F444047

General Info

Members Datasets Scaffolds Average Seq Length
438 129 876 282

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0002719|Ga0495638_0002719_8861_9784
Length 307
Sequence LNDSGGGTLSGVAISPVRLIPYVIMQVFARIAAWSLACPLVLAAPAAGAGPHVYNFSPVNQYNLQVSASFWNPIIRYVSSRSGVTLNLKLGRTSADTTSFVLAREVDFAFTNHLFSPERSKMGWTVFGRRNAAPVRSQIVVPADSPVTRLSELAGGAVAFPGPEAMIAYKGPYAELLRSNIPVTVVFAGNMDAAFTQLFSGKVKAAGANSQLVLNYAGREGKKFRVLWSSAPFNDLALMASPRVPETDVRAVATAFLGMHQDPEGKKILAAVGALVHAPEAVSFVAASDADYASYRAFYAAAPASLR

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
9 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
10 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
12 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
13 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
25 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
28 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
29 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
30 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
31 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
32 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
33 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
34 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
35 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
36 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
39 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
40 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
43 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
44 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
45 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
46 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
47 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
48 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
49 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
50 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
51 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
52 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
53 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
54 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
55 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
56 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
57 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
58 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
59 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
60 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
63 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
64 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
67 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
68 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
73 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
74 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
75 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
76 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
84 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
87 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
93 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
105 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
106 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
107 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
111 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
123 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 2643221556 Massilia sp. Root1485 Isolate Unclassified
128 2643221684 Massilia sp. Root133 Isolate Unclassified
129 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 1.6
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0002719 3300046460 Bacteria 14222
2 rootL2_10058879 3300003322 Bacteria 3647
3 rootL2_10093935 3300003322 Bacteria 3351
4 Ga0065165_1009078 3300005262 Bacteria 4522
5 Ga0065165_1017543 3300005262 Bacteria 2632
6 Ga0070661_100153173 3300005344 Bacteria 1744
7 Ga0070659_100043881 3300005366 Bacteria 3498
8 Ga0070662_100026816 3300005457 Bacteria 3994
9 Ga0068855_100046613 3300005563 Bacteria 5123
10 Ga0070664_100076932 3300005564 Bacteria 2868
11 Ga0068865_100033243 3300006881 Bacteria 3452
12 Ga0111539_10286829 3300009094 Bacteria 1916
13 Ga0105241_10179389 3300009174 Bacteria 1755
14 Ga0105242_10088469 3300009176 Bacteria 2602
15 Ga0105238_10363141 3300009551 Bacteria 1438
16 Ga0105239_10700023 3300010375 Bacteria 1158
17 Ga0157371_10000161 3300013102 Bacteria 98412
18 Ga0182008_10026654 3300014497 Bacteria 2930
19 Ga0207705_10000483 3300025909 Bacteria 34144
20 Ga0207657_10023430 3300025919 Bacteria 5748
21 Ga0207694_10451500 3300025924 Bacteria 1073
22 Ga0207690_10206086 3300025932 Bacteria 1496
23 Ga0207706_10034950 3300025933 Bacteria 4471
24 Ga0207679_10059481 3300025945 Bacteria 2835
25 Ga0207667_10023371 3300025949 Bacteria 6806
26 Ga0395899_0026198 3300037312 Bacteria 4400
27 Ga0395899_0058047 3300037312 Bacteria 2855
28 Ga0395900_0000402 3300037418 Bacteria 62208
29 Ga0395900_0002186 3300037418 Bacteria 21856
30 Ga0395900_0047927 3300037418 Bacteria 4401
31 Ga0395898_0057867 3300037466 Bacteria 3775
32 Ga0395898_0061019 3300037466 Bacteria 3663
33 Ga0395898_0625576 3300037466 Bacteria 1019
34 Ga0395905_0005709 3300037471 Bacteria 12646
35 Ga0395905_0072238 3300037471 Bacteria 3235
36 Ga0395905_0093215 3300037471 Bacteria 2824
37 Ga0395905_0101405 3300037471 Bacteria 2702
38 Ga0395905_0352263 3300037471 Bacteria 1364
39 Ga0395901_0000250 3300038443 Bacteria 66983
40 Ga0395901_0039896 3300038443 Bacteria 4860
41 Ga0395901_0137242 3300038443 Bacteria 2570
42 Ga0395901_0423980 3300038443 Bacteria 1364
43 Ga0450911_004560 3300042115 Bacteria 2257
44 Ga0450904_000376 3300042139 Bacteria 9296
45 Ga0466965_0006397 3300044683 Bacteria 5346
46 Ga0466965_0022012 3300044683 Bacteria 3071
47 Ga0466966_0004419 3300044684 Bacteria 9274
48 Ga0466966_0014193 3300044684 Bacteria 5274
49 Ga0466966_0033452 3300044684 Bacteria 3329
50 Ga0466966_0084115 3300044684 Bacteria 1979
51 Ga0466964_0001065 3300044706 Bacteria 9166
52 Ga0466964_0033744 3300044706 Bacteria 2040
53 Ga0453684_0441020 3300044712 Bacteria 1451
54 Ga0466971_0088143 3300044719 Bacteria 1419
55 Ga0466968_0004692 3300044735 Bacteria 5121
56 Ga0466970_0065539 3300044765 Bacteria 1949
57 Ga0466957_0000773 3300044842 Bacteria 16336
58 Ga0466957_0172973 3300044842 Bacteria 1407
59 Ga0466959_0006739 3300045049 Bacteria 7995
60 Ga0466959_0118365 3300045049 Bacteria 1885
61 Ga0466958_0050635 3300045836 Bacteria 2514
62 Ga0466967_0005962 3300045976 Bacteria 8552
63 Ga0466967_0356127 3300045976 Bacteria 1417
64 Ga0495617_000001 3300046452 Bacteria 877032
65 Ga0495617_000949 3300046452 Bacteria 13451
66 Ga0495627_000300 3300046453 Bacteria 48824
67 Ga0495627_003017 3300046453 Bacteria 7693
68 Ga0495627_007222 3300046453 Bacteria 4283
69 Ga0495603_0067956 3300046455 Bacteria 2096
70 Ga0495590_0000077 3300046457 Bacteria 64092
71 Ga0495590_0000434 3300046457 Bacteria 20832
72 Ga0495590_0053736 3300046457 Bacteria 1407
73 Ga0495591_000337 3300046458 Bacteria 42029
74 Ga0495591_008141 3300046458 Bacteria 4328
75 Ga0495638_0028837 3300046460 Bacteria 3582
76 Ga0495653_0006445 3300046463 Bacteria 9623
77 Ga0495653_0049723 3300046463 Bacteria 3228
78 Ga0495650_0000631 3300046471 Bacteria 47329
79 Ga0495650_0022498 3300046471 Bacteria 3022
80 Ga0495582_0010590 3300046473 Bacteria 5072
81 Ga0495605_0000325 3300046474 Bacteria 48544
82 Ga0495605_0000327 3300046474 Bacteria 48114
83 Ga0495605_0003339 3300046474 Bacteria 9598
84 Ga0495605_0006452 3300046474 Bacteria 6740
85 Ga0495605_0008759 3300046474 Bacteria 5709
86 Ga0495605_0010214 3300046474 Bacteria 5257
87 Ga0495605_0012572 3300046474 Bacteria 4689
88 Ga0495605_0014602 3300046474 Bacteria 4295
89 Ga0495605_0015379 3300046474 Bacteria 4166
90 Ga0495605_0022405 3300046474 Bacteria 3336
91 Ga0495605_0042053 3300046474 Bacteria 2273
92 Ga0495605_0079252 3300046474 Bacteria 1538
93 Ga0495605_0090149 3300046474 Bacteria 1422
94 Ga0495584_0000193 3300046491 Bacteria 43275
95 Ga0495584_0000302 3300046491 Bacteria 34849
96 Ga0495584_0000522 3300046491 Bacteria 26217
97 Ga0495584_0001527 3300046491 Bacteria 13763
98 Ga0495584_0004165 3300046491 Bacteria 7805
99 Ga0495584_0004542 3300046491 Bacteria 7449
100 Ga0495584_0010780 3300046491 Bacteria 4692
101 Ga0495584_0016210 3300046491 Bacteria 3800
102 Ga0495584_0044065 3300046491 Bacteria 2251
103 Ga0495584_0049937 3300046491 Bacteria 2107
104 Ga0495584_0091115 3300046491 Bacteria 1537
105 Ga0495584_0156543 3300046491 Bacteria 1158
106 Ga0495585_0000206 3300046492 Bacteria 61632
107 Ga0495585_0000295 3300046492 Bacteria 50228
108 Ga0495585_0000353 3300046492 Bacteria 44438
109 Ga0495585_0000406 3300046492 Bacteria 41715
110 Ga0495585_0001691 3300046492 Bacteria 16855
111 Ga0495585_0002622 3300046492 Bacteria 12676
112 Ga0495585_0003619 3300046492 Bacteria 10353
113 Ga0495585_0011994 3300046492 Bacteria 5116
114 Ga0495585_0015173 3300046492 Bacteria 4477
115 Ga0495585_0037052 3300046492 Bacteria 2747
116 Ga0495585_0044418 3300046492 Bacteria 2482
117 Ga0495585_0049410 3300046492 Bacteria 2335
118 Ga0495585_0079659 3300046492 Bacteria 1776
119 Ga0495585_0207373 3300046492 Bacteria 995
120 Ga0495594_0004378 3300046499 Bacteria 7265
121 Ga0495594_0014682 3300046499 Bacteria 4108
122 Ga0495596_0000559 3300046500 Bacteria 23256
123 Ga0495596_0002706 3300046500 Bacteria 9326
124 Ga0495596_0003677 3300046500 Bacteria 7675
125 Ga0495596_0005002 3300046500 Bacteria 6344
126 Ga0495596_0006531 3300046500 Bacteria 5355
127 Ga0495596_0010362 3300046500 Bacteria 4061
128 Ga0495596_0015621 3300046500 Bacteria 3173
129 Ga0495596_0084573 3300046500 Bacteria 1231
130 Ga0495596_0091114 3300046500 Bacteria 1183
131 Ga0495596_0101952 3300046500 Bacteria 1114
132 Ga0495596_0146121 3300046500 Bacteria 918
133 Ga0495607_0001519 3300046501 Bacteria 20422
134 Ga0495607_0007532 3300046501 Bacteria 7517
135 Ga0495607_0007677 3300046501 Bacteria 7433
136 Ga0495607_0010136 3300046501 Bacteria 6341
137 Ga0495607_0038336 3300046501 Bacteria 2871
138 Ga0495607_0059519 3300046501 Bacteria 2178
139 Ga0495607_0060250 3300046501 Bacteria 2161
140 Ga0495607_0142660 3300046501 Bacteria 1234
141 Ga0495583_0000424 3300046506 Bacteria 63938
142 Ga0495583_0000811 3300046506 Bacteria 38463
143 Ga0495583_0000822 3300046506 Bacteria 38020
144 Ga0495583_0001194 3300046506 Bacteria 27898
145 Ga0495583_0003613 3300046506 Bacteria 11586
146 Ga0495583_0008778 3300046506 Bacteria 6129
147 Ga0495583_0022697 3300046506 Bacteria 3194
148 Ga0495606_0008865 3300046507 Bacteria 8621
149 Ga0495606_0015318 3300046507 Bacteria 5915
150 Ga0495606_0016140 3300046507 Bacteria 5713
151 Ga0495606_0041673 3300046507 Bacteria 3078
152 Ga0495606_0046674 3300046507 Bacteria 2862
153 Ga0495606_0093197 3300046507 Bacteria 1848
154 Ga0495606_0172581 3300046507 Bacteria 1253
155 Ga0495610_0002400 3300046512 Bacteria 15768
156 Ga0495610_0120890 3300046512 Bacteria 1148
157 Ga0495616_0000316 3300046513 Bacteria 38626
158 Ga0495616_0000328 3300046513 Bacteria 37754
159 Ga0495616_0000829 3300046513 Bacteria 22549
160 Ga0495616_0002271 3300046513 Bacteria 12852
161 Ga0495616_0003684 3300046513 Bacteria 9785
162 Ga0495616_0012034 3300046513 Bacteria 4926
163 Ga0495616_0025862 3300046513 Bacteria 3130
164 Ga0495616_0026301 3300046513 Bacteria 3099
165 Ga0495616_0026574 3300046513 Bacteria 3079
166 Ga0495616_0026620 3300046513 Bacteria 3075
167 Ga0495616_0028744 3300046513 Bacteria 2940
168 Ga0495616_0044253 3300046513 Bacteria 2258
169 Ga0495616_0067728 3300046513 Bacteria 1734
170 Ga0495620_0002276 3300046515 Bacteria 11106
171 Ga0495630_0074613 3300046517 Bacteria 2555
172 Ga0495631_0000731 3300046518 Bacteria 21106
173 Ga0495631_0001983 3300046518 Bacteria 11970
174 Ga0495631_0003147 3300046518 Bacteria 9082
175 Ga0495631_0004850 3300046518 Bacteria 7087
176 Ga0495631_0005634 3300046518 Bacteria 6536
177 Ga0495631_0010708 3300046518 Bacteria 4533
178 Ga0495631_0012103 3300046518 Bacteria 4225
179 Ga0495631_0039111 3300046518 Bacteria 2106
180 Ga0495631_0058359 3300046518 Bacteria 1678
181 Ga0495631_0066189 3300046518 Bacteria 1563
182 Ga0495631_0067909 3300046518 Bacteria 1542
183 Ga0495631_0082970 3300046518 Bacteria 1381
184 Ga0495631_0109534 3300046518 Bacteria 1187
185 Ga0495631_0160214 3300046518 Bacteria 965
186 Ga0495632_0000251 3300046519 Bacteria 53273
187 Ga0495632_0000725 3300046519 Bacteria 29897
188 Ga0495632_0000775 3300046519 Bacteria 28660
189 Ga0495632_0001334 3300046519 Bacteria 20731
190 Ga0495632_0014470 3300046519 Bacteria 4461
191 Ga0495632_0024445 3300046519 Bacteria 3208
192 Ga0495632_0026285 3300046519 Bacteria 3066
193 Ga0495637_0000008 3300046520 Bacteria 404658
194 Ga0495637_0009544 3300046520 Bacteria 4730
195 Ga0495643_0001136 3300046522 Bacteria 26142
196 Ga0495643_0001278 3300046522 Bacteria 24108
197 Ga0495643_0002779 3300046522 Bacteria 13378
198 Ga0495643_0008425 3300046522 Bacteria 6526
199 Ga0495643_0012310 3300046522 Bacteria 5166
200 Ga0495643_0023925 3300046522 Bacteria 3467
201 Ga0495643_0054216 3300046522 Bacteria 2147
202 Ga0495643_0075166 3300046522 Bacteria 1768
203 Ga0495644_0006520 3300046523 Bacteria 4518
204 Ga0495644_0007516 3300046523 Bacteria 4200
205 Ga0495644_0012564 3300046523 Bacteria 3255
206 Ga0495644_0014322 3300046523 Bacteria 3039
207 Ga0495644_0023314 3300046523 Bacteria 2356
208 Ga0495644_0032965 3300046523 Bacteria 1957
209 Ga0495644_0034822 3300046523 Bacteria 1901
210 Ga0495644_0062796 3300046523 Bacteria 1396
211 Ga0495648_0000057 3300046524 Bacteria 157446
212 Ga0495648_0004310 3300046524 Bacteria 12192
213 Ga0495648_0012645 3300046524 Bacteria 6277
214 Ga0495648_0017659 3300046524 Bacteria 5089
215 Ga0495648_0027980 3300046524 Bacteria 3764
216 Ga0495648_0045918 3300046524 Bacteria 2713
217 Ga0495663_0007519 3300046525 Bacteria 3014
218 Ga0495666_0008504 3300046526 Bacteria 5146
219 Ga0495666_0020598 3300046526 Bacteria 3266
220 Ga0495642_0000090 3300046528 Bacteria 53472
221 Ga0495642_0000821 3300046528 Bacteria 14952
222 Ga0495642_0002559 3300046528 Bacteria 7350
223 Ga0495642_0009450 3300046528 Bacteria 3733
224 Ga0495642_0023857 3300046528 Bacteria 2417
225 Ga0495642_0034747 3300046528 Bacteria 2031
226 Ga0495642_0035805 3300046528 Bacteria 2004
227 Ga0495642_0038517 3300046528 Bacteria 1937
228 Ga0495642_0075683 3300046528 Bacteria 1412
229 Ga0495642_0102614 3300046528 Bacteria 1218
230 Ga0495652_0007238 3300046529 Bacteria 10243
231 Ga0495654_0006534 3300046530 Bacteria 6610
232 Ga0495654_0030937 3300046530 Bacteria 2719
233 Ga0495665_0002584 3300046531 Bacteria 9780
234 Ga0495587_0031504 3300046536 Bacteria 3210
235 Ga0495587_0058115 3300046536 Bacteria 2272
236 Ga0495587_0069673 3300046536 Bacteria 2048
237 Ga0495609_0000039 3300046538 Bacteria 179384
238 Ga0495609_0000730 3300046538 Bacteria 24990
239 Ga0495609_0002533 3300046538 Bacteria 11205
240 Ga0495609_0007915 3300046538 Bacteria 5253
241 Ga0495609_0012953 3300046538 Bacteria 3945
242 Ga0495609_0018237 3300046538 Bacteria 3252
243 Ga0495609_0023195 3300046538 Bacteria 2853
244 Ga0495609_0023807 3300046538 Bacteria 2811
245 Ga0495609_0055880 3300046538 Bacteria 1750
246 Ga0495609_0094582 3300046538 Bacteria 1297
247 Ga0495597_0000538 3300046542 Bacteria 31407
248 Ga0495597_0000576 3300046542 Bacteria 30449
249 Ga0495597_0001241 3300046542 Bacteria 18938
250 Ga0495597_0007734 3300046542 Bacteria 5434
251 Ga0495597_0034636 3300046542 Bacteria 2281
252 Ga0495597_0053152 3300046542 Bacteria 1782
253 Ga0495633_0002145 3300046558 Bacteria 14138
254 Ga0495633_0003206 3300046558 Bacteria 11046
255 Ga0495633_0003467 3300046558 Bacteria 10489
256 Ga0495633_0011347 3300046558 Bacteria 4809
257 Ga0495633_0015008 3300046558 Bacteria 4027
258 Ga0495656_0000498 3300046615 Bacteria 12853
259 Ga0495656_0016708 3300046615 Bacteria 2788
260 Ga0495656_0195535 3300046615 Bacteria 1001
261 Ga0495668_0001213 3300046616 Bacteria 26083
262 Ga0495668_0001527 3300046616 Bacteria 21976
263 Ga0495668_0003633 3300046616 Bacteria 11422
264 Ga0495668_0004135 3300046616 Bacteria 10492
265 Ga0495668_0005536 3300046616 Bacteria 8512
266 Ga0495668_0010810 3300046616 Bacteria 5504
267 Ga0495668_0018786 3300046616 Bacteria 3994
268 Ga0495668_0018943 3300046616 Bacteria 3975
269 Ga0495668_0057480 3300046616 Bacteria 2146
270 Ga0495668_0063778 3300046616 Bacteria 2029
271 Ga0495634_0003307 3300046642 Bacteria 12987
272 Ga0495611_0000305 3300046648 Bacteria 33302
273 Ga0495611_0005398 3300046648 Bacteria 5469
274 Ga0495611_0008239 3300046648 Bacteria 4423
275 Ga0495611_0030123 3300046648 Bacteria 2384
276 Ga0495611_0030210 3300046648 Bacteria 2381
277 Ga0495611_0071999 3300046648 Bacteria 1581
278 Ga0495611_0074527 3300046648 Bacteria 1554
279 Ga0495611_0206765 3300046648 Bacteria 914
280 Ga0495625_0019763 3300046660 Bacteria 5215
281 Ga0495659_0034161 3300046664 Bacteria 1788
282 Ga0495661_0000648 3300046665 Bacteria 35214
283 Ga0495661_0000903 3300046665 Bacteria 27258
284 Ga0495661_0001789 3300046665 Bacteria 17289
285 Ga0495661_0004824 3300046665 Bacteria 9669
286 Ga0495661_0008338 3300046665 Bacteria 7174
287 Ga0495661_0011464 3300046665 Bacteria 6015
288 Ga0495661_0017746 3300046665 Bacteria 4691
289 Ga0495661_0025093 3300046665 Bacteria 3854
290 Ga0495661_0035073 3300046665 Bacteria 3152
291 Ga0495661_0043193 3300046665 Bacteria 2772
292 Ga0495661_0054234 3300046665 Bacteria 2407
293 Ga0495661_0064461 3300046665 Bacteria 2161
294 Ga0495661_0082532 3300046665 Bacteria 1849
295 Ga0495661_0113787 3300046665 Bacteria 1504
296 Ga0495588_0000110 3300046674 Bacteria 142825
297 Ga0495588_0004003 3300046674 Bacteria 6479
298 Ga0495588_0007609 3300046674 Bacteria 4942
299 Ga0495588_0012809 3300046674 Bacteria 3976
300 Ga0495588_0021938 3300046674 Bacteria 3151
301 Ga0495588_0029037 3300046674 Bacteria 2772
302 Ga0495623_0001157 3300046679 Bacteria 17860
303 Ga0495669_0000062 3300046684 Bacteria 70803
304 Ga0495669_0000842 3300046684 Bacteria 13047
305 Ga0495669_0010754 3300046684 Bacteria 3873
306 Ga0495669_0026949 3300046684 Bacteria 2512
307 Ga0495613_0057742 3300046689 Bacteria 2849
308 Ga0495670_0000209 3300046691 Bacteria 26603
309 Ga0495670_0000641 3300046691 Bacteria 16688
310 Ga0495670_0004003 3300046691 Bacteria 7229
311 Ga0495670_0010048 3300046691 Bacteria 4654
312 Ga0495670_0013740 3300046691 Bacteria 3981
313 Ga0495670_0041095 3300046691 Bacteria 2306
314 Ga0495670_0078423 3300046691 Bacteria 1680
315 Ga0495671_0000838 3300046692 Bacteria 21987
316 Ga0495671_0001624 3300046692 Bacteria 14758
317 Ga0495671_0009754 3300046692 Bacteria 5349
318 Ga0495671_0017451 3300046692 Bacteria 3821
319 Ga0495649_0000468 3300046694 Bacteria 34749
320 Ga0495649_0002618 3300046694 Bacteria 12565
321 Ga0495649_0005114 3300046694 Bacteria 8419
322 Ga0495649_0016772 3300046694 Bacteria 4147
323 Ga0495649_0024695 3300046694 Bacteria 3351
324 Ga0495649_0039708 3300046694 Bacteria 2580
325 Ga0495649_0090911 3300046694 Bacteria 1627
326 Ga0495649_0101006 3300046694 Bacteria 1533
327 Ga0495649_0162286 3300046694 Bacteria 1171
328 Ga0495589_0000019 3300046794 Bacteria 200814
329 Ga0495589_0000830 3300046794 Bacteria 19410
330 Ga0495589_0007994 3300046794 Bacteria 5533
331 Ga0495589_0031976 3300046794 Bacteria 2647
332 Ga0495589_0037800 3300046794 Bacteria 2417
333 Ga0495589_0049224 3300046794 Bacteria 2085
334 Ga0495589_0076829 3300046794 Bacteria 1627
335 Ga0495589_0084485 3300046794 Bacteria 1543
336 Ga0495660_0000572 3300046810 Bacteria 29701
337 Ga0495660_0007036 3300046810 Bacteria 6631
338 Ga0495660_0022940 3300046810 Bacteria 3561
339 Ga0495660_0030033 3300046810 Bacteria 3063
340 Ga0495660_0030280 3300046810 Bacteria 3049
341 Ga0495660_0045527 3300046810 Bacteria 2408
342 Ga0495581_0044020 3300047315 Bacteria 2581
343 Ga0495604_0001465 3300047317 Bacteria 19420
344 Ga0495636_0059003 3300047318 Bacteria 1619
345 Ga0495672_0000296 3300047320 Bacteria 68060
346 Ga0495672_0002576 3300047320 Bacteria 16479
347 Ga0495672_0003288 3300047320 Bacteria 13982
348 Ga0495672_0009828 3300047320 Bacteria 6882
349 Ga0495672_0017354 3300047320 Bacteria 4816
350 Ga0495676_0000114 3300047321 Bacteria 61730
351 Ga0495680_0054242 3300047322 Bacteria 3114
352 Ga0495683_0000151 3300047323 Bacteria 68310
353 Ga0495683_0000504 3300047323 Bacteria 30152
354 Ga0495683_0005231 3300047323 Bacteria 7216
355 Ga0495683_0008159 3300047323 Bacteria 5618
356 Ga0495683_0008317 3300047323 Bacteria 5559
357 Ga0495683_0030875 3300047323 Bacteria 2731
358 Ga0495683_0035480 3300047323 Bacteria 2535
359 Ga0495683_0077251 3300047323 Bacteria 1628
360 Ga0495683_0118415 3300047323 Bacteria 1259
361 Ga0495683_0165197 3300047323 Bacteria 1021
362 Ga0495687_000059 3300047443 Bacteria 179357
363 Ga0495687_000865 3300047443 Bacteria 32056
364 Ga0495687_001067 3300047443 Bacteria 27066
365 Ga0495687_001227 3300047443 Bacteria 24504
366 Ga0495687_099625 3300047443 Bacteria 1093
367 Ga0495675_0062861 3300047444 Bacteria 2350
368 Ga0495677_0000006 3300047445 Bacteria 199230
369 Ga0495677_0000225 3300047445 Bacteria 25941
370 Ga0495677_0000258 3300047445 Bacteria 23316
371 Ga0495677_0000347 3300047445 Bacteria 19957
372 Ga0495677_0002789 3300047445 Bacteria 6817
373 Ga0495677_0005419 3300047445 Bacteria 4836
374 Ga0495677_0006128 3300047445 Bacteria 4551
375 Ga0495677_0011857 3300047445 Bacteria 3183
376 Ga0495677_0071918 3300047445 Bacteria 1289
377 Ga0495679_004091 3300047446 Bacteria 6823
378 Ga0495679_009107 3300047446 Bacteria 3997
379 Ga0495685_002981 3300047447 Bacteria 5362
380 Ga0495685_031922 3300047447 Bacteria 1810
381 Ga0495685_034610 3300047447 Bacteria 1735
382 Ga0495673_0009308 3300047469 Bacteria 5443
383 Ga0495681_0000530 3300047470 Bacteria 29191
384 Ga0495681_0000549 3300047470 Bacteria 28708
385 Ga0495681_0001252 3300047470 Bacteria 19277
386 Ga0495681_0003961 3300047470 Bacteria 10207
387 Ga0495681_0007293 3300047470 Bacteria 7091
388 Ga0495681_0016590 3300047470 Bacteria 4119
389 Ga0495681_0021260 3300047470 Bacteria 3500
390 Ga0495681_0046634 3300047470 Bacteria 2065
391 Ga0495681_0072897 3300047470 Bacteria 1551
392 Ga0495681_0122881 3300047470 Bacteria 1112
393 Ga0495686_0000318 3300047472 Bacteria 80125
394 Ga0495686_0000797 3300047472 Bacteria 40927
395 Ga0495686_0022454 3300047472 Bacteria 4177
396 Ga0495686_0185534 3300047472 Bacteria 1202
397 Ga0495593_0100460 3300047673 Bacteria 1484
398 Ga0495614_0000548 3300048089 Bacteria 15547
399 Ga0495626_0000038 3300048091 Bacteria 175936
400 Ga0495626_0000103 3300048091 Bacteria 110163
401 Ga0495626_0000902 3300048091 Bacteria 26250
402 Ga0495626_0001125 3300048091 Bacteria 22406
403 Ga0495626_0003741 3300048091 Bacteria 9601
404 Ga0495626_0004094 3300048091 Bacteria 9062
405 Ga0495626_0005354 3300048091 Bacteria 7542
406 Ga0495626_0023970 3300048091 Bacteria 2996
407 Ga0495626_0025467 3300048091 Bacteria 2893
408 Ga0495626_0031958 3300048091 Bacteria 2530
409 Ga0495626_0052514 3300048091 Bacteria 1878
410 Ga0495626_0060019 3300048091 Bacteria 1734
411 Ga0495626_0061607 3300048091 Bacteria 1705
412 Ga0496101_0006523 3300048904 Bacteria 7514
413 Ga0496102_0001473 3300048905 Bacteria 20774
414 Ga0496102_0392196 3300048905 Bacteria 1306
415 Ga0496108_0214384 3300048911 Bacteria 1672
416 Ga0496109_0082654 3300048912 Bacteria 2960
417 Ga0496109_0214774 3300048912 Bacteria 1809
418 Ga0496113_0179143 3300048916 Bacteria 1680
419 Ga0496121_0070823 3300048924 Bacteria 2807
420 Ga0496122_0000727 3300048925 Bacteria 64439
421 Ga0496122_0008695 3300048925 Bacteria 10876
422 Ga0496123_0000791 3300048926 Bacteria 51059
423 Ga0496123_0004450 3300048926 Bacteria 14723
424 Ga0496124_0075786 3300048927 Bacteria 2778
425 Ga0496124_0224887 3300048927 Bacteria 1408
426 Ga0496125_0003361 3300048928 Bacteria 19485
427 Ga0495678_000157 3300049459 Bacteria 81092
428 Ga0495678_000391 3300049459 Bacteria 44274
429 Ga0495678_000743 3300049459 Bacteria 29597
430 Ga0495682_0000342 3300049460 Bacteria 34442
431 Ga0495682_0002914 3300049460 Bacteria 7848
432 Ga0495682_0018172 3300049460 Bacteria 2649
433 Ga0501034_0098596 3300049571 Bacteria 2918
434 Ga0501035_0052658 3300049822 Bacteria 3642
435 Ga0466962_0139491 3300061719 Bacteria 1174
436 2643799857 2643221556 Bacteria 7251154
437 2644474857 2643221684 Bacteria 7145183
438 2809146802 2808606418 Bacteria 6724496
439 Ga0495638_0002719
440 rootL2_10058879
441 rootL2_10093935
442 Ga0065165_1009078
443 Ga0065165_1017543
444 Ga0070661_100153173
445 Ga0070659_100043881
446 Ga0070662_100026816
447 Ga0068855_100046613
448 Ga0070664_100076932
449 Ga0068865_100033243
450 Ga0111539_10286829
451 Ga0105241_10179389
452 Ga0105242_10088469
453 Ga0105238_10363141
454 Ga0105239_10700023
455 Ga0157371_10000161
456 Ga0182008_10026654
457 Ga0207705_10000483
458 Ga0207657_10023430
459 Ga0207694_10451500
460 Ga0207690_10206086
461 Ga0207706_10034950
462 Ga0207679_10059481
463 Ga0207667_10023371
464 Ga0395899_0026198
465 Ga0395899_0058047
466 Ga0395900_0000402
467 Ga0395900_0002186
468 Ga0395900_0047927
469 Ga0395898_0057867
470 Ga0395898_0061019
471 Ga0395898_0625576
472 Ga0395905_0005709
473 Ga0395905_0072238
474 Ga0395905_0093215
475 Ga0395905_0101405
476 Ga0395905_0352263
477 Ga0395901_0000250
478 Ga0395901_0039896
479 Ga0395901_0137242
480 Ga0395901_0423980
481 Ga0450911_004560
482 Ga0450904_000376
483 Ga0466965_0006397
484 Ga0466965_0022012
485 Ga0466966_0004419
486 Ga0466966_0014193
487 Ga0466966_0033452
488 Ga0466966_0084115
489 Ga0466964_0001065
490 Ga0466964_0033744
491 Ga0453684_0441020
492 Ga0466971_0088143
493 Ga0466968_0004692
494 Ga0466970_0065539
495 Ga0466957_0000773
496 Ga0466957_0172973
497 Ga0466959_0006739
498 Ga0466959_0118365
499 Ga0466958_0050635
500 Ga0466967_0005962
501 Ga0466967_0356127
502 Ga0495617_000001
503 Ga0495617_000949
504 Ga0495627_000300
505 Ga0495627_003017
506 Ga0495627_007222
507 Ga0495603_0067956
508 Ga0495590_0000077
509 Ga0495590_0000434
510 Ga0495590_0053736
511 Ga0495591_000337
512 Ga0495591_008141
513 Ga0495638_0028837
514 Ga0495653_0006445
515 Ga0495653_0049723
516 Ga0495650_0000631
517 Ga0495650_0022498
518 Ga0495582_0010590
519 Ga0495605_0000325
520 Ga0495605_0000327
521 Ga0495605_0003339
522 Ga0495605_0006452
523 Ga0495605_0008759
524 Ga0495605_0010214
525 Ga0495605_0012572
526 Ga0495605_0014602
527 Ga0495605_0015379
528 Ga0495605_0022405
529 Ga0495605_0042053
530 Ga0495605_0079252
531 Ga0495605_0090149
532 Ga0495584_0000193
533 Ga0495584_0000302
534 Ga0495584_0000522
535 Ga0495584_0001527
536 Ga0495584_0004165
537 Ga0495584_0004542
538 Ga0495584_0010780
539 Ga0495584_0016210
540 Ga0495584_0044065
541 Ga0495584_0049937
542 Ga0495584_0091115
543 Ga0495584_0156543
544 Ga0495585_0000206
545 Ga0495585_0000295
546 Ga0495585_0000353
547 Ga0495585_0000406
548 Ga0495585_0001691
549 Ga0495585_0002622
550 Ga0495585_0003619
551 Ga0495585_0011994
552 Ga0495585_0015173
553 Ga0495585_0037052
554 Ga0495585_0044418
555 Ga0495585_0049410
556 Ga0495585_0079659
557 Ga0495585_0207373
558 Ga0495594_0004378
559 Ga0495594_0014682
560 Ga0495596_0000559
561 Ga0495596_0002706
562 Ga0495596_0003677
563 Ga0495596_0005002
564 Ga0495596_0006531
565 Ga0495596_0010362
566 Ga0495596_0015621
567 Ga0495596_0084573
568 Ga0495596_0091114
569 Ga0495596_0101952
570 Ga0495596_0146121
571 Ga0495607_0001519
572 Ga0495607_0007532
573 Ga0495607_0007677
574 Ga0495607_0010136
575 Ga0495607_0038336
576 Ga0495607_0059519
577 Ga0495607_0060250
578 Ga0495607_0142660
579 Ga0495583_0000424
580 Ga0495583_0000811
581 Ga0495583_0000822
582 Ga0495583_0001194
583 Ga0495583_0003613
584 Ga0495583_0008778
585 Ga0495583_0022697
586 Ga0495606_0008865
587 Ga0495606_0015318
588 Ga0495606_0016140
589 Ga0495606_0041673
590 Ga0495606_0046674
591 Ga0495606_0093197
592 Ga0495606_0172581
593 Ga0495610_0002400
594 Ga0495610_0120890
595 Ga0495616_0000316
596 Ga0495616_0000328
597 Ga0495616_0000829
598 Ga0495616_0002271
599 Ga0495616_0003684
600 Ga0495616_0012034
601 Ga0495616_0025862
602 Ga0495616_0026301
603 Ga0495616_0026574
604 Ga0495616_0026620
605 Ga0495616_0028744
606 Ga0495616_0044253
607 Ga0495616_0067728
608 Ga0495620_0002276
609 Ga0495630_0074613
610 Ga0495631_0000731
611 Ga0495631_0001983
612 Ga0495631_0003147
613 Ga0495631_0004850
614 Ga0495631_0005634
615 Ga0495631_0010708
616 Ga0495631_0012103
617 Ga0495631_0039111
618 Ga0495631_0058359
619 Ga0495631_0066189
620 Ga0495631_0067909
621 Ga0495631_0082970
622 Ga0495631_0109534
623 Ga0495631_0160214
624 Ga0495632_0000251
625 Ga0495632_0000725
626 Ga0495632_0000775
627 Ga0495632_0001334
628 Ga0495632_0014470
629 Ga0495632_0024445
630 Ga0495632_0026285
631 Ga0495637_0000008
632 Ga0495637_0009544
633 Ga0495643_0001136
634 Ga0495643_0001278
635 Ga0495643_0002779
636 Ga0495643_0008425
637 Ga0495643_0012310
638 Ga0495643_0023925
639 Ga0495643_0054216
640 Ga0495643_0075166
641 Ga0495644_0006520
642 Ga0495644_0007516
643 Ga0495644_0012564
644 Ga0495644_0014322
645 Ga0495644_0023314
646 Ga0495644_0032965
647 Ga0495644_0034822
648 Ga0495644_0062796
649 Ga0495648_0000057
650 Ga0495648_0004310
651 Ga0495648_0012645
652 Ga0495648_0017659
653 Ga0495648_0027980
654 Ga0495648_0045918
655 Ga0495663_0007519
656 Ga0495666_0008504
657 Ga0495666_0020598
658 Ga0495642_0000090
659 Ga0495642_0000821
660 Ga0495642_0002559
661 Ga0495642_0009450
662 Ga0495642_0023857
663 Ga0495642_0034747
664 Ga0495642_0035805
665 Ga0495642_0038517
666 Ga0495642_0075683
667 Ga0495642_0102614
668 Ga0495652_0007238
669 Ga0495654_0006534
670 Ga0495654_0030937
671 Ga0495665_0002584
672 Ga0495587_0031504
673 Ga0495587_0058115
674 Ga0495587_0069673
675 Ga0495609_0000039
676 Ga0495609_0000730
677 Ga0495609_0002533
678 Ga0495609_0007915
679 Ga0495609_0012953
680 Ga0495609_0018237
681 Ga0495609_0023195
682 Ga0495609_0023807
683 Ga0495609_0055880
684 Ga0495609_0094582
685 Ga0495597_0000538
686 Ga0495597_0000576
687 Ga0495597_0001241
688 Ga0495597_0007734
689 Ga0495597_0034636
690 Ga0495597_0053152
691 Ga0495633_0002145
692 Ga0495633_0003206
693 Ga0495633_0003467
694 Ga0495633_0011347
695 Ga0495633_0015008
696 Ga0495656_0000498
697 Ga0495656_0016708
698 Ga0495656_0195535
699 Ga0495668_0001213
700 Ga0495668_0001527
701 Ga0495668_0003633
702 Ga0495668_0004135
703 Ga0495668_0005536
704 Ga0495668_0010810
705 Ga0495668_0018786
706 Ga0495668_0018943
707 Ga0495668_0057480
708 Ga0495668_0063778
709 Ga0495634_0003307
710 Ga0495611_0000305
711 Ga0495611_0005398
712 Ga0495611_0008239
713 Ga0495611_0030123
714 Ga0495611_0030210
715 Ga0495611_0071999
716 Ga0495611_0074527
717 Ga0495611_0206765
718 Ga0495625_0019763
719 Ga0495659_0034161
720 Ga0495661_0000648
721 Ga0495661_0000903
722 Ga0495661_0001789
723 Ga0495661_0004824
724 Ga0495661_0008338
725 Ga0495661_0011464
726 Ga0495661_0017746
727 Ga0495661_0025093
728 Ga0495661_0035073
729 Ga0495661_0043193
730 Ga0495661_0054234
731 Ga0495661_0064461
732 Ga0495661_0082532
733 Ga0495661_0113787
734 Ga0495588_0000110
735 Ga0495588_0004003
736 Ga0495588_0007609
737 Ga0495588_0012809
738 Ga0495588_0021938
739 Ga0495588_0029037
740 Ga0495623_0001157
741 Ga0495669_0000062
742 Ga0495669_0000842
743 Ga0495669_0010754
744 Ga0495669_0026949
745 Ga0495613_0057742
746 Ga0495670_0000209
747 Ga0495670_0000641
748 Ga0495670_0004003
749 Ga0495670_0010048
750 Ga0495670_0013740
751 Ga0495670_0041095
752 Ga0495670_0078423
753 Ga0495671_0000838
754 Ga0495671_0001624
755 Ga0495671_0009754
756 Ga0495671_0017451
757 Ga0495649_0000468
758 Ga0495649_0002618
759 Ga0495649_0005114
760 Ga0495649_0016772
761 Ga0495649_0024695
762 Ga0495649_0039708
763 Ga0495649_0090911
764 Ga0495649_0101006
765 Ga0495649_0162286
766 Ga0495589_0000019
767 Ga0495589_0000830
768 Ga0495589_0007994
769 Ga0495589_0031976
770 Ga0495589_0037800
771 Ga0495589_0049224
772 Ga0495589_0076829
773 Ga0495589_0084485
774 Ga0495660_0000572
775 Ga0495660_0007036
776 Ga0495660_0022940
777 Ga0495660_0030033
778 Ga0495660_0030280
779 Ga0495660_0045527
780 Ga0495581_0044020
781 Ga0495604_0001465
782 Ga0495636_0059003
783 Ga0495672_0000296
784 Ga0495672_0002576
785 Ga0495672_0003288
786 Ga0495672_0009828
787 Ga0495672_0017354
788 Ga0495676_0000114
789 Ga0495680_0054242
790 Ga0495683_0000151
791 Ga0495683_0000504
792 Ga0495683_0005231
793 Ga0495683_0008159
794 Ga0495683_0008317
795 Ga0495683_0030875
796 Ga0495683_0035480
797 Ga0495683_0077251
798 Ga0495683_0118415
799 Ga0495683_0165197
800 Ga0495687_000059
801 Ga0495687_000865
802 Ga0495687_001067
803 Ga0495687_001227
804 Ga0495687_099625
805 Ga0495675_0062861
806 Ga0495677_0000006
807 Ga0495677_0000225
808 Ga0495677_0000258
809 Ga0495677_0000347
810 Ga0495677_0002789
811 Ga0495677_0005419
812 Ga0495677_0006128
813 Ga0495677_0011857
814 Ga0495677_0071918
815 Ga0495679_004091
816 Ga0495679_009107
817 Ga0495685_002981
818 Ga0495685_031922
819 Ga0495685_034610
820 Ga0495673_0009308
821 Ga0495681_0000530
822 Ga0495681_0000549
823 Ga0495681_0001252
824 Ga0495681_0003961
825 Ga0495681_0007293
826 Ga0495681_0016590
827 Ga0495681_0021260
828 Ga0495681_0046634
829 Ga0495681_0072897
830 Ga0495681_0122881
831 Ga0495686_0000318
832 Ga0495686_0000797
833 Ga0495686_0022454
834 Ga0495686_0185534
835 Ga0495593_0100460
836 Ga0495614_0000548
837 Ga0495626_0000038
838 Ga0495626_0000103
839 Ga0495626_0000902
840 Ga0495626_0001125
841 Ga0495626_0003741
842 Ga0495626_0004094
843 Ga0495626_0005354
844 Ga0495626_0023970
845 Ga0495626_0025467
846 Ga0495626_0031958
847 Ga0495626_0052514
848 Ga0495626_0060019
849 Ga0495626_0061607
850 Ga0496101_0006523
851 Ga0496102_0001473
852 Ga0496102_0392196
853 Ga0496108_0214384
854 Ga0496109_0082654
855 Ga0496109_0214774
856 Ga0496113_0179143
857 Ga0496121_0070823
858 Ga0496122_0000727
859 Ga0496122_0008695
860 Ga0496123_0000791
861 Ga0496123_0004450
862 Ga0496124_0075786
863 Ga0496124_0224887
864 Ga0496125_0003361
865 Ga0495678_000157
866 Ga0495678_000391
867 Ga0495678_000743
868 Ga0495682_0000342
869 Ga0495682_0002914
870 Ga0495682_0018172
871 Ga0501034_0098596
872 Ga0501035_0052658
873 Ga0466962_0139491
874 2643799857
875 2644474857
876 2809146802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

56

292

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p7i-assembly1.cif.gz_A-2 crystal structure of escherichia coli phnd in complex with 2-aminoethyl phosphonate 0.8411 29 268
3quj-assembly1.cif.gz_A crystal structure of the phosphonate binding protein, phnd, from escherichia coli 0.8365 29 268
3n5l-assembly2.cif.gz_B crystal structure of a binding protein component of abc phosphonate transporter (pa3383) from pseudomonas aeruginosa at 1.97 a resolution 0.8362 27 268
3quj-assembly1.cif.gz_B crystal structure of the phosphonate binding protein, phnd, from escherichia coli 0.8346 29 277
3quj-assembly2.cif.gz_D crystal structure of the phosphonate binding protein, phnd, from escherichia coli 0.8314 29 278
ID Description Score Start End Superfamily
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8411 113 208 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7854 114 204 3.40.190.10
2ia4B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7768 115 182 3.40.190.10
3zsfD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7742 112 208 3.40.190.10
1q1kA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7713 112 207 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2G4DT34-F1-model_v4 ABC transporter substrate-binding protein 0.9533 38 284
AF-A0A2G4DT34-F1-model_v4 ABC transporter substrate-binding protein 0.9496 38 284
AF-A0A3M5ZQY2-F1-model_v4 Phosphate/phosphonate ABC transporter periplasmic protein 0.9428 56 284
AF-A0A4R3HW55-F1-model_v4 Phosphonate transport system substrate-binding protein 0.9393 21 281
AF-A0A3M5ZQY2-F1-model_v4 Phosphate/phosphonate ABC transporter periplasmic protein 0.935 56 284

Map