F444069

General Info

Members Datasets Scaffolds Average Seq Length
438 234 437 133

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0003316|Ga0496114_0003316_8052_8531
Length 159
Sequence MLTPLDRVRRGDPVSPRIDIGTGGHMLKTYLGSCHCGAVRFEADIDLTLPTYRCNCSICRRNRFWPAIVTPDRFRLLAGEGELTEYRFNSRRNSHHFCRTCGVRPFGIGNNMPGEERVYGVNLGCLEDVAPEELDAAPVTYVDGAHDRWQETPRFTRYL

Samples

Sample ID Description Type Environment
1 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
161 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
162 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10435425 3300005290 Unclassified 689
2 Ga0065715_10588095 3300005293 Bacteria 715
3 Ga0070658_10511296 3300005327 Bacteria 1038
4 Ga0070658_10697925 3300005327 Bacteria 881
5 Ga0070676_10000472 3300005328 Bacteria 19298
6 Ga0070690_100291162 3300005330 Bacteria 1168
7 Ga0070690_100598771 3300005330 Bacteria 836
8 Ga0070690_100916864 3300005330 Bacteria 686
9 Ga0070670_100035529 3300005331 Bacteria 4290
10 Ga0070670_100061802 3300005331 Bacteria 3215
11 Ga0070670_100677055 3300005331 Bacteria 926
12 Ga0070670_100803591 3300005331 Bacteria 849
13 Ga0070677_10003912 3300005333 Bacteria 4831
14 Ga0070677_10046298 3300005333 Bacteria 1739
15 Ga0068869_100000782 3300005334 Bacteria 18135
16 Ga0068869_100002744 3300005334 Bacteria 10659
17 Ga0070666_10000383 3300005335 Bacteria 27824
18 Ga0070666_10685354 3300005335 Unclassified 751
19 Ga0070680_100571183 3300005336 Bacteria 970
20 Ga0068868_100235195 3300005338 Bacteria 1538
21 Ga0068868_101418037 3300005338 Unclassified 648
22 Ga0070660_100726849 3300005339 Unclassified 833
23 Ga0070689_100174206 3300005340 Bacteria 1744
24 Ga0070689_100437134 3300005340 Bacteria 1111
25 Ga0070689_101571916 3300005340 Bacteria 597
26 Ga0070661_101329538 3300005344 Bacteria 603
27 Ga0070692_10295448 3300005345 Bacteria 987
28 Ga0070668_100001273 3300005347 Bacteria 18006
29 Ga0070669_100002155 3300005353 Bacteria 14244
30 Ga0070675_100002617 3300005354 Bacteria 13517
31 Ga0070675_100009479 3300005354 Bacteria 7577
32 Ga0070675_100530904 3300005354 Bacteria 1062
33 Ga0070671_100144891 3300005355 Bacteria 2005
34 Ga0070671_100797966 3300005355 Unclassified 822
35 Ga0070674_100045204 3300005356 Bacteria 3008
36 Ga0070674_100125465 3300005356 Bacteria 1906
37 Ga0070673_100108870 3300005364 Unclassified 2295
38 Ga0070673_100231756 3300005364 Bacteria 1602
39 Ga0070673_100342452 3300005364 Bacteria 1325
40 Ga0070688_100150745 3300005365 Bacteria 1589
41 Ga0070688_100890267 3300005365 Bacteria 701
42 Ga0070659_101123437 3300005366 Bacteria 693
43 Ga0070667_100002701 3300005367 Bacteria 15360
44 Ga0070667_100405203 3300005367 Bacteria 1242
45 Ga0070701_10133969 3300005438 Bacteria 1410
46 Ga0070705_100000798 3300005440 Bacteria 17772
47 Ga0070694_100024699 3300005444 Bacteria 3880
48 Ga0070708_100555240 3300005445 Bacteria 1083
49 Ga0070663_100093865 3300005455 Bacteria 2227
50 Ga0070678_100028442 3300005456 Bacteria 3812
51 Ga0070678_100078499 3300005456 Bacteria 2494
52 Ga0070678_100080250 3300005456 Bacteria 2470
53 Ga0070678_100085960 3300005456 Bacteria 2398
54 Ga0070678_100124762 3300005456 Bacteria 2036
55 Ga0070678_100217580 3300005456 Bacteria 1586
56 Ga0070662_100002002 3300005457 Bacteria 12492
57 Ga0070662_100068815 3300005457 Bacteria 2604
58 Ga0070662_100202260 3300005457 Bacteria 1577
59 Ga0068867_100006666 3300005459 Bacteria 8165
60 Ga0070706_100185461 3300005467 Bacteria 1944
61 Ga0070707_100514320 3300005468 Bacteria 1159
62 Ga0070699_100017291 3300005518 Bacteria 6193
63 Ga0070699_102035945 3300005518 Bacteria 525
64 Ga0070684_101951525 3300005535 Unclassified 554
65 Ga0070697_100003801 3300005536 Bacteria 11595
66 Ga0068853_100041700 3300005539 Bacteria 3923
67 Ga0068853_100069018 3300005539 Unclassified 3074
68 Ga0070672_100002092 3300005543 Bacteria 12581
69 Ga0070672_100010069 3300005543 Bacteria 6545
70 Ga0070672_100037125 3300005543 Bacteria 3715
71 Ga0070672_101159974 3300005543 Bacteria 688
72 Ga0070686_100022911 3300005544 Bacteria 3726
73 Ga0070686_100439749 3300005544 Bacteria 1000
74 Ga0070695_100000996 3300005545 Bacteria 15419
75 Ga0070696_100001647 3300005546 Bacteria 14646
76 Ga0070693_100016298 3300005547 Bacteria 3844
77 Ga0070693_100260681 3300005547 Bacteria 1153
78 Ga0070693_100907363 3300005547 Unclassified 661
79 Ga0070665_100130159 3300005548 Bacteria 2519
80 Ga0070665_101393414 3300005548 Unclassified 710
81 Ga0070704_101122368 3300005549 Bacteria 715
82 Ga0068857_100631207 3300005577 Bacteria 1014
83 Ga0068857_101433672 3300005577 Bacteria 672
84 Ga0068854_100470980 3300005578 Bacteria 1053
85 Ga0068856_100039435 3300005614 Bacteria 4637
86 Ga0068852_100022201 3300005616 Bacteria 5085
87 Ga0068852_100069704 3300005616 Bacteria 3083
88 Ga0068852_100207087 3300005616 Bacteria 1859
89 Ga0068852_100241926 3300005616 Unclassified 1725
90 Ga0068852_100637838 3300005616 Unclassified 1072
91 Ga0068852_101588912 3300005616 Bacteria 676
92 Ga0068859_100129251 3300005617 Bacteria 2597
93 Ga0068859_100595888 3300005617 Bacteria 1198
94 Ga0068859_100881498 3300005617 Bacteria 980
95 Ga0068864_100008915 3300005618 Bacteria 8267
96 Ga0068864_100225138 3300005618 Bacteria 1732
97 Ga0068864_101048090 3300005618 Bacteria 810
98 Ga0068866_10007383 3300005718 Bacteria 4599
99 Ga0068861_100001459 3300005719 Bacteria 14966
100 Ga0068851_10126900 3300005834 Bacteria 1376
101 Ga0068851_10804232 3300005834 Bacteria 584
102 Ga0068851_10925374 3300005834 Bacteria 547
103 Ga0068870_10521900 3300005840 Bacteria 795
104 Ga0068863_100001611 3300005841 Bacteria 22315
105 Ga0068863_100014714 3300005841 Bacteria 7529
106 Ga0068863_100047025 3300005841 Bacteria 4095
107 Ga0068863_100057323 3300005841 Bacteria 3687
108 Ga0068863_100348490 3300005841 Bacteria 1442
109 Ga0068863_101367479 3300005841 Bacteria 715
110 Ga0068858_100519630 3300005842 Bacteria 1151
111 Ga0068858_101291725 3300005842 Bacteria 718
112 Ga0068860_100003919 3300005843 Bacteria 15290
113 Ga0068860_101500597 3300005843 Bacteria 696
114 Ga0068862_100002751 3300005844 Bacteria 15426
115 Ga0068862_100101592 3300005844 Bacteria 2516
116 Ga0070716_100481380 3300006173 Bacteria 911
117 Ga0075366_10257478 3300006195 Bacteria 1065
118 Ga0097621_100023069 3300006237 Bacteria 4840
119 Ga0097621_100073269 3300006237 Bacteria 2835
120 Ga0097621_100121736 3300006237 Bacteria 2213
121 Ga0097621_100166363 3300006237 Bacteria 1899
122 Ga0097621_100193053 3300006237 Unclassified 1764
123 Ga0097621_100263563 3300006237 Unclassified 1512
124 Ga0097621_102216056 3300006237 Bacteria 526
125 Ga0068871_100004228 3300006358 Bacteria 9944
126 Ga0068871_100010010 3300006358 Bacteria 6891
127 Ga0068871_100112979 3300006358 Bacteria 2287
128 Ga0068871_100155365 3300006358 Unclassified 1953
129 Ga0068871_100190726 3300006358 Unclassified 1765
130 Ga0068871_101849345 3300006358 Bacteria 574
131 Ga0075428_100098532 3300006844 Bacteria 3187
132 Ga0075429_100308678 3300006880 Bacteria 1385
133 Ga0075429_100550545 3300006880 Bacteria 1011
134 Ga0068865_100002156 3300006881 Bacteria 11594
135 Ga0068865_100239591 3300006881 Bacteria 1427
136 Ga0068865_100977503 3300006881 Bacteria 740
137 Ga0068865_101054616 3300006881 Bacteria 714
138 Ga0097620_100129243 3300006931 Bacteria 2597
139 Ga0097620_100595885 3300006931 Bacteria 1198
140 Ga0097620_100881266 3300006931 Bacteria 980
141 Ga0105240_10773243 3300009093 Bacteria 1042
142 Ga0111539_10001041 3300009094 Bacteria 36433
143 Ga0111539_10025764 3300009094 Bacteria 7203
144 Ga0111539_10161771 3300009094 Unclassified 2618
145 Ga0111539_11746678 3300009094 Bacteria 721
146 Ga0105245_10064028 3300009098 Unclassified 3323
147 Ga0105245_10101215 3300009098 Bacteria 2667
148 Ga0105247_10114069 3300009101 Bacteria 1743
149 Ga0114129_11613901 3300009147 Unclassified 794
150 Ga0105243_10332927 3300009148 Bacteria 1387
151 Ga0105243_11888815 3300009148 Unclassified 630
152 Ga0105241_10528860 3300009174 Bacteria 1055
153 Ga0105242_10021774 3300009176 Bacteria 5037
154 Ga0105242_10338107 3300009176 Unclassified 1387
155 Ga0105242_10433213 3300009176 Bacteria 1235
156 Ga0105242_10821518 3300009176 Unclassified 922
157 Ga0105248_10002726 3300009177 Bacteria 19624
158 Ga0105248_10009185 3300009177 Bacteria 10875
159 Ga0105248_10034622 3300009177 Bacteria 5650
160 Ga0105248_10035120 3300009177 Bacteria 5609
161 Ga0105248_10248590 3300009177 Unclassified 2002
162 Ga0105248_10306363 3300009177 Unclassified 1789
163 Ga0105249_10000996 3300009553 Bacteria 25124
164 Ga0105246_11201141 3300011119 Bacteria 698
165 Ga0157339_1014522 3300012505 Bacteria 766
166 Ga0157373_10984789 3300013100 Unclassified 629
167 Ga0157370_10200536 3300013104 Bacteria 1851
168 Ga0157370_10722549 3300013104 Unclassified 908
169 Ga0157374_10039898 3300013296 Bacteria 4322
170 Ga0157374_10071555 3300013296 Bacteria 3270
171 Ga0157374_10097449 3300013296 Bacteria 2814
172 Ga0157374_10300187 3300013296 Bacteria 1589
173 Ga0157374_12185159 3300013296 Bacteria 580
174 Ga0157378_10010904 3300013297 Bacteria 7950
175 Ga0157378_10044479 3300013297 Bacteria 3944
176 Ga0157378_10456278 3300013297 Bacteria 1269
177 Ga0157378_10753931 3300013297 Bacteria 996
178 Ga0163162_10021806 3300013306 Bacteria 6309
179 Ga0163162_10034779 3300013306 Bacteria 5016
180 Ga0163162_10255205 3300013306 Bacteria 1885
181 Ga0163162_10333308 3300013306 Bacteria 1650
182 Ga0163162_10342380 3300013306 Bacteria 1628
183 Ga0157375_10000906 3300013308 Bacteria 25775
184 Ga0157375_10011174 3300013308 Bacteria 7920
185 Ga0157375_10014952 3300013308 Bacteria 6939
186 Ga0157375_10078860 3300013308 Bacteria 3328
187 Ga0157375_10110006 3300013308 Bacteria 2852
188 Ga0163163_10446369 3300014325 Bacteria 1353
189 Ga0157380_10955027 3300014326 Bacteria 887
190 Ga0157377_10705650 3300014745 Unclassified 733
191 Ga0157377_10910798 3300014745 Bacteria 658
192 Ga0157379_10015165 3300014968 Bacteria 6760
193 Ga0157379_10320192 3300014968 Bacteria 1416
194 Ga0157376_10001379 3300014969 Bacteria 15994
195 Ga0157376_10023563 3300014969 Bacteria 4820
196 Ga0157376_10238144 3300014969 Bacteria 1694
197 Ga0157376_10397336 3300014969 Bacteria 1332
198 Ga0157376_10433366 3300014969 Unclassified 1278
199 Ga0157376_10683940 3300014969 Unclassified 1029
200 Ga0163161_10000551 3300017792 Bacteria 30373
201 Ga0207697_10022886 3300025315 Bacteria 2559
202 Ga0207656_10009223 3300025321 Bacteria 3660
203 Ga0207656_10088016 3300025321 Bacteria 1406
204 Ga0207656_10104265 3300025321 Bacteria 1303
205 Ga0207682_10005457 3300025893 Bacteria 5176
206 Ga0207682_10066332 3300025893 Bacteria 1521
207 Ga0207682_10301814 3300025893 Bacteria 751
208 Ga0207642_10289984 3300025899 Bacteria 945
209 Ga0207688_10060480 3300025901 Bacteria 2134
210 Ga0207680_10012679 3300025903 Unclassified 4301
211 Ga0207680_10200653 3300025903 Bacteria 1359
212 Ga0207645_10000390 3300025907 Bacteria 36191
213 Ga0207645_11232588 3300025907 Bacteria 502
214 Ga0207705_10515301 3300025909 Unclassified 929
215 Ga0207705_10593053 3300025909 Bacteria 862
216 Ga0207654_10190399 3300025911 Bacteria 1344
217 Ga0207695_10470697 3300025913 Bacteria 1139
218 Ga0207662_10076117 3300025918 Bacteria 2039
219 Ga0207657_10490370 3300025919 Unclassified 963
220 Ga0207681_10001344 3300025923 Bacteria 15876
221 Ga0207694_10888086 3300025924 Bacteria 754
222 Ga0207650_10500838 3300025925 Bacteria 1015
223 Ga0207650_10612924 3300025925 Unclassified 916
224 Ga0207659_10007942 3300025926 Bacteria 6562
225 Ga0207659_10332196 3300025926 Bacteria 1257
226 Ga0207659_10666371 3300025926 Bacteria 890
227 Ga0207687_10091667 3300025927 Bacteria 2217
228 Ga0207687_10944131 3300025927 Bacteria 739
229 Ga0207644_10205703 3300025931 Bacteria 1554
230 Ga0207644_11189213 3300025931 Bacteria 641
231 Ga0207706_10006984 3300025933 Bacteria 10435
232 Ga0207706_10011456 3300025933 Bacteria 8077
233 Ga0207706_10314834 3300025933 Bacteria 1363
234 Ga0207706_11149249 3300025933 Bacteria 647
235 Ga0207706_11363336 3300025933 Bacteria 584
236 Ga0207686_10075242 3300025934 Bacteria 2185
237 Ga0207709_10753018 3300025935 Bacteria 783
238 Ga0207709_11542291 3300025935 Unclassified 551
239 Ga0207670_10226906 3300025936 Bacteria 1433
240 Ga0207669_10005373 3300025937 Bacteria 5743
241 Ga0207704_10002919 3300025938 Bacteria 7721
242 Ga0207704_10683406 3300025938 Bacteria 848
243 Ga0207704_10783493 3300025938 Bacteria 795
244 Ga0207704_11026684 3300025938 Unclassified 698
245 Ga0207704_11172203 3300025938 Unclassified 654
246 Ga0207665_10143237 3300025939 Bacteria 1706
247 Ga0207691_10001079 3300025940 Bacteria 27155
248 Ga0207691_10004663 3300025940 Bacteria 13268
249 Ga0207691_10022820 3300025940 Bacteria 5899
250 Ga0207691_10024680 3300025940 Bacteria 5653
251 Ga0207691_10068524 3300025940 Bacteria 3205
252 Ga0207711_10040861 3300025941 Bacteria 3947
253 Ga0207711_10070439 3300025941 Bacteria 3033
254 Ga0207711_10148022 3300025941 Bacteria 2117
255 Ga0207711_10668034 3300025941 Bacteria 969
256 Ga0207689_10003499 3300025942 Bacteria 14351
257 Ga0207689_10008976 3300025942 Bacteria 8662
258 Ga0207651_10585834 3300025960 Unclassified 973
259 Ga0207651_10612114 3300025960 Unclassified 953
260 Ga0207651_11335035 3300025960 Bacteria 645
261 Ga0207712_10000987 3300025961 Bacteria 20375
262 Ga0207668_10039113 3300025972 Unclassified 3189
263 Ga0207658_10051803 3300025986 Unclassified 3026
264 Ga0207658_10483841 3300025986 Bacteria 1100
265 Ga0207658_10706182 3300025986 Bacteria 911
266 Ga0207677_10089960 3300026023 Unclassified 2229
267 Ga0207703_10004869 3300026035 Bacteria 10920
268 Ga0207703_10112533 3300026035 Bacteria 2325
269 Ga0207703_10320361 3300026035 Bacteria 1419
270 Ga0207703_11036371 3300026035 Bacteria 787
271 Ga0207639_10067510 3300026041 Unclassified 2783
272 Ga0207639_10077512 3300026041 Unclassified 2620
273 Ga0207639_10110496 3300026041 Unclassified 2239
274 Ga0207678_10034429 3300026067 Bacteria 4411
275 Ga0207678_10134857 3300026067 Bacteria 2107
276 Ga0207678_10379230 3300026067 Bacteria 1222
277 Ga0207702_10045319 3300026078 Bacteria 3700
278 Ga0207641_10012611 3300026088 Bacteria 6931
279 Ga0207641_10020591 3300026088 Bacteria 5419
280 Ga0207641_10258582 3300026088 Bacteria 1629
281 Ga0207641_11084224 3300026088 Unclassified 799
282 Ga0207648_10001878 3300026089 Bacteria 22968
283 Ga0207648_10188349 3300026089 Bacteria 1828
284 Ga0207676_10027601 3300026095 Bacteria 4230
285 Ga0207676_10207647 3300026095 Bacteria 1735
286 Ga0207674_10903936 3300026116 Bacteria 851
287 Ga0207675_100002444 3300026118 Bacteria 18401
288 Ga0207675_100085973 3300026118 Bacteria 2952
289 Ga0207683_10070502 3300026121 Bacteria 3088
290 Ga0207683_10104429 3300026121 Bacteria 2532
291 Ga0207683_10113083 3300026121 Bacteria 2432
292 Ga0207683_10210135 3300026121 Bacteria 1771
293 Ga0207698_10070944 3300026142 Bacteria 2762
294 Ga0207698_10225218 3300026142 Unclassified 1698
295 Ga0207698_10424861 3300026142 Bacteria 1276
296 Ga0207698_10684141 3300026142 Bacteria 1019
297 Ga0207698_11350009 3300026142 Bacteria 728
298 Ga0207698_11372457 3300026142 Unclassified 722
299 Ga0209969_1012299 3300027360 Bacteria 1233
300 Ga0210000_1018269 3300027462 Bacteria 1064
301 Ga0209995_1045003 3300027471 Unclassified 747
302 Ga0209995_1047567 3300027471 Bacteria 726
303 Ga0209968_1007801 3300027526 Bacteria 1623
304 Ga0209982_1010229 3300027552 Bacteria 1389
305 Ga0209982_1046664 3300027552 Bacteria 695
306 Ga0209982_1071300 3300027552 Unclassified 569
307 Ga0210002_1046029 3300027617 Bacteria 747
308 Ga0209974_10006598 3300027876 Bacteria 4040
309 Ga0209974_10019570 3300027876 Bacteria 2244
310 Ga0207428_10004837 3300027907 Bacteria 12715
311 Ga0207428_10909848 3300027907 Bacteria 621
312 Ga0268266_10170360 3300028379 Bacteria 1976
313 Ga0268266_10530094 3300028379 Bacteria 1127
314 Ga0268265_10006346 3300028380 Bacteria 8014
315 Ga0268265_10472297 3300028380 Bacteria 1176
316 Ga0307516_10001281 3300031730 Bacteria 34984
317 Ga0307405_10303821 3300031731 Bacteria 1212
318 Ga0307405_10786723 3300031731 Bacteria 796
319 Ga0307405_11381095 3300031731 Bacteria 615
320 Ga0307410_10742188 3300031852 Unclassified 831
321 Ga0307412_10173074 3300031911 Bacteria 1616
322 Ga0307416_100248052 3300032002 Bacteria 1731
323 Ga0307416_100334882 3300032002 Bacteria 1523
324 Ga0307416_100468967 3300032002 Bacteria 1316
325 Ga0307416_101413390 3300032002 Bacteria 801
326 Ga0307411_11787608 3300032005 Bacteria 570
327 Ga0373956_0189326 3300035119 Bacteria 974
328 Ga0373957_0030166 3300035120 Bacteria 1986
329 Ga0373943_0014995 3300035170 Bacteria 3518
330 Ga0373924_0308932 3300035410 Bacteria 702
331 Ga0373935_0105727 3300035692 Bacteria 1861
332 Ga0373937_0026757 3300036401 Bacteria 5213
333 Ga0373937_1141217 3300036401 Unclassified 728
334 Ga0373925_0125421 3300037068 Bacteria 1997
335 Ga0451797_1301464 3300041453 Bacteria 798
336 Ga0451845_0583611 3300041501 Unclassified 538
337 Ga0451849_0263988 3300041505 Bacteria 599
338 Ga0451853_0190596 3300041512 Unclassified 699
339 Ga0439432_251163 3300042006 Bacteria 507
340 Ga0439449_0018909 3300042007 Bacteria 2583
341 Ga0439452_053466 3300042010 Bacteria 919
342 Ga0439440_0015703 3300042993 Bacteria 1649
343 Ga0453683_0630970 3300044673 Unclassified 700
344 Ga0495603_0240318 3300046455 Bacteria 1043
345 Ga0495629_0064096 3300046459 Bacteria 2566
346 Ga0495580_0227567 3300046472 Bacteria 1281
347 Ga0495639_0333095 3300046475 Bacteria 760
348 Ga0495618_0839714 3300046514 Bacteria 533
349 Ga0495628_0556697 3300046516 Bacteria 823
350 Ga0495640_0153065 3300046533 Bacteria 1481
351 Ga0495598_0143658 3300046537 Bacteria 827
352 Ga0495621_0147581 3300046539 Bacteria 923
353 Ga0495645_0102491 3300046543 Bacteria 2034
354 Ga0495645_0135060 3300046543 Bacteria 1726
355 Ga0495667_0224393 3300046559 Bacteria 1199
356 Ga0495635_0060178 3300046663 Bacteria 2611
357 Ga0495646_0388380 3300046680 Bacteria 727
358 Ga0495647_0165816 3300046681 Bacteria 954
359 Ga0495647_0323139 3300046681 Bacteria 699
360 Ga0495613_0634233 3300046689 Bacteria 708
361 Ga0495670_0582164 3300046691 Bacteria 609
362 Ga0495670_0786831 3300046691 Unclassified 519
363 Ga0495674_0076834 3300047319 Bacteria 2872
364 Ga0495676_0977703 3300047321 Bacteria 541
365 Ga0496100_0969887 3300048903 Unclassified 669
366 Ga0496108_0413079 3300048911 Bacteria 1179
367 Ga0496110_0579502 3300048913 Bacteria 1019
368 Ga0496110_1076526 3300048913 Bacteria 712
369 Ga0496114_0003316 3300048917 Bacteria 12370
370 Ga0496126_0069754 3300048929 Bacteria 3134
371 Ga0501032_0014604 3300049569 Bacteria 5563
372 Ga0501032_0654921 3300049569 Bacteria 667
373 Ga0501033_0025126 3300049570 Bacteria 4488
374 Ga0501034_0042621 3300049571 Bacteria 4594
375 Ga0501034_0131895 3300049571 Bacteria 2481
376 Ga0501034_0584224 3300049571 Unclassified 1024
377 Ga0501036_0011300 3300049572 Bacteria 7386
378 Ga0501036_0027474 3300049572 Bacteria 4807
379 Ga0501037_0003619 3300049573 Bacteria 11201
380 Ga0501037_0059633 3300049573 Unclassified 2783
381 Ga0501038_0007243 3300049574 Bacteria 10246
382 Ga0501038_0015410 3300049574 Bacteria 6949
383 Ga0501038_0830352 3300049574 Bacteria 685
384 Ga0501039_0030495 3300049575 Unclassified 4158
385 Ga0501039_0186249 3300049575 Bacteria 1632
386 Ga0501040_0022732 3300049576 Bacteria 4200
387 Ga0501040_0244800 3300049576 Bacteria 1279
388 Ga0501041_0004553 3300049577 Bacteria 8043
389 Ga0501042_0019621 3300049578 Bacteria 4698
390 Ga0501042_1238778 3300049578 Bacteria 544
391 Ga0501043_0014100 3300049579 Bacteria 6254
392 Ga0501043_0056335 3300049579 Bacteria 3087
393 Ga0501046_0156738 3300049580 Unclassified 1715
394 Ga0501047_0093072 3300049581 Bacteria 2893
395 Ga0501048_0320860 3300049582 Bacteria 1103
396 Ga0501048_0844271 3300049582 Bacteria 658
397 Ga0501048_1082673 3300049582 Bacteria 577
398 Ga0501068_0065919 3300049584 Unclassified 2205
399 Ga0501070_0018785 3300049586 Bacteria 5799
400 Ga0501071_0015015 3300049587 Bacteria 5308
401 Ga0501071_0214011 3300049587 Bacteria 1449
402 Ga0501072_0002752 3300049588 Bacteria 13209
403 Ga0501073_0023530 3300049589 Bacteria 4423
404 Ga0501074_0407397 3300049590 Unclassified 964
405 Ga0501075_0001645 3300049591 Bacteria 14682
406 Ga0501075_0556580 3300049591 Bacteria 875
407 Ga0501076_0003431 3300049592 Bacteria 11120
408 Ga0501077_0009563 3300049593 Bacteria 6027
409 Ga0501233_109357 3300049668 Bacteria 738
410 Ga0501225_0169741 3300049705 Unclassified 676
411 Ga0501079_0001743 3300049741 Bacteria 15508
412 Ga0501080_0022413 3300049742 Bacteria 5851
413 Ga0501080_0047370 3300049742 Bacteria 4001
414 Ga0501081_0006975 3300049743 Bacteria 7345
415 Ga0501081_0053444 3300049743 Bacteria 2789
416 Ga0501083_0010526 3300049744 Bacteria 6509
417 Ga0501035_0023054 3300049822 Bacteria 5713
418 Ga0501035_0079819 3300049822 Unclassified 2890
419 Ga0501044_0009987 3300049823 Bacteria 10312
420 Ga0501045_0056228 3300049824 Bacteria 2877
421 Ga0501045_1027204 3300049824 Bacteria 604
422 nmdc:mga04h51_320469_c1 3300050495 Bacteria 635
423 nmdc:mga09592_168906_c1 3300050508 Bacteria 1011
424 nmdc:mga09592_413021_c1 3300050508 Bacteria 1166
425 nmdc:mga06r32_930700_c1 3300050510 Bacteria 824
426 nmdc:mga08y16_131050_c1 3300050511 Bacteria 2607
427 nmdc:mga08y16_1376385_c1 3300050511 Bacteria 670
428 nmdc:mga08y16_7903_c1 3300050511 Bacteria 11131
429 nmdc:mga08y16_96629_c1 3300050511 Unclassified 3076
430 nmdc:mga0rr50_1328064_c1 3300050513 Bacteria 609
431 Ga0495601_0074361 3300053077 Bacteria 2174
432 Ga0495612_0255838 3300053078 Bacteria 779
433 Ga0495619_0077480 3300053085 Bacteria 2233
434 Ga0495619_0077631 3300053085 Bacteria 2231
435 Ga0500627_0311741 3300053158 Bacteria 685
436 Ga0501084_0007391 3300054114 Bacteria 9055
437 Ga0530510_0003596 3300061734 Bacteria 10671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10024680 Ga0207691_100246807 129
2 iso_pu_bacteria 2643221581 2643916234 129
3 3300005327 Ga0070658_10511296 Ga0070658_105112962 131
4 3300005327 Ga0070658_10697925 Ga0070658_106979252 131
5 3300005328 Ga0070676_10000472 Ga0070676_1000047225 131
6 3300005330 Ga0070690_100291162 Ga0070690_1002911622 131
7 3300005331 Ga0070670_100035529 Ga0070670_1000355292 131
8 3300005331 Ga0070670_100061802 Ga0070670_1000618023 131
9 3300005331 Ga0070670_100677055 Ga0070670_1006770552 131
10 3300005331 Ga0070670_100803591 Ga0070670_1008035912 131
11 3300005333 Ga0070677_10003912 Ga0070677_100039124 131
12 3300005333 Ga0070677_10046298 Ga0070677_100462983 131
13 3300005334 Ga0068869_100000782 Ga0068869_1000007822 131
14 3300005334 Ga0068869_100002744 Ga0068869_10000274418 131
15 3300005335 Ga0070666_10000383 Ga0070666_1000038321 131
16 3300005338 Ga0068868_101418037 Ga0068868_1014180371 131
17 3300005339 Ga0070660_100726849 Ga0070660_1007268491 131
18 3300005340 Ga0070689_100437134 Ga0070689_1004371342 131
19 3300005340 Ga0070689_101571916 Ga0070689_1015719161 131
20 3300005344 Ga0070661_101329538 Ga0070661_1013295381 131
21 3300005347 Ga0070668_100001273 Ga0070668_10000127310 131
22 3300005353 Ga0070669_100002155 Ga0070669_10000215514 131
23 3300005354 Ga0070675_100002617 Ga0070675_10000261710 131
24 3300005354 Ga0070675_100009479 Ga0070675_1000094798 131
25 3300005354 Ga0070675_100530904 Ga0070675_1005309042 131
26 3300005355 Ga0070671_100144891 Ga0070671_1001448913 131
27 3300005356 Ga0070674_100045204 Ga0070674_1000452043 131
28 3300005356 Ga0070674_100125465 Ga0070674_1001254653 131
29 3300005364 Ga0070673_100108870 Ga0070673_1001088702 131
30 3300005364 Ga0070673_100231756 Ga0070673_1002317561 131
31 3300005364 Ga0070673_100342452 Ga0070673_1003424522 131
32 3300005365 Ga0070688_100150745 Ga0070688_1001507453 131
33 3300005366 Ga0070659_101123437 Ga0070659_1011234372 131
34 3300005367 Ga0070667_100002701 Ga0070667_1000027016 131
35 3300005367 Ga0070667_100405203 Ga0070667_1004052032 131
36 3300005438 Ga0070701_10133969 Ga0070701_101339692 131
37 3300005455 Ga0070663_100093865 Ga0070663_1000938654 131
38 3300005456 Ga0070678_100028442 Ga0070678_1000284424 131
39 3300005456 Ga0070678_100078499 Ga0070678_1000784993 131
40 3300005456 Ga0070678_100080250 Ga0070678_1000802502 131
41 3300005456 Ga0070678_100085960 Ga0070678_1000859604 131
42 3300005456 Ga0070678_100124762 Ga0070678_1001247621 131
43 3300005457 Ga0070662_100002002 Ga0070662_10000200217 131
44 3300005457 Ga0070662_100068815 Ga0070662_1000688156 131
45 3300005457 Ga0070662_100202260 Ga0070662_1002022602 131
46 3300005459 Ga0068867_100006666 Ga0068867_1000066668 131
47 3300005468 Ga0070707_100514320 Ga0070707_1005143203 131
48 3300005518 Ga0070699_102035945 Ga0070699_1020359451 131
49 3300005539 Ga0068853_100069018 Ga0068853_1000690183 131
50 3300005543 Ga0070672_100002092 Ga0070672_10000209225 131
51 3300005543 Ga0070672_100010069 Ga0070672_1000100693 131
52 3300005543 Ga0070672_100037125 Ga0070672_1000371253 131
53 3300005543 Ga0070672_101159974 Ga0070672_1011599742 131
54 3300005544 Ga0070686_100022911 Ga0070686_1000229113 131
55 3300005548 Ga0070665_100130159 Ga0070665_1001301591 131
56 3300005577 Ga0068857_100631207 Ga0068857_1006312072 131
57 3300005578 Ga0068854_100470980 Ga0068854_1004709802 131
58 3300005616 Ga0068852_100022201 Ga0068852_1000222017 131
59 3300005616 Ga0068852_100069704 Ga0068852_1000697046 131
60 3300005616 Ga0068852_100207087 Ga0068852_1002070873 131
61 3300005616 Ga0068852_100241926 Ga0068852_1002419263 131
62 3300005616 Ga0068852_101588912 Ga0068852_1015889122 131
63 3300005617 Ga0068859_100129251 Ga0068859_1001292512 131
64 3300005617 Ga0068859_100595888 Ga0068859_1005958882 131
65 3300005618 Ga0068864_100008915 Ga0068864_10000891510 131
66 3300005618 Ga0068864_100225138 Ga0068864_1002251383 131
67 3300005618 Ga0068864_101048090 Ga0068864_1010480902 131
68 3300005718 Ga0068866_10007383 Ga0068866_100073832 131
69 3300005719 Ga0068861_100001459 Ga0068861_10000145912 131
70 3300005834 Ga0068851_10126900 Ga0068851_101269003 131
71 3300005834 Ga0068851_10804232 Ga0068851_108042321 131
72 3300005834 Ga0068851_10925374 Ga0068851_109253741 131
73 3300005840 Ga0068870_10521900 Ga0068870_105219002 131
74 3300005841 Ga0068863_100001611 Ga0068863_10000161133 131
75 3300005841 Ga0068863_100014714 Ga0068863_1000147149 131
76 3300005841 Ga0068863_100047025 Ga0068863_1000470256 131
77 3300005841 Ga0068863_100057323 Ga0068863_1000573233 131
78 3300005841 Ga0068863_100348490 Ga0068863_1003484902 131
79 3300005841 Ga0068863_101367479 Ga0068863_1013674792 131
80 3300005842 Ga0068858_100519630 Ga0068858_1005196302 131
81 3300005842 Ga0068858_101291725 Ga0068858_1012917252 131
82 3300005843 Ga0068860_100003919 Ga0068860_10000391910 131
83 3300005843 Ga0068860_101500597 Ga0068860_1015005972 131
84 3300005844 Ga0068862_100002751 Ga0068862_10000275112 131
85 3300005844 Ga0068862_100101592 Ga0068862_1001015923 131
86 3300006237 Ga0097621_100023069 Ga0097621_1000230697 131
87 3300006237 Ga0097621_100073269 Ga0097621_1000732696 131
88 3300006237 Ga0097621_100166363 Ga0097621_1001663632 131
89 3300006237 Ga0097621_102216056 Ga0097621_1022160561 131
90 3300006358 Ga0068871_100010010 Ga0068871_10001001010 131
91 3300006358 Ga0068871_101849345 Ga0068871_1018493452 131
92 3300006844 Ga0075428_100098532 Ga0075428_1000985325 131
93 3300006880 Ga0075429_100308678 Ga0075429_1003086782 131
94 3300006881 Ga0068865_100002156 Ga0068865_10000215610 131
95 3300006881 Ga0068865_100239591 Ga0068865_1002395912 131
96 3300006881 Ga0068865_100977503 Ga0068865_1009775032 131
97 3300006881 Ga0068865_101054616 Ga0068865_1010546162 131
98 3300006931 Ga0097620_100129243 Ga0097620_1001292435 131
99 3300006931 Ga0097620_100595885 Ga0097620_1005958852 131
100 3300009094 Ga0111539_10001041 Ga0111539_100010417 131
101 3300009094 Ga0111539_10161771 Ga0111539_101617712 131
102 3300009094 Ga0111539_11746678 Ga0111539_117466782 131
103 3300009098 Ga0105245_10064028 Ga0105245_100640284 131
104 3300009098 Ga0105245_10101215 Ga0105245_101012154 131
105 3300009101 Ga0105247_10114069 Ga0105247_101140692 131
106 3300009174 Ga0105241_10528860 Ga0105241_105288602 131
107 3300009176 Ga0105242_10021774 Ga0105242_100217746 131
108 3300009177 Ga0105248_10002726 Ga0105248_1000272610 131
109 3300009177 Ga0105248_10009185 Ga0105248_1000918510 131
110 3300009177 Ga0105248_10035120 Ga0105248_100351205 131
111 3300009177 Ga0105248_10248590 Ga0105248_102485902 131
112 3300009177 Ga0105248_10306363 Ga0105248_103063633 131
113 3300009553 Ga0105249_10000996 Ga0105249_1000099642 131
114 3300011119 Ga0105246_11201141 Ga0105246_112011411 131
115 3300013100 Ga0157373_10984789 Ga0157373_109847892 131
116 3300013104 Ga0157370_10722549 Ga0157370_107225492 131
117 3300013296 Ga0157374_10039898 Ga0157374_100398984 131
118 3300013296 Ga0157374_10071555 Ga0157374_100715555 131
119 3300013296 Ga0157374_10097449 Ga0157374_100974495 131
120 3300013296 Ga0157374_12185159 Ga0157374_121851592 131
121 3300013297 Ga0157378_10044479 Ga0157378_100444796 131
122 3300013297 Ga0157378_10456278 Ga0157378_104562782 131
123 3300013297 Ga0157378_10753931 Ga0157378_107539312 131
124 3300013306 Ga0163162_10021806 Ga0163162_100218064 131
125 3300013306 Ga0163162_10333308 Ga0163162_103333084 131
126 3300013308 Ga0157375_10000906 Ga0157375_1000090645 131
127 3300013308 Ga0157375_10011174 Ga0157375_100111748 131
128 3300013308 Ga0157375_10014952 Ga0157375_100149525 131
129 3300013308 Ga0157375_10078860 Ga0157375_100788603 131
130 3300013308 Ga0157375_10110006 Ga0157375_101100063 131
131 3300014325 Ga0163163_10446369 Ga0163163_104463692 131
132 3300014745 Ga0157377_10705650 Ga0157377_107056501 131
133 3300014745 Ga0157377_10910798 Ga0157377_109107981 131
134 3300014968 Ga0157379_10015165 Ga0157379_1001516510 131
135 3300014968 Ga0157379_10320192 Ga0157379_103201922 131
136 3300014969 Ga0157376_10023563 Ga0157376_100235639 131
137 3300014969 Ga0157376_10238144 Ga0157376_102381443 131
138 3300014969 Ga0157376_10433366 Ga0157376_104333662 131
139 3300014969 Ga0157376_10683940 Ga0157376_106839402 131
140 3300017792 Ga0163161_10000551 Ga0163161_1000055154 131
141 3300025315 Ga0207697_10022886 Ga0207697_100228862 131
142 3300025321 Ga0207656_10009223 Ga0207656_100092233 131
143 3300025321 Ga0207656_10088016 Ga0207656_100880162 131
144 3300025321 Ga0207656_10104265 Ga0207656_101042652 131
145 3300025893 Ga0207682_10005457 Ga0207682_100054577 131
146 3300025893 Ga0207682_10066332 Ga0207682_100663323 131
147 3300025893 Ga0207682_10301814 Ga0207682_103018142 131
148 3300025899 Ga0207642_10289984 Ga0207642_102899841 131
149 3300025901 Ga0207688_10060480 Ga0207688_100604803 131
150 3300025903 Ga0207680_10012679 Ga0207680_100126798 131
151 3300025903 Ga0207680_10200653 Ga0207680_102006533 131
152 3300025907 Ga0207645_10000390 Ga0207645_1000039037 131
153 3300025907 Ga0207645_11232588 Ga0207645_112325881 131
154 3300025909 Ga0207705_10515301 Ga0207705_105153012 131
155 3300025909 Ga0207705_10593053 Ga0207705_105930532 131
156 3300025918 Ga0207662_10076117 Ga0207662_100761173 131
157 3300025919 Ga0207657_10490370 Ga0207657_104903702 131
158 3300025923 Ga0207681_10001344 Ga0207681_100013446 131
159 3300025925 Ga0207650_10500838 Ga0207650_105008382 131
160 3300025926 Ga0207659_10007942 Ga0207659_100079426 131
161 3300025926 Ga0207659_10332196 Ga0207659_103321963 131
162 3300025926 Ga0207659_10666371 Ga0207659_106663711 131
163 3300025927 Ga0207687_10091667 Ga0207687_100916675 131
164 3300025927 Ga0207687_10944131 Ga0207687_109441311 131
165 3300025931 Ga0207644_10205703 Ga0207644_102057032 131
166 3300025931 Ga0207644_11189213 Ga0207644_111892131 131
167 3300025933 Ga0207706_10006984 Ga0207706_1000698416 131
168 3300025933 Ga0207706_10011456 Ga0207706_100114567 131
169 3300025933 Ga0207706_10314834 Ga0207706_103148341 131
170 3300025933 Ga0207706_11149249 Ga0207706_111492491 131
171 3300025933 Ga0207706_11363336 Ga0207706_113633361 131
172 3300025934 Ga0207686_10075242 Ga0207686_100752422 131
173 3300025937 Ga0207669_10005373 Ga0207669_100053736 131
174 3300025938 Ga0207704_10002919 Ga0207704_100029193 131
175 3300025938 Ga0207704_10683406 Ga0207704_106834062 131
176 3300025938 Ga0207704_10783493 Ga0207704_107834932 131
177 3300025938 Ga0207704_11026684 Ga0207704_110266842 131
178 3300025940 Ga0207691_10001079 Ga0207691_1000107912 131
179 3300025940 Ga0207691_10004663 Ga0207691_1000466319 131
180 3300025940 Ga0207691_10022820 Ga0207691_100228206 131
181 3300025940 Ga0207691_10068524 Ga0207691_100685242 131
182 3300025941 Ga0207711_10040861 Ga0207711_100408617 131
183 3300025941 Ga0207711_10070439 Ga0207711_100704396 131
184 3300025941 Ga0207711_10668034 Ga0207711_106680342 131
185 3300025942 Ga0207689_10003499 Ga0207689_100034999 131
186 3300025942 Ga0207689_10008976 Ga0207689_100089768 131
187 3300025960 Ga0207651_10585834 Ga0207651_105858342 131
188 3300025960 Ga0207651_10612114 Ga0207651_106121142 131
189 3300025960 Ga0207651_11335035 Ga0207651_113350351 131
190 3300025961 Ga0207712_10000987 Ga0207712_1000098729 131
191 3300025972 Ga0207668_10039113 Ga0207668_100391132 131
192 3300025986 Ga0207658_10051803 Ga0207658_100518036 131
193 3300025986 Ga0207658_10483841 Ga0207658_104838413 131
194 3300025986 Ga0207658_10706182 Ga0207658_107061822 131
195 3300026023 Ga0207677_10089960 Ga0207677_100899602 131
196 3300026035 Ga0207703_10004869 Ga0207703_100048698 131
197 3300026035 Ga0207703_10112533 Ga0207703_101125334 131
198 3300026035 Ga0207703_11036371 Ga0207703_110363712 131
199 3300026041 Ga0207639_10077512 Ga0207639_100775123 131
200 3300026041 Ga0207639_10110496 Ga0207639_101104962 131
201 3300026067 Ga0207678_10034429 Ga0207678_100344294 131
202 3300026067 Ga0207678_10134857 Ga0207678_101348572 131
203 3300026067 Ga0207678_10379230 Ga0207678_103792303 131
204 3300026088 Ga0207641_10012611 Ga0207641_100126115 131
205 3300026088 Ga0207641_10020591 Ga0207641_100205916 131
206 3300026088 Ga0207641_10258582 Ga0207641_102585822 131
207 3300026088 Ga0207641_11084224 Ga0207641_110842241 131
208 3300026089 Ga0207648_10001878 Ga0207648_1000187828 131
209 3300026089 Ga0207648_10188349 Ga0207648_101883492 131
210 3300026095 Ga0207676_10027601 Ga0207676_100276012 131
211 3300026095 Ga0207676_10207647 Ga0207676_102076472 131
212 3300026116 Ga0207674_10903936 Ga0207674_109039362 131
213 3300026118 Ga0207675_100002444 Ga0207675_10000244420 131
214 3300026118 Ga0207675_100085973 Ga0207675_1000859732 131
215 3300026121 Ga0207683_10070502 Ga0207683_100705025 131
216 3300026121 Ga0207683_10113083 Ga0207683_101130834 131
217 3300026121 Ga0207683_10210135 Ga0207683_102101352 131
218 3300026142 Ga0207698_10070944 Ga0207698_100709444 131
219 3300026142 Ga0207698_10225218 Ga0207698_102252183 131
220 3300026142 Ga0207698_10424861 Ga0207698_104248611 131
221 3300026142 Ga0207698_10684141 Ga0207698_106841411 131
222 3300026142 Ga0207698_11350009 Ga0207698_113500092 131
223 3300027907 Ga0207428_10004837 Ga0207428_1000483711 131
224 3300027907 Ga0207428_10909848 Ga0207428_109098481 131
225 3300028379 Ga0268266_10170360 Ga0268266_101703602 131
226 3300028379 Ga0268266_10530094 Ga0268266_105300943 131
227 3300028380 Ga0268265_10006346 Ga0268265_1000634610 131
228 3300028380 Ga0268265_10472297 Ga0268265_104722972 131
229 3300031731 Ga0307405_11381095 Ga0307405_113810951 131
230 3300032002 Ga0307416_100248052 Ga0307416_1002480522 131
231 3300032002 Ga0307416_101413390 Ga0307416_1014133902 131
232 3300035119 Ga0373956_0189326 Ga0373956_0189326_551_949 131
233 3300035120 Ga0373957_0030166 Ga0373957_0030166_432_830 131
234 3300035170 Ga0373943_0014995 Ga0373943_0014995_542_940 131
235 3300035410 Ga0373924_0308932 Ga0373924_0308932_124_522 131
236 3300035692 Ga0373935_0105727 Ga0373935_0105727_1380_1778 131
237 3300036401 Ga0373937_0026757 Ga0373937_0026757_2594_2992 131
238 3300037068 Ga0373925_0125421 Ga0373925_0125421_1260_1658 131
239 3300041501 Ga0451845_0583611 Ga0451845_0583611_38_436 131
240 3300041505 Ga0451849_0263988 Ga0451849_0263988_27_425 131
241 3300042006 Ga0439432_251163 Ga0439432_251163_63_461 131
242 3300042007 Ga0439449_0018909 Ga0439449_0018909_1015_1413 131
243 3300042993 Ga0439440_0015703 Ga0439440_0015703_1102_1500 131
244 3300046455 Ga0495603_0240318 Ga0495603_0240318_242_640 131
245 3300046459 Ga0495629_0064096 Ga0495629_0064096_774_1172 131
246 3300046472 Ga0495580_0227567 Ga0495580_0227567_138_536 131
247 3300046475 Ga0495639_0333095 Ga0495639_0333095_12_410 131
248 3300046514 Ga0495618_0839714 Ga0495618_0839714_67_465 131
249 3300046516 Ga0495628_0556697 Ga0495628_0556697_146_544 131
250 3300046533 Ga0495640_0153065 Ga0495640_0153065_274_672 131
251 3300046537 Ga0495598_0143658 Ga0495598_0143658_285_683 131
252 3300046539 Ga0495621_0147581 Ga0495621_0147581_104_502 131
253 3300046543 Ga0495645_0102491 Ga0495645_0102491_1320_1718 131
254 3300046543 Ga0495645_0135060 Ga0495645_0135060_886_1284 131
255 3300046559 Ga0495667_0224393 Ga0495667_0224393_667_1065 131
256 3300046663 Ga0495635_0060178 Ga0495635_0060178_2061_2459 131
257 3300046680 Ga0495646_0388380 Ga0495646_0388380_107_505 131
258 3300046681 Ga0495647_0165816 Ga0495647_0165816_115_513 131
259 3300046681 Ga0495647_0323139 Ga0495647_0323139_166_564 131
260 3300046689 Ga0495613_0634233 Ga0495613_0634233_43_441 131
261 3300046691 Ga0495670_0582164 Ga0495670_0582164_78_476 131
262 3300046691 Ga0495670_0786831 Ga0495670_0786831_72_470 131
263 3300047319 Ga0495674_0076834 Ga0495674_0076834_1102_1500 131
264 3300047321 Ga0495676_0977703 Ga0495676_0977703_79_477 131
265 3300048903 Ga0496100_0969887 Ga0496100_0969887_31_429 131
266 3300048911 Ga0496108_0413079 Ga0496108_0413079_287_685 131
267 3300048913 Ga0496110_0579502 Ga0496110_0579502_488_886 131
268 3300048913 Ga0496110_1076526 Ga0496110_1076526_186_584 131
269 3300049569 Ga0501032_0014604 Ga0501032_0014604_2086_2484 131
270 3300049571 Ga0501034_0042621 Ga0501034_0042621_3378_3776 131
271 3300049571 Ga0501034_0131895 Ga0501034_0131895_638_1036 131
272 3300049572 Ga0501036_0027474 Ga0501036_0027474_3168_3566 131
273 3300049573 Ga0501037_0003619 Ga0501037_0003619_2153_2551 131
274 3300049574 Ga0501038_0015410 Ga0501038_0015410_3174_3572 131
275 3300049574 Ga0501038_0830352 Ga0501038_0830352_188_586 131
276 3300049575 Ga0501039_0186249 Ga0501039_0186249_535_933 131
277 3300049579 Ga0501043_0056335 Ga0501043_0056335_602_1000 131
278 3300049581 Ga0501047_0093072 Ga0501047_0093072_488_886 131
279 3300049582 Ga0501048_0844271 Ga0501048_0844271_106_504 131
280 3300049586 Ga0501070_0018785 Ga0501070_0018785_3077_3475 131
281 3300049587 Ga0501071_0214011 Ga0501071_0214011_570_968 131
282 3300049589 Ga0501073_0023530 Ga0501073_0023530_1849_2247 131
283 3300049742 Ga0501080_0022413 Ga0501080_0022413_2601_2999 131
284 3300049822 Ga0501035_0023054 Ga0501035_0023054_3145_3543 131
285 3300049823 Ga0501044_0009987 Ga0501044_0009987_2839_3237 131
286 3300050508 nmdc:mga09592_413021_c1 nmdc:mga09592_413021_c1_265_663 131
287 3300050511 nmdc:mga08y16_1376385_c1 nmdc:mga08y16_1376385_c1_153_551 131
288 3300050511 nmdc:mga08y16_7903_c1 nmdc:mga08y16_7903_c1_2879_3277 131
289 3300050511 nmdc:mga08y16_96629_c1 nmdc:mga08y16_96629_c1_617_1015 131
290 3300053077 Ga0495601_0074361 Ga0495601_0074361_1045_1443 131
291 3300053078 Ga0495612_0255838 Ga0495612_0255838_23_421 131
292 3300053085 Ga0495619_0077480 Ga0495619_0077480_806_1204 131
293 3300053085 Ga0495619_0077631 Ga0495619_0077631_59_457 131
294 3300005290 Ga0065712_10435425 Ga0065712_104354252 132
295 3300005293 Ga0065715_10588095 Ga0065715_105880952 132
296 3300005330 Ga0070690_100598771 Ga0070690_1005987711 132
297 3300005330 Ga0070690_100916864 Ga0070690_1009168641 132
298 3300005335 Ga0070666_10685354 Ga0070666_106853542 132
299 3300005336 Ga0070680_100571183 Ga0070680_1005711832 132
300 3300005338 Ga0068868_100235195 Ga0068868_1002351952 132
301 3300005340 Ga0070689_100174206 Ga0070689_1001742063 132
302 3300005345 Ga0070692_10295448 Ga0070692_102954481 132
303 3300005355 Ga0070671_100797966 Ga0070671_1007979661 132
304 3300005365 Ga0070688_100890267 Ga0070688_1008902672 132
305 3300005440 Ga0070705_100000798 Ga0070705_10000079810 132
306 3300005444 Ga0070694_100024699 Ga0070694_1000246993 132
307 3300005445 Ga0070708_100555240 Ga0070708_1005552401 132
308 3300005456 Ga0070678_100217580 Ga0070678_1002175803 132
309 3300005467 Ga0070706_100185461 Ga0070706_1001854612 132
310 3300005518 Ga0070699_100017291 Ga0070699_1000172913 132
311 3300005535 Ga0070684_101951525 Ga0070684_1019515251 132
312 3300005536 Ga0070697_100003801 Ga0070697_10000380115 132
313 3300005539 Ga0068853_100041700 Ga0068853_1000417004 132
314 3300005544 Ga0070686_100439749 Ga0070686_1004397492 132
315 3300005545 Ga0070695_100000996 Ga0070695_1000009963 132
316 3300005546 Ga0070696_100001647 Ga0070696_10000164712 132
317 3300005547 Ga0070693_100016298 Ga0070693_1000162984 132
318 3300005547 Ga0070693_100260681 Ga0070693_1002606812 132
319 3300005547 Ga0070693_100907363 Ga0070693_1009073631 132
320 3300005548 Ga0070665_101393414 Ga0070665_1013934141 132
321 3300005549 Ga0070704_101122368 Ga0070704_1011223682 132
322 3300005577 Ga0068857_101433672 Ga0068857_1014336721 132
323 3300005614 Ga0068856_100039435 Ga0068856_1000394354 132
324 3300005616 Ga0068852_100637838 Ga0068852_1006378381 132
325 3300005617 Ga0068859_100881498 Ga0068859_1008814982 132
326 3300006173 Ga0070716_100481380 Ga0070716_1004813802 132
327 3300006195 Ga0075366_10257478 Ga0075366_102574782 132
328 3300006237 Ga0097621_100121736 Ga0097621_1001217363 132
329 3300006237 Ga0097621_100193053 Ga0097621_1001930532 132
330 3300006237 Ga0097621_100263563 Ga0097621_1002635632 132
331 3300006358 Ga0068871_100004228 Ga0068871_10000422813 132
332 3300006358 Ga0068871_100112979 Ga0068871_1001129792 132
333 3300006358 Ga0068871_100155365 Ga0068871_1001553653 132
334 3300006358 Ga0068871_100190726 Ga0068871_1001907263 132
335 3300006880 Ga0075429_100550545 Ga0075429_1005505452 132
336 3300006931 Ga0097620_100881266 Ga0097620_1008812662 132
337 3300009093 Ga0105240_10773243 Ga0105240_107732432 132
338 3300009094 Ga0111539_10025764 Ga0111539_100257644 132
339 3300009147 Ga0114129_11613901 Ga0114129_116139012 132
340 3300009148 Ga0105243_10332927 Ga0105243_103329273 132
341 3300009148 Ga0105243_11888815 Ga0105243_118888152 132
342 3300009176 Ga0105242_10338107 Ga0105242_103381072 132
343 3300009176 Ga0105242_10433213 Ga0105242_104332132 132
344 3300009176 Ga0105242_10821518 Ga0105242_108215181 132
345 3300009177 Ga0105248_10034622 Ga0105248_100346228 132
346 3300012505 Ga0157339_1014522 Ga0157339_10145222 132
347 3300013104 Ga0157370_10200536 Ga0157370_102005361 132
348 3300013296 Ga0157374_10300187 Ga0157374_103001873 132
349 3300013297 Ga0157378_10010904 Ga0157378_1001090414 132
350 3300013306 Ga0163162_10034779 Ga0163162_100347793 132
351 3300013306 Ga0163162_10255205 Ga0163162_102552052 132
352 3300013306 Ga0163162_10342380 Ga0163162_103423803 132
353 3300014326 Ga0157380_10955027 Ga0157380_109550272 132
354 3300014969 Ga0157376_10001379 Ga0157376_1000137916 132
355 3300014969 Ga0157376_10397336 Ga0157376_103973362 132
356 3300025911 Ga0207654_10190399 Ga0207654_101903993 132
357 3300025913 Ga0207695_10470697 Ga0207695_104706972 132
358 3300025924 Ga0207694_10888086 Ga0207694_108880861 132
359 3300025925 Ga0207650_10612924 Ga0207650_106129242 132
360 3300025935 Ga0207709_10753018 Ga0207709_107530182 132
361 3300025935 Ga0207709_11542291 Ga0207709_115422912 132
362 3300025936 Ga0207670_10226906 Ga0207670_102269064 132
363 3300025938 Ga0207704_11172203 Ga0207704_111722031 132
364 3300025939 Ga0207665_10143237 Ga0207665_101432371 132
365 3300025941 Ga0207711_10148022 Ga0207711_101480222 132
366 3300026035 Ga0207703_10320361 Ga0207703_103203611 132
367 3300026041 Ga0207639_10067510 Ga0207639_100675103 132
368 3300026078 Ga0207702_10045319 Ga0207702_100453192 132
369 3300026121 Ga0207683_10104429 Ga0207683_101044293 132
370 3300026142 Ga0207698_11372457 Ga0207698_113724571 132
371 3300027360 Ga0209969_1012299 Ga0209969_10122992 132
372 3300027462 Ga0210000_1018269 Ga0210000_10182691 132
373 3300027471 Ga0209995_1045003 Ga0209995_10450032 132
374 3300027471 Ga0209995_1047567 Ga0209995_10475672 132
375 3300027526 Ga0209968_1007801 Ga0209968_10078012 132
376 3300027552 Ga0209982_1010229 Ga0209982_10102292 132
377 3300027552 Ga0209982_1046664 Ga0209982_10466642 132
378 3300027552 Ga0209982_1071300 Ga0209982_10713001 132
379 3300027617 Ga0210002_1046029 Ga0210002_10460291 132
380 3300027876 Ga0209974_10006598 Ga0209974_100065983 132
381 3300027876 Ga0209974_10019570 Ga0209974_100195702 132
382 3300031730 Ga0307516_10001281 Ga0307516_1000128113 132
383 3300031731 Ga0307405_10303821 Ga0307405_103038212 132
384 3300031731 Ga0307405_10786723 Ga0307405_107867232 132
385 3300031852 Ga0307410_10742188 Ga0307410_107421882 132
386 3300031911 Ga0307412_10173074 Ga0307412_101730742 132
387 3300032002 Ga0307416_100334882 Ga0307416_1003348822 132
388 3300032002 Ga0307416_100468967 Ga0307416_1004689672 132
389 3300032005 Ga0307411_11787608 Ga0307411_117876081 132
390 3300036401 Ga0373937_1141217 Ga0373937_1141217_96_497 132
391 3300041453 Ga0451797_1301464 Ga0451797_1301464_167_568 132
392 3300041512 Ga0451853_0190596 Ga0451853_0190596_90_491 132
393 3300042010 Ga0439452_053466 Ga0439452_053466_53_454 132
394 3300044673 Ga0453683_0630970 Ga0453683_0630970_171_572 132
395 3300048917 Ga0496114_0003316 Ga0496114_0003316_8052_8531 132
396 3300048929 Ga0496126_0069754 Ga0496126_0069754_1912_2391 132
397 3300049569 Ga0501032_0654921 Ga0501032_0654921_176_577 132
398 3300049570 Ga0501033_0025126 Ga0501033_0025126_3152_3553 132
399 3300049571 Ga0501034_0584224 Ga0501034_0584224_22_423 132
400 3300049572 Ga0501036_0011300 Ga0501036_0011300_3410_3811 132
401 3300049573 Ga0501037_0059633 Ga0501037_0059633_786_1187 132
402 3300049574 Ga0501038_0007243 Ga0501038_0007243_3248_3649 132
403 3300049575 Ga0501039_0030495 Ga0501039_0030495_2810_3211 132
404 3300049576 Ga0501040_0022732 Ga0501040_0022732_113_514 132
405 3300049576 Ga0501040_0244800 Ga0501040_0244800_292_693 132
406 3300049577 Ga0501041_0004553 Ga0501041_0004553_7511_7912 132
407 3300049578 Ga0501042_0019621 Ga0501042_0019621_416_817 132
408 3300049578 Ga0501042_1238778 Ga0501042_1238778_124_525 132
409 3300049579 Ga0501043_0014100 Ga0501043_0014100_2573_2974 132
410 3300049580 Ga0501046_0156738 Ga0501046_0156738_451_852 132
411 3300049582 Ga0501048_0320860 Ga0501048_0320860_681_1082 132
412 3300049582 Ga0501048_1082673 Ga0501048_1082673_76_477 132
413 3300049584 Ga0501068_0065919 Ga0501068_0065919_601_1002 132
414 3300049587 Ga0501071_0015015 Ga0501071_0015015_1376_1777 132
415 3300049588 Ga0501072_0002752 Ga0501072_0002752_4098_4499 132
416 3300049590 Ga0501074_0407397 Ga0501074_0407397_54_455 132
417 3300049591 Ga0501075_0001645 Ga0501075_0001645_1829_2230 132
418 3300049591 Ga0501075_0556580 Ga0501075_0556580_83_484 132
419 3300049592 Ga0501076_0003431 Ga0501076_0003431_8361_8762 132
420 3300049593 Ga0501077_0009563 Ga0501077_0009563_3381_3782 132
421 3300049668 Ga0501233_109357 Ga0501233_109357_89_490 132
422 3300049705 Ga0501225_0169741 Ga0501225_0169741_132_533 132
423 3300049741 Ga0501079_0001743 Ga0501079_0001743_10673_11074 132
424 3300049742 Ga0501080_0047370 Ga0501080_0047370_2811_3212 132
425 3300049743 Ga0501081_0006975 Ga0501081_0006975_4682_5083 132
426 3300049743 Ga0501081_0053444 Ga0501081_0053444_1258_1659 132
427 3300049744 Ga0501083_0010526 Ga0501083_0010526_1708_2109 132
428 3300049822 Ga0501035_0079819 Ga0501035_0079819_2253_2654 132
429 3300049824 Ga0501045_0056228 Ga0501045_0056228_1014_1415 132
430 3300049824 Ga0501045_1027204 Ga0501045_1027204_80_481 132
431 3300050495 nmdc:mga04h51_320469_c1 nmdc:mga04h51_320469_c1_27_428 132
432 3300050508 nmdc:mga09592_168906_c1 nmdc:mga09592_168906_c1_171_572 132
433 3300050510 nmdc:mga06r32_930700_c1 nmdc:mga06r32_930700_c1_52_453 132
434 3300050511 nmdc:mga08y16_131050_c1 nmdc:mga08y16_131050_c1_542_943 132
435 3300050513 nmdc:mga0rr50_1328064_c1 nmdc:mga0rr50_1328064_c1_18_419 132
436 3300053158 Ga0500627_0311741 Ga0500627_0311741_159_560 132
437 3300054114 Ga0501084_0007391 Ga0501084_0007391_3971_4372 132
438 3300061734 Ga0530510_0003596 Ga0530510_0003596_1708_2109 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

52

143

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8703 5 111
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8481 5 111
4aez-assembly2.cif.gz_D crystal structure of mitotic checkpoint complex 0.7028 54 83
5xog-assembly1.cif.gz_M rna polymerase ii elongation complex bound with spt5 kow5 and elf1 0.6153 56 88
3j9w-assembly1.cif.gz_BR cryo-em structure of the bacillus subtilis mifm-stalled ribosome complex 0.6063 55 87
ID Description Score Start End Superfamily
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9525 6 122 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9194 5 118 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9006 6 122 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8657 5 113 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8512 5 113 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A2N7TK62-F1-model_v4 Aldehyde-activating protein 0.9858 2 132 GO:0016846
GO:0046872
AF-A0A7X9YDI4-F1-model_v4 deleted 0.9805 2 132
AF-A0A0K8P5Y1-F1-model_v4 CENP-V/GFA domain-containing protein 0.9736 14 132 GO:0016846
GO:0046872
AF-A0A2N7TK62-F1-model_v4 Aldehyde-activating protein 0.9711 2 132 GO:0016846
GO:0046872
AF-A0A7X9YDI4-F1-model_v4 deleted 0.9659 2 132

Feature Viewer

pLDDT pTM Quality
93.91 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map