria 1192
346 Ga0501082_0304242 3300060353 Bacteria 1389
347 2511194072 2510917030 Bacteria 7460662
348 2513571582 2513237084 Bacteria 7231967
349 2517078271 2516653085 Bacteria 7346596
350 2524465166 2524023210 Bacteria 9029266
351 2585151465 2582581280 Bacteria 5994497
352 2585195661 2582581293 Bacteria 5907401
353 2585223362 2582581298 Bacteria 7315509
354 2585546042 2585427529 Bacteria 7395659
355 2585548925 2585427529 Bacteria 7395659
356 2599720581 2599185236 Bacteria 6875203
357 2644242057 2643221643 Bacteria 5749658
358 2766064316 2765235942 Bacteria 7445910
359 2776267325 2775506902 Bacteria 6208009
360 2776281452 2775506904 Bacteria 5954060
361 2778125764 2775507255 Bacteria 3945731
362 2793082922
363 2821124085 2821123053 Bacteria 7836056
364 2824661435 2824661429 Bacteria 9877870
365 2828307829 2828305725 Bacteria 4916900
366 2838690235 2838686498 Bacteria 7807632
367 2838732010 2838729681 Bacteria 7400765
368 2838738889 2838736955 Bacteria 5760694
369 2838744906 2838742623 Bacteria 7396178
370 2841842788 2841840854 Bacteria 5761912
371 2841855963 2841851746 Bacteria 7532261
372 2842116904 2842110456 Bacteria 7656360
373 2842142568 2842140634 Bacteria 5759631
374 2842161133 2842156927 Bacteria 6894975
375 2842184749 2842180545 Bacteria 6888678
376 2842232332 2842229732 Bacteria 7475766
377 2842246747 2842243621 Bacteria 7421798
378 2842261151 2842257432 Bacteria 7401195
379 2842274255 2842271015 Bacteria 7807131
380 2844457067 2844454524 Bacteria 7952546
381 2857519523 2857516855 Bacteria 7787325
382 2857531648 2857531043 Bacteria 6754041
383 2879104540 2879099564 Bacteria 10442239
384 2904690834 2904690495 Bacteria 9412302
385 2909401639 2909399089 Bacteria 3922598
386 2919101758 2919100787 Bacteria 7710546
387 2919451308 2919450847 Bacteria 5631160
388 2922374704
389 2929621792 2929615660 Bacteria 9193770
390 2929629901 2929624759 Bacteria 9339455
391 2932788645 2932784394 Bacteria 9704911
392 2932817418 2932809354 Bacteria 9135765
393 2932826187 2932818245 Bacteria 9955613
394 2932830293 2932828146 Bacteria 9745859
395 2933583932 2933577622 Bacteria 9116884
396 2933593092 2933586486 Bacteria 7667493
397 2935616584 2935616580 Bacteria 9032984
398 2935642086 2935638405 Bacteria 10015038
399 2935672530 2935665750 Bacteria 9571747
400 2935676005 2935675223 Bacteria 9928132
401 2935685996 2935684952 Bacteria 9590419
402 2935697759 2935694250 Bacteria 9291695
403 2935705837 2935703347 Bacteria 10242284
404 2935714548 2935713505 Bacteria 9608509
405 2935725167 2935722832 Bacteria 9608746
406 2935732473 2935732158 Bacteria 9706831
407 2935741852 2935741537 Bacteria 9707219
408 2935751961 2935750917 Bacteria 9590372
409 2935765218 2935760218 Bacteria 9817913
410 2935802834 2935801545 Bacteria 9301974
411 2935813334 2935810662 Bacteria 9401221
412 2935830253 2935827899 Bacteria 10038562
413 2935838150 2935837841 Bacteria 9454360
414 2935855208 2935855204 Bacteria 9035059
415 2935867529 2935864058 Bacteria 9784707
416 2935875633 2935873716 Bacteria 9632195
417 2935996316 2935992306 Bacteria 9802711
418 2936003599 2936002035 Bacteria 9362176
419 2936042283 2936037263 Bacteria 9446081
420 2936372356 2936367885 Bacteria 7324495
421 2936380841 2936375103 Bacteria 6652732
422 2936383544 2936381700 Bacteria 7006523
423 2940557236 2940556831 Bacteria 9590747
424 2941539183 2941538514 Bacteria 9402094
425 3003933443 3003930520 Bacteria 5667563
426 3003933893 3003930520 Bacteria 5667563
427 3005456641 3005452660 Bacteria 5889319
428 8005291034 8005289223 Bacteria 6634003
429 8005379568 8005376324 Bacteria 6590079
430 8016522014 8016511872 Bacteria 9921665
431 8017063654 8017057580 Bacteria 10023680
432 8019582981 8019576017 Bacteria 10049540
433 8019590778 8019586578 Bacteria 10212056
434 8019600572 8019597564 Bacteria 10041141
435 8019617975 8019608314 Bacteria 10042931
436 8054304623 8054302542 Bacteria 5698134
437 8055746042 8055742211 Bacteria 9226248
438 Ga0439465_0022048
439 SwRhRL2b_contig_282692
440 JGI25158J39367_1000058
441 JGI25152J39213_1002178
442 JGI25150J39212_1000059
443 JGI25159J45721_1000684
444 JGI25151J46595_10043098
445 JGI25153J46596_10000080
446 JGI25153J46596_10002161
447 rootH1_10081177
448 rootH1_10190196
449 rootH2_10059461
450 rootH2_10080421
451 rootL2_10112127
452 rootL2_10116084
453 rootL2_10265445
454 rootL2_10270642
455 rootH1_10043892
456 rootH1_10227338
457 JGI25160J50197_1001646
458 JGI25161J50226_1000027
459 JGI25404J52841_10000234
460 JGI25404J52841_10001078
461 JGI25404J52841_10002115
462 JGI25404J52841_10005240
463 JGI25404J52841_10005851
464 JGI25404J52841_10010786
465 JGI25404J52841_10047597
466 Ga0055542_1005540
467 Ga0055542_1005862
468 Ga0055526_1000338
469 Ga0055537_1001246
470 Ga0055524_1001477
471 Ga0055524_1010890
472 Ga0055524_1011900
473 Ga0055536_1003109
474 Ga0055528_1000788
475 Ga0055530_10000355
476 Ga0055530_10009036
477 Ga0055530_10032445
478 Ga0055540_1000238
479 Ga0055531_10000462
480 Ga0055531_10001400
481 Ga0055531_10004115
482 Ga0065165_1002793
483 Ga0065704_10075366
484 Ga0070666_10270286
485 Ga0070668_100018326
486 Ga0070668_100026011
487 Ga0070669_100124674
488 Ga0070669_100132363
489 Ga0070671_100306912
490 Ga0070667_100002325
491 Ga0070667_100206308
492 Ga0070700_100325181
493 Ga0070708_100275584
494 Ga0070663_100191891
495 Ga0068867_100124316
496 Ga0070706_100077637
497 Ga0070698_100212720
498 Ga0070699_100027177
499 Ga0070699_100238642
500 Ga0070679_100061470
501 Ga0070697_100055505
502 Ga0070697_100076447
503 Ga0068853_100030626
504 Ga0068852_100140560
505 Ga0068859_100501296
506 Ga0068863_100001669
507 Ga0068863_100014024
508 Ga0068862_100087772
509 Ga0068862_100164654
510 Ga0081455_10010384
511 Ga0081455_10031989
512 Ga0081540_1000094
513 Ga0081540_1000180
514 Ga0081540_1000195
515 Ga0081540_1000653
516 Ga0081540_1001489
517 Ga0081540_1001970
518 Ga0081540_1004497
519 Ga0081540_1005512
520 Ga0081540_1005631
521 Ga0081540_1005691
522 Ga0081540_1006224
523 Ga0081540_1007206
524 Ga0081540_1007656
525 Ga0081540_1009969
526 Ga0081540_1010740
527 Ga0081540_1014560
528 Ga0081540_1015355
529 Ga0081540_1018055
530 Ga0081540_1018212
531 Ga0081540_1021783
532 Ga0081540_1038774
533 Ga0081540_1045498
534 Ga0081540_1051121
535 Ga0081540_1094221
536 Ga0081540_1098609
537 Ga0081540_1134718
538 Ga0070717_10270886
539 Ga0075365_10074464
540 Ga0075367_10108916
541 Ga0075369_10020456
542 Ga0075366_10031097
543 Ga0097620_100008745
544 Ga0097620_100501252
545 Ga0079104_1000010
546 Ga0105247_10131723
547 Ga0105248_10001374
548 Ga0105248_10043306
549 Ga0105248_10123881
550 Ga0105248_10878624
551 Ga0105237_10012252
552 Ga0105238_10001053
553 Ga0105238_10007525
554 Ga0105239_10009289
555 Ga0163162_10192913
556 Ga0157379_10446799
557 Ga0163161_10078407
558 Ga0213872_10002060
559 Ga0213872_10005918
560 Ga0213872_10021319
561 Ga0213876_10000089
562 Ga0213871_10062809
563 Ga0209436_100009
564 Ga0207425_1000019
565 Ga0209148_1000809
566 Ga0209148_1001896
567 Ga0209129_1001259
568 Ga0209129_1002116
569 Ga0209233_1003927
570 Ga0209233_1009883
571 Ga0209565_1000052
572 Ga0209455_1000809
573 Ga0209455_1001126
574 Ga0209673_1000054
575 Ga0209673_1001339
576 Ga0209673_1019098
577 Ga0209130_1000031
578 Ga0209130_1015791
579 Ga0209676_1000430
580 Ga0209676_1000878
581 Ga0209676_1008193
582 Ga0209025_1000268
583 Ga0209025_1007265
584 Ga0209564_1000750
585 Ga0209564_1000952
586 Ga0209758_1000019
587 Ga0209758_1002736
588 Ga0209758_1015224
589 Ga0209758_1020704
590 Ga0209758_1069209
591 Ga0209050_1000001
592 Ga0209050_1000166
593 Ga0209050_1001051
594 Ga0209050_1004528
595 Ga0209050_1027700
596 Ga0209256_1003106
597 Ga0209256_1003228
598 Ga0207426_1000042
599 Ga0207426_1001359
600 Ga0207426_1020686
601 Ga0209051_1000364
602 Ga0209051_1015260
603 Ga0209257_1000155
604 Ga0209257_1000535
605 Ga0209257_1000543
606 Ga0209257_1000850
607 Ga0207684_10476980
608 Ga0207671_10012450
609 Ga0207652_10045409
610 Ga0207646_10389839
611 Ga0207681_10151509
612 Ga0207694_10000011
613 Ga0207694_10247620
614 Ga0207711_10001991
615 Ga0207668_10003652
616 Ga0207658_10004748
617 Ga0207678_10009491
618 Ga0207641_10000645
619 Ga0207641_10017071
620 Ga0207675_100626985
621 Ga0209281_1000078
622 Ga0268266_10195575
623 Ga0268266_10306741
624 Ga0268266_10361689
625 Ga0268265_10052345
626 Ga0268265_10434466
627 Ga0268264_10373619
628 Ga0307406_10037031
629 Ga0436365_1738066
630 Ga0436360_0602373
631 Ga0436360_0682032
632 Ga0436360_1114013
633 Ga0436361_0242276
634 Ga0436361_0305675
635 Ga0436361_0354778
636 Ga0436361_0715355
637 Ga0436361_0967428
638 Ga0436361_1005487
639 Ga0439465_0000241
640 Ga0439465_0022183
641 Ga0439465_0030523
642 Ga0451802_0049085
643 Ga0451806_135301
644 Ga0451845_0561346
645 Ga0439431_0000436
646 Ga0439431_0006063
647 Ga0439445_0001063
648 Ga0439445_0020381
649 Ga0439449_0021656
650 Ga0450909_018686
651 Ga0439435_0043678
652 Ga0495627_000464
653 Ga0495638_0000629
654 Ga0495638_0049543
655 Ga0495638_0155358
656 Ga0495650_0000007
657 Ga0495582_0136848
658 Ga0495607_0004609
659 Ga0495607_0083294
660 Ga0495606_0028744
661 Ga0495606_0033000
662 Ga0495608_0119466
663 Ga0495610_0000063
664 Ga0495610_0019096
665 Ga0495610_0130189
666 Ga0495628_0241619
667 Ga0495643_0000007
668 Ga0495643_0022391
669 Ga0495625_0007872
670 Ga0495625_0049179
671 Ga0495625_0202090
672 Ga0495635_0043440
673 Ga0495613_0042716
674 Ga0495649_0017298
675 Ga0495649_0089263
676 Ga0495604_0027517
677 Ga0495673_0003692
678 Ga0495681_0066358
679 Ga0495626_0057016
680 Ga0496100_0288664
681 Ga0496102_0065310
682 Ga0496102_0672624
683 Ga0496104_0010168
684 Ga0496105_0008275
685 Ga0496106_0086418
686 Ga0496112_0652151
687 Ga0496113_0015219
688 Ga0496114_0097430
689 Ga0496116_0011360
690 Ga0496116_0020945
691 Ga0496116_0048244
692 Ga0496117_0013228
693 Ga0496117_0013854
694 Ga0496117_0016719
695 Ga0496117_0045968
696 Ga0496117_0143331
697 Ga0496118_0002332
698 Ga0496118_0018597
699 Ga0496118_0025470
700 Ga0496118_0041658
701 Ga0496118_0058363
702 Ga0496118_0126250
703 Ga0496121_0000125
704 Ga0496121_0003347
705 Ga0496121_0009953
706 Ga0496121_0011173
707 Ga0496121_0016701
708 Ga0496121_0039090
709 Ga0496121_0046837
710 Ga0496121_0049995
711 Ga0496121_0052359
712 Ga0496121_0099425
713 Ga0496121_0101890
714 Ga0496121_0177548
715 Ga0496121_0180094
716 Ga0496121_0333422
717 Ga0496122_0002563
718 Ga0496122_0009424
719 Ga0496122_0017180
720 Ga0496122_0097854
721 Ga0496123_0002105
722 Ga0496123_0016045
723 Ga0496123_0063907
724 Ga0496124_0000043
725 Ga0496124_0002530
726 Ga0496124_0011381
727 Ga0496124_0025089
728 Ga0496124_0041577
729 Ga0496124_0078998
730 Ga0496125_0000525
731 Ga0496125_0002260
732 Ga0496125_0012943
733 Ga0496125_0024876
734 Ga0496125_0038891
735 Ga0496125_0196494
736 Ga0496126_0002132
737 Ga0496126_0014610
738 Ga0496126_0031745
739 Ga0496126_0046296
740 Ga0496126_0061365
741 Ga0496126_0105441
742 Ga0496126_0328832
743 Ga0496126_0331366
744 Ga0495682_0074072
745 Ga0501073_0066162
746 Ga0501224_002613
747 Ga0501249_000045
748 Ga0501083_0058894
749 Ga0501044_0154623
750 Ga0501204_001436
751 nmdc:mga0yw44_15556_c1
752 nmdc:mga0yw44_2906_c1
753 nmdc:mga06z11_200430_c1
754 nmdc:mga0sz30_19085_c1
755 nmdc:mga0sz30_28594_c1
756 Ga0500578_0205530
757 Ga0500651_0034908
758 Ga0500555_000139
759 Ga0500569_001631
760 Ga0500572_008057
761 Ga0500595_001411
762 Ga0500608_000477
763 Ga0500618_000007
764 Ga0500618_008314
765 Ga0500642_0004845
766 Ga0500655_010873
767 Ga0500559_0006718
768 Ga0500559_0074678
769 Ga0500568_0000688
770 Ga0500568_0009561
771 Ga0500568_0016250
772 Ga0500568_0056901
773 Ga0500577_0000237
774 Ga0500604_0000039
775 Ga0500616_0002680
776 Ga0500622_0000117
777 Ga0500622_0003423
778 Ga0500622_0023190
779 Ga0500627_0000416
780 Ga0500627_0004113
781 Ga0500601_000630
782 Ga0500661_019957
783 Ga0501082_0304242
784 2511194072
785 2513571582
786 2517078271
787 2524465166
788 2585151465
789 2585195661
790 2585223362
791 2585546042
792 2585548925
793 2599720581
794 2644242057
795 2766064316
796 2776267325
797 2776281452
798 2778125764
799 2793082922
800 2821124085
801 2824661435
802 2828307829
803 2838690235
804 2838732010
805 2838738889
806 2838744906
807 2841842788
808 2841855963
809 2842116904
810 2842142568
811 2842161133
812 2842184749
813 2842232332
814 2842246747
815 2842261151
816 2842274255
817 2844457067
818 2857519523
819 2857531648
820 2879104540
821 2904690834
822 2909401639
823 2919101758
824 2919451308
825 2922374704
826 2929621792
827 2929629901
828 2932788645
829 2932817418
830 2932826187
831 2932830293
832 2933583932
833 2933593092
834 2935616584
835 2935642086
836 2935672530
837 2935676005
838 2935685996
839 2935697759
840 2935705837
841 2935714548
842 2935725167
843 2935732473
844 2935741852
845 2935751961
846 2935765218
847 2935802834
848 2935813334
849 2935830253
850 2935838150
851 2935855208
852 2935867529
853 2935875633
854 2935996316
855 2936003599
856 2936042283
857 2936372356
858 2936380841
859 2936383544
860 2940557236
861 2941539183
862 3003933443
863 3003933893
864 3005456641
865 8005291034
866 8005379568
867 8016522014
868 8017063654
869 8019582981
870 8019590778
871 8019600572
872 8019617975
873 8054304623
874 8055746042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

85

222

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pv2-assembly2.cif.gz_C native form 2 e.coli chaperone hsp31 0.8946 6 265
4i4n-assembly2.cif.gz_C crystal structure of the catalytic cys to ala mutant of vchsp31 from vibrio cholerae 0.8885 3 265
1pv2-assembly1.cif.gz_A native form 2 e.coli chaperone hsp31 0.8875 6 261
1pv2-assembly1.cif.gz_B native form 2 e.coli chaperone hsp31 0.8873 2 262
5k4a-assembly8.cif.gz_E structure of the amidase mutant e79a at 2.3 angstrom resolution 0.8862 3 265
ID Description Score Start End Superfamily
1pv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8875 6 261 3.40.50.880
1pv2E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8781 2 261 3.40.50.880
4hcjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8772 1 261 3.40.50.880
af_Q8NB37_11_215_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.876 6 257 3.40.50.880
af_Q8NB37_11_215_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8641 6 257 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A4R2XNF2-F1-model_v4 deleted 0.9978 1 263
AF-A0A529QVT0-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.997 1 223 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-A0A561GQM2-F1-model_v4 deleted 0.9952 1 260
AF-A0A529QVT0-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9926 1 223 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-A0A4R2XNF2-F1-model_v4 deleted 0.9903 1 263

Map