F444082

General Info

Members Datasets Scaffolds Average Seq Length
438 288 877 148

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0590467|Ga0501043_0590467_187_699
Length 170
Sequence LDFGPFPDTLVSAMSKPTLRETGLVDVRFGRNVTVVQPANLYGCAIGDDCFIGPFVEIQRDVVIGARTRIQSHSFICELVRIGEDCMIAHGVMFTNDLFKDGGPARGNRSAWKSTQVGNRVSIGSNATLLPVRICDDVVIGAGSVVTKDITQPGVYAGNPARLLRTLPGK

Samples

Sample ID Description Type Environment
1 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
163 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
164 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
165 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
166 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
167 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
253 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
254 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
262 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
263 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
264 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
269 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
270 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
271 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
272 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
273 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
274 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
275 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
276 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
277 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
278 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
279 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
280 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
281 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
282 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
283 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
284 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
285 8005275841 Rhizobium sp. N4311 Isolate Nodule
286 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
287 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
288 8018176218 Rhizobium sp. N122 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.21
Metatranscriptomes 0
Isolates 4.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.96
Nodule 3.65
Rhizoplane 2.28
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 6.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501043_0590467 3300049579 Bacteria 821
2 JGI25159J45721_1000044 3300002987 Bacteria 60564
3 JGI25153J46596_10000744 3300003215 Bacteria 19896
4 rootL2_10120629 3300003322 Bacteria 1345
5 rootH1_10007743 3300003316 Bacteria 6031
6 rootH1_10007743 3300003323 Bacteria 19767
7 JGI25160J50197_1000206 3300003354 Bacteria 49083
8 JGI25161J50226_1000097 3300003374 Bacteria 72031
9 Ga0055524_1006179 3300003775 Bacteria 5230
10 Ga0055530_10003364 3300003791 Bacteria 9156
11 Ga0055543_1000056 3300004625 Bacteria 103704
12 Ga0065165_1000719 3300005262 Bacteria 46606
13 Ga0065704_10098741 3300005289 Bacteria 2341
14 Ga0065715_10003750 3300005293 Bacteria 6327
15 Ga0070676_10406023 3300005328 Bacteria 949
16 Ga0070683_100275566 3300005329 Bacteria 1600
17 Ga0070683_100512247 3300005329 Bacteria 1146
18 Ga0070670_100206532 3300005331 Bacteria 1707
19 Ga0070666_10385635 3300005335 Unclassified 1006
20 Ga0070666_10534151 3300005335 Bacteria 852
21 Ga0070680_100215403 3300005336 Bacteria 1621
22 Ga0068868_100172436 3300005338 Unclassified 1791
23 Ga0068868_100601143 3300005338 Bacteria 974
24 Ga0070660_100191480 3300005339 Bacteria 1657
25 Ga0070691_10184160 3300005341 Bacteria 1088
26 Ga0070687_100028037 3300005343 Unclassified 2727
27 Ga0070687_100980037 3300005343 Bacteria 611
28 Ga0070668_100250598 3300005347 Bacteria 1470
29 Ga0070675_100089511 3300005354 Bacteria 2577
30 Ga0070659_100097196 3300005366 Bacteria 2366
31 Ga0070659_101319565 3300005366 Bacteria 640
32 Ga0070667_100071921 3300005367 Bacteria 2946
33 Ga0070709_10264137 3300005434 Bacteria 1245
34 Ga0070713_100401479 3300005436 Bacteria 1280
35 Ga0070663_100449891 3300005455 Bacteria 1061
36 Ga0070678_100702484 3300005456 Bacteria 911
37 Ga0070662_100050620 3300005457 Bacteria 2996
38 Ga0070681_10093572 3300005458 Bacteria 2954
39 Ga0070681_10114783 3300005458 Bacteria 2631
40 Ga0070681_10222351 3300005458 Bacteria 1803
41 Ga0070706_100062307 3300005467 Bacteria 3446
42 Ga0070707_100617917 3300005468 Bacteria 1046
43 Ga0070699_100098442 3300005518 Bacteria 2563
44 Ga0070679_100405791 3300005530 Bacteria 1308
45 Ga0070679_100586175 3300005530 Bacteria 1058
46 Ga0070684_100323108 3300005535 Bacteria 1417
47 Ga0070684_100518682 3300005535 Bacteria 1104
48 Ga0070697_100000134 3300005536 Bacteria 59796
49 Ga0070697_100153736 3300005536 Bacteria 1941
50 Ga0068853_100128145 3300005539 Bacteria 2269
51 Ga0068853_101881990 3300005539 Bacteria 580
52 Ga0070696_100076931 3300005546 Bacteria 2357
53 Ga0068855_100215091 3300005563 Bacteria 2158
54 Ga0068855_100283789 3300005563 Bacteria 1838
55 Ga0068855_100593209 3300005563 Bacteria 1195
56 Ga0070664_100369999 3300005564 Bacteria 1306
57 Ga0070664_100449783 3300005564 Bacteria 1182
58 Ga0068856_100122657 3300005614 Bacteria 2601
59 Ga0068856_100784016 3300005614 Bacteria 973
60 Ga0068856_102098395 3300005614 Bacteria 575
61 Ga0068859_100092134 3300005617 Bacteria 3082
62 Ga0068859_100284992 3300005617 Bacteria 1745
63 Ga0068859_101346876 3300005617 Bacteria 787
64 Ga0068864_100155175 3300005618 Bacteria 2077
65 Ga0068866_10189418 3300005718 Bacteria 1221
66 Ga0068866_10657254 3300005718 Bacteria 714
67 Ga0068861_100395959 3300005719 Bacteria 1224
68 Ga0068863_100011283 3300005841 Bacteria 8655
69 Ga0068863_100480615 3300005841 Bacteria 1222
70 Ga0068860_100000409 3300005843 Bacteria 55861
71 Ga0068860_100020727 3300005843 Bacteria 6368
72 Ga0075364_10346231 3300006051 Bacteria 1013
73 Ga0070712_100786730 3300006175 Bacteria 816
74 Ga0075369_10326383 3300006186 Unclassified 718
75 Ga0097621_100361991 3300006237 Unclassified 1292
76 Ga0097621_100672079 3300006237 Bacteria 952
77 Ga0075428_100068525 3300006844 Bacteria 3881
78 Ga0075428_100444189 3300006844 Bacteria 1389
79 Ga0075430_100002156 3300006846 Bacteria 16291
80 Ga0075430_100069277 3300006846 Bacteria 2959
81 Ga0075431_100003788 3300006847 Bacteria 14700
82 Ga0075431_100088376 3300006847 Bacteria 3198
83 Ga0075431_100152027 3300006847 Bacteria 2383
84 Ga0075434_100635935 3300006871 Unclassified 1085
85 Ga0075434_100943369 3300006871 Bacteria 877
86 Ga0075429_100027917 3300006880 Bacteria 4899
87 Ga0075429_100204718 3300006880 Bacteria 1729
88 Ga0097620_100092135 3300006931 Bacteria 3082
89 Ga0097620_100284978 3300006931 Bacteria 1745
90 Ga0097620_101346519 3300006931 Bacteria 787
91 Ga0105240_10000387 3300009093 Bacteria 82855
92 Ga0105240_10008582 3300009093 Bacteria 14603
93 Ga0105245_10578939 3300009098 Bacteria 1147
94 Ga0105245_10751215 3300009098 Bacteria 1011
95 Ga0105247_10049227 3300009101 Bacteria 2591
96 Ga0105247_10188226 3300009101 Bacteria 1381
97 Ga0105247_11200303 3300009101 Bacteria 604
98 Ga0114129_10056913 3300009147 Bacteria 5474
99 Ga0105243_11080613 3300009148 Bacteria 809
100 Ga0105248_10228063 3300009177 Bacteria 2097
101 Ga0105248_11654929 3300009177 Bacteria 725
102 Ga0105237_10000577 3300009545 Bacteria 51264
103 Ga0105237_10033764 3300009545 Bacteria 5183
104 Ga0105237_10093286 3300009545 Bacteria 3000
105 Ga0105237_10148544 3300009545 Bacteria 2339
106 Ga0105237_10218642 3300009545 Bacteria 1905
107 Ga0105237_11441750 3300009545 Bacteria 695
108 Ga0105237_11733418 3300009545 Bacteria 632
109 Ga0105238_10041626 3300009551 Bacteria 4653
110 Ga0105238_10249716 3300009551 Bacteria 1752
111 Ga0105238_10363295 3300009551 Bacteria 1437
112 Ga0105249_10483939 3300009553 Bacteria 1281
113 Ga0105249_10670202 3300009553 Bacteria 1096
114 Ga0105249_11193000 3300009553 Bacteria 832
115 Ga0105239_10006826 3300010375 Bacteria 13167
116 Ga0105239_10106769 3300010375 Bacteria 3102
117 Ga0105239_10192513 3300010375 Bacteria 2283
118 Ga0105239_10844787 3300010375 Bacteria 1050
119 Ga0105239_11529996 3300010375 Bacteria 771
120 Ga0105246_10272565 3300011119 Bacteria 1353
121 Ga0105246_10963522 3300011119 Bacteria 770
122 Ga0105246_11567946 3300011119 Unclassified 621
123 Ga0157371_10000970 3300013102 Bacteria 31856
124 Ga0157370_10005587 3300013104 Bacteria 14084
125 Ga0157369_10995326 3300013105 Bacteria 858
126 Ga0157374_10248001 3300013296 Bacteria 1752
127 Ga0157374_10939559 3300013296 Bacteria 883
128 Ga0163162_10029156 3300013306 Bacteria 5460
129 Ga0163162_10157318 3300013306 Bacteria 2393
130 Ga0163162_10242894 3300013306 Bacteria 1932
131 Ga0163162_10558177 3300013306 Bacteria 1273
132 Ga0163162_10937889 3300013306 Bacteria 977
133 Ga0157372_10010192 3300013307 Bacteria 9980
134 Ga0157372_10040297 3300013307 Bacteria 5158
135 Ga0157372_10159637 3300013307 Bacteria 2605
136 Ga0157372_10221991 3300013307 Bacteria 2190
137 Ga0157375_11179334 3300013308 Bacteria 898
138 Ga0157375_11735739 3300013308 Unclassified 739
139 Ga0163163_10493502 3300014325 Bacteria 1286
140 Ga0157380_10310114 3300014326 Bacteria 1458
141 Ga0157376_10570137 3300014969 Bacteria 1123
142 Ga0213872_10041452 3300021361 Bacteria 2101
143 Ga0213875_10076308 3300021388 Bacteria 1564
144 Ga0209436_100008 3300025208 Bacteria 145772
145 Ga0209129_1006573 3300025258 Bacteria 3711
146 Ga0209233_1012021 3300025261 Bacteria 2525
147 Ga0209673_1005252 3300025273 Bacteria 6583
148 Ga0209130_1000019 3300025284 Bacteria 381993
149 Ga0209758_1000482 3300025297 Bacteria 65578
150 Ga0209758_1001785 3300025297 Bacteria 23762
151 Ga0209050_1000118 3300025298 Bacteria 202586
152 Ga0209256_1001370 3300025299 Bacteria 25604
153 Ga0207426_1000005 3300025302 Bacteria 1037188
154 Ga0209051_1045927 3300025303 Bacteria 1507
155 Ga0209051_1086351 3300025303 Bacteria 887
156 Ga0209257_1012202 3300025304 Bacteria 4011
157 Ga0209257_1025243 3300025304 Bacteria 2035
158 Ga0207692_10460619 3300025898 Bacteria 802
159 Ga0207710_10056563 3300025900 Bacteria 1770
160 Ga0207710_10134560 3300025900 Bacteria 1189
161 Ga0207680_10294643 3300025903 Bacteria 1130
162 Ga0207699_10199720 3300025906 Bacteria 1354
163 Ga0207645_10056934 3300025907 Bacteria 2496
164 Ga0207645_10080974 3300025907 Bacteria 2081
165 Ga0207684_10533340 3300025910 Unclassified 1005
166 Ga0207707_10073098 3300025912 Bacteria 2989
167 Ga0207695_10000510 3300025913 Bacteria 82650
168 Ga0207695_10013567 3300025913 Bacteria 9705
169 Ga0207695_11262181 3300025913 Bacteria 619
170 Ga0207671_10001317 3300025914 Bacteria 29052
171 Ga0207671_10110525 3300025914 Bacteria 2091
172 Ga0207671_10110669 3300025914 Bacteria 2089
173 Ga0207671_10144338 3300025914 Bacteria 1835
174 Ga0207671_10222457 3300025914 Bacteria 1479
175 Ga0207671_10255243 3300025914 Bacteria 1379
176 Ga0207671_11271100 3300025914 Bacteria 574
177 Ga0207662_10074683 3300025918 Bacteria 2058
178 Ga0207657_10127125 3300025919 Bacteria 2093
179 Ga0207652_10255302 3300025921 Bacteria 1581
180 Ga0207652_10368999 3300025921 Bacteria 1296
181 Ga0207646_10572368 3300025922 Bacteria 1015
182 Ga0207694_10030482 3300025924 Bacteria 4120
183 Ga0207694_10589468 3300025924 Unclassified 935
184 Ga0207694_10703147 3300025924 Bacteria 852
185 Ga0207650_10049831 3300025925 Bacteria 3094
186 Ga0207659_10008810 3300025926 Bacteria 6286
187 Ga0207687_10023885 3300025927 Bacteria 4079
188 Ga0207687_10524450 3300025927 Bacteria 991
189 Ga0207700_10295647 3300025928 Bacteria 1397
190 Ga0207700_11218538 3300025928 Bacteria 672
191 Ga0207690_10155829 3300025932 Bacteria 1698
192 Ga0207706_10708169 3300025933 Bacteria 860
193 Ga0207709_10504770 3300025935 Bacteria 944
194 Ga0207661_10376876 3300025944 Bacteria 1284
195 Ga0207661_11089643 3300025944 Bacteria 735
196 Ga0207679_10207497 3300025945 Bacteria 1641
197 Ga0207667_10193710 3300025949 Bacteria 2085
198 Ga0207667_10259506 3300025949 Bacteria 1777
199 Ga0207667_10630646 3300025949 Bacteria 1079
200 Ga0207712_11040755 3300025961 Bacteria 727
201 Ga0207668_10109172 3300025972 Bacteria 2072
202 Ga0207658_10373905 3300025986 Bacteria 1246
203 Ga0207677_10233552 3300026023 Bacteria 1483
204 Ga0207677_11113454 3300026023 Unclassified 720
205 Ga0207639_10693256 3300026041 Bacteria 945
206 Ga0207678_10218039 3300026067 Bacteria 1633
207 Ga0207678_10447323 3300026067 Bacteria 1123
208 Ga0207678_10912974 3300026067 Bacteria 777
209 Ga0207702_10879601 3300026078 Unclassified 887
210 Ga0207702_10972799 3300026078 Bacteria 842
211 Ga0207641_10302133 3300026088 Bacteria 1512
212 Ga0207641_10333409 3300026088 Bacteria 1442
213 Ga0207676_11251105 3300026095 Bacteria 736
214 Ga0207676_12160954 3300026095 Unclassified 555
215 Ga0207675_100109235 3300026118 Bacteria 2609
216 Ga0207683_10041344 3300026121 Bacteria 4025
217 Ga0207698_10430595 3300026142 Bacteria 1268
218 Ga0207428_10710994 3300027907 Bacteria 718
219 Ga0268266_10053276 3300028379 Bacteria 3475
220 Ga0268265_10297667 3300028380 Bacteria 1451
221 Ga0268264_10000020 3300028381 Bacteria 483593
222 Ga0268264_10018924 3300028381 Bacteria 5630
223 Ga0268264_10157935 3300028381 Bacteria 2040
224 Ga0265338_10768052 3300028800 Unclassified 662
225 Ga0307511_10122791 3300030521 Bacteria 1598
226 Ga0265340_10055886 3300031247 Bacteria 1900
227 Ga0265340_10197525 3300031247 Bacteria 905
228 Ga0265339_10004757 3300031249 Bacteria 9201
229 Ga0265327_10000700 3300031251 Bacteria 53289
230 Ga0265327_10008846 3300031251 Bacteria 7405
231 Ga0265316_10392689 3300031344 Bacteria 1000
232 Ga0307508_10002697 3300031616 Bacteria 18577
233 Ga0307508_10050769 3300031616 Bacteria 3689
234 Ga0307516_10109930 3300031730 Bacteria 2561
235 Ga0307516_10302747 3300031730 Bacteria 1274
236 Ga0307410_10315337 3300031852 Bacteria 1239
237 Ga0307410_10733271 3300031852 Bacteria 835
238 Ga0307406_10150611 3300031901 Bacteria 1659
239 Ga0307412_10877670 3300031911 Bacteria 784
240 Ga0307414_10237059 3300032004 Bacteria 1508
241 Ga0307414_10258490 3300032004 Bacteria 1452
242 Ga0307507_10037052 3300033179 Bacteria 4969
243 Ga0373934_0428774 3300035086 Bacteria 554
244 Ga0373923_0054514 3300035111 Bacteria 1683
245 Ga0373939_0275544 3300035114 Bacteria 663
246 Ga0373954_0226881 3300035118 Bacteria 919
247 Ga0373935_0442052 3300035692 Bacteria 938
248 Ga0373927_0026021 3300035695 Bacteria 3825
249 Ga0373927_0961661 3300035695 Bacteria 563
250 Ga0373933_0209009 3300035724 Bacteria 1250
251 Ga0373937_0167001 3300036401 Bacteria 2064
252 Ga0373925_0326716 3300037068 Bacteria 1242
253 Ga0395900_0446094 3300037418 Bacteria 1251
254 Ga0395898_0281014 3300037466 Bacteria 1588
255 Ga0395898_0292757 3300037466 Bacteria 1553
256 Ga0395898_0737097 3300037466 Bacteria 927
257 Ga0395905_0304386 3300037471 Bacteria 1482
258 Ga0436364_0175813 3300037853 Bacteria 7662
259 Ga0436364_0714717 3300037853 Unclassified 2107
260 Ga0400490_44737 3300038726 Bacteria 17097
261 Ga0436365_1354402 3300039437 Bacteria 1642
262 Ga0436365_1604306 3300039437 Bacteria 1211
263 Ga0451833_0229023 3300041491 Bacteria 2597
264 Ga0451833_0840808 3300041491 Bacteria 6215
265 Ga0451833_0878483 3300041491 Bacteria 2744
266 Ga0451837_0108500 3300041494 Bacteria 1480
267 Ga0451841_0858756 3300041498 Bacteria 837
268 Ga0451849_1220883 3300041505 Bacteria 1124
269 Ga0451851_1279256 3300041507 Bacteria 943
270 Ga0451843_0546128 3300041509 Bacteria 4688
271 Ga0451853_0183479 3300041512 Bacteria 8539
272 Ga0451853_0299950 3300041512 Bacteria 8155
273 Ga0451853_3672779 3300041512 Bacteria 702
274 Ga0439457_049868 3300042014 Unclassified 939
275 Ga0466972_0000047 3300044658 Bacteria 122901
276 Ga0466966_0069528 3300044684 Bacteria 2209
277 Ga0466961_0112628 3300044693 Bacteria 1711
278 Ga0453684_0682643 3300044712 Bacteria 1118
279 Ga0453684_1100977 3300044712 Unclassified 839
280 Ga0466957_0095656 3300044842 Bacteria 1866
281 Ga0466959_0007439 3300045049 Bacteria 7683
282 Ga0451576_0035399 3300045051 Bacteria 5297
283 Ga0451576_1293796 3300045051 Bacteria 760
284 Ga0466967_0489605 3300045976 Bacteria 1206
285 Ga0466967_0511721 3300045976 Bacteria 1179
286 Ga0495629_0835838 3300046459 Bacteria 606
287 Ga0495662_0291173 3300046476 Bacteria 804
288 Ga0495616_0093175 3300046513 Bacteria 1423
289 Ga0495630_0152626 3300046517 Bacteria 1758
290 Ga0495643_0015619 3300046522 Bacteria 4481
291 Ga0495643_0147890 3300046522 Bacteria 1166
292 Ga0495643_0309863 3300046522 Bacteria 717
293 Ga0495648_0008505 3300046524 Bacteria 8067
294 Ga0495666_0185131 3300046526 Bacteria 961
295 Ga0495642_0018271 3300046528 Bacteria 2744
296 Ga0495652_0690557 3300046529 Bacteria 688
297 Ga0495622_0176958 3300046557 Bacteria 958
298 Ga0495656_0088073 3300046615 Bacteria 1415
299 Ga0495656_0125281 3300046615 Bacteria 1217
300 Ga0495634_0053809 3300046642 Bacteria 2695
301 Ga0495611_0204606 3300046648 Bacteria 920
302 Ga0495625_0194401 3300046660 Bacteria 1342
303 Ga0495635_1064523 3300046663 Bacteria 513
304 Ga0495658_0217567 3300046683 Bacteria 1195
305 Ga0495669_0261732 3300046684 Bacteria 831
306 Ga0495624_0102393 3300046690 Bacteria 1763
307 Ga0495671_0500014 3300046692 Unclassified 580
308 Ga0495649_0021712 3300046694 Bacteria 3596
309 Ga0495649_0028845 3300046694 Bacteria 3076
310 Ga0495581_0083441 3300047315 Bacteria 1851
311 Ga0495674_0057245 3300047319 Bacteria 3412
312 Ga0495672_0007947 3300047320 Bacteria 7909
313 Ga0495684_0286848 3300047471 Bacteria 1186
314 Ga0495686_0504089 3300047472 Bacteria 637
315 Ga0496101_0751151 3300048904 Bacteria 770
316 Ga0496102_0044391 3300048905 Bacteria 4034
317 Ga0496102_0064999 3300048905 Bacteria 3343
318 Ga0496103_0018310 3300048906 Bacteria 4201
319 Ga0496106_0001723 3300048909 Bacteria 16311
320 Ga0496106_1323987 3300048909 Bacteria 559
321 Ga0496107_1115896 3300048910 Bacteria 569
322 Ga0496109_0400683 3300048912 Bacteria 1296
323 Ga0496112_0324861 3300048915 Bacteria 1483
324 Ga0496113_0485009 3300048916 Bacteria 993
325 Ga0496116_0011406 3300048919 Bacteria 7361
326 Ga0496117_0016688 3300048920 Bacteria 6178
327 Ga0496118_0013737 3300048921 Bacteria 7637
328 Ga0496120_0103203 3300048923 Bacteria 1503
329 Ga0496120_0206782 3300048923 Bacteria 947
330 Ga0496121_0001584 3300048924 Bacteria 37864
331 Ga0496121_0003087 3300048924 Bacteria 24109
332 Ga0496121_0004902 3300048924 Bacteria 17563
333 Ga0496121_0111065 3300048924 Bacteria 2091
334 Ga0496121_0176191 3300048924 Bacteria 1548
335 Ga0496121_0226789 3300048924 Bacteria 1311
336 Ga0496122_0134578 3300048925 Bacteria 1561
337 Ga0496124_0008891 3300048927 Bacteria 10417
338 Ga0496124_0067575 3300048927 Bacteria 2974
339 Ga0496125_0039879 3300048928 Bacteria 4036
340 Ga0496125_0046312 3300048928 Bacteria 3649
341 Ga0496126_0005136 3300048929 Bacteria 15157
342 Ga0496126_0025679 3300048929 Bacteria 5662
343 Ga0496126_0295263 3300048929 Bacteria 1339
344 Ga0496126_0332095 3300048929 Bacteria 1247
345 Ga0496126_0513151 3300048929 Bacteria 956
346 Ga0496126_0696739 3300048929 Bacteria 790
347 Ga0501033_0001075 3300049570 Bacteria 24806
348 Ga0501034_0144985 3300049571 Bacteria 2352
349 Ga0501034_0663545 3300049571 Bacteria 944
350 Ga0501038_0935536 3300049574 Bacteria 639
351 Ga0501040_0150605 3300049576 Bacteria 1641
352 Ga0501046_0062135 3300049580 Bacteria 2919
353 Ga0501046_0195495 3300049580 Bacteria 1507
354 Ga0501047_0013983 3300049581 Bacteria 7626
355 Ga0501047_0022387 3300049581 Bacteria 6069
356 Ga0501070_0047520 3300049586 Bacteria 3566
357 Ga0501073_0025069 3300049589 Bacteria 4281
358 Ga0501073_0387319 3300049589 Bacteria 966
359 Ga0501075_0058038 3300049591 Bacteria 2915
360 Ga0501075_0326563 3300049591 Unclassified 1169
361 Ga0501076_0215328 3300049592 Bacteria 1570
362 Ga0501077_0074983 3300049593 Unclassified 2142
363 Ga0501077_0239540 3300049593 Bacteria 1153
364 Ga0501243_000169 3300049675 Bacteria 7631
365 Ga0501225_0000857 3300049705 Bacteria 9446
366 Ga0501079_0139066 3300049741 Bacteria 1891
367 Ga0501080_0033362 3300049742 Bacteria 4804
368 Ga0501080_0109716 3300049742 Bacteria 2558
369 Ga0501080_0387404 3300049742 Bacteria 1259
370 Ga0501080_0473225 3300049742 Bacteria 1121
371 Ga0501080_0675289 3300049742 Bacteria 913
372 Ga0501081_0104577 3300049743 Unclassified 2005
373 Ga0501035_0263938 3300049822 Bacteria 1459
374 Ga0501044_0000106 3300049823 Bacteria 101709
375 Ga0501044_0037681 3300049823 Bacteria 5053
376 Ga0501044_0055787 3300049823 Bacteria 4057
377 Ga0501044_0261420 3300049823 Bacteria 1669
378 Ga0501045_0215420 3300049824 Bacteria 1430
379 nmdc:mga0k408_49682_c1 3300050493 Unclassified 2428
380 nmdc:mga04h51_234906_c1 3300050495 Bacteria 730
381 nmdc:mga07m45_268022_c1 3300050496 Bacteria 993
382 nmdc:mga05p37_99563_c1 3300050507 Bacteria 3580
383 nmdc:mga09592_144384_c1 3300050508 Bacteria 2052
384 nmdc:mga09592_58055_c2 3300050508 Bacteria 1760
385 nmdc:mga09592_738854_c1 3300050508 Bacteria 836
386 nmdc:mga0qj67_11370_c1 3300050509 Bacteria 6669
387 nmdc:mga0qj67_12709_c1 3300050509 Bacteria 6350
388 nmdc:mga0qj67_4133_c1 3300050509 Bacteria 10522
389 nmdc:mga06r32_182978_c1 3300050510 Bacteria 2082
390 nmdc:mga06r32_39668_c1 3300050510 Bacteria 4469
391 nmdc:mga06r32_910_c1 3300050510 Bacteria 26293
392 nmdc:mga08y16_118761_c1 3300050511 Bacteria 2752
393 nmdc:mga0sz30_298689_c1 3300050516 Unclassified 718
394 Ga0500578_0023317 3300053086 Bacteria 3974
395 Ga0500646_0000534 3300053090 Bacteria 11120
396 Ga0500566_0098815 3300053094 Bacteria 1603
397 Ga0500556_0090495 3300053104 Bacteria 1168
398 Ga0500557_000007 3300053105 Bacteria 136781
399 Ga0500572_209464 3300053111 Bacteria 638
400 Ga0500592_038011 3300053116 Unclassified 778
401 Ga0500595_021265 3300053119 Bacteria 2319
402 Ga0500658_0210204 3300053134 Bacteria 891
403 Ga0500658_0536082 3300053134 Bacteria 528
404 Ga0500568_0000217 3300053139 Bacteria 49245
405 Ga0500590_137740 3300053148 Bacteria 1120
406 Ga0500616_0050233 3300053153 Unclassified 2203
407 Ga0500622_0000092 3300053156 Bacteria 92830
408 Ga0500622_0032206 3300053156 Bacteria 2748
409 Ga0500633_0000096 3300053160 Bacteria 12355
410 Ga0500633_0305871 3300053160 Unclassified 584
411 Ga0500637_0017173 3300053178 Bacteria 3871
412 Ga0500625_006466 3300053729 Bacteria 4995
413 Ga0500601_024969 3300053737 Bacteria 696
414 Ga0501084_0003367 3300054114 Bacteria 12948
415 Ga0501084_0743456 3300054114 Unclassified 827
416 Ga0501082_0084620 3300060353 Unclassified 2735
417 Ga0501082_1231908 3300060353 Unclassified 654
418 Ga0530510_1066525 3300061734 Unclassified 619
419 2511197000 2510917030 Bacteria 7460662
420 2585550672 2585427529 Bacteria 7395659
421 2766064964 2765235942 Bacteria 7445910
422 2838672363 2838668709 Bacteria 6671819
423 2838703895 2838701080 Bacteria 6669771
424 2842148313 2842146304 Bacteria 5957337
425 2842253379 2842250916 Bacteria 6579627
426 2842289327 2842285085 Bacteria 6011953
427 2842312592 2842311132 Bacteria 6616990
428 2842322624 2842317721 Bacteria 6793725
429 2842401955 2842395702 Bacteria 6780583
430 2842406675 2842402390 Bacteria 6681310
431 2842413829 2842409023 Bacteria 6687331
432 2842420209 2842415677 Bacteria 6596907
433 2842501988 2842495871 Bacteria 6820686
434 2857524470 2857516855 Bacteria 7787325
435 639646702 639633055 Bacteria 7751309
436 8005278922 8005275841 Bacteria 6929066
437 8005565032 8005563573 Bacteria 7153261
438 8005700608 8005695170 Bacteria 6912330
439 8018179429 8018176218 Bacteria 6896178
440 Ga0501043_0590467
441 JGI25159J45721_1000044
442 JGI25153J46596_10000744
443 rootL2_10120629
444 rootH1_10007743
445 JGI25160J50197_1000206
446 JGI25161J50226_1000097
447 Ga0055524_1006179
448 Ga0055530_10003364
449 Ga0055543_1000056
450 Ga0065165_1000719
451 Ga0065704_10098741
452 Ga0065715_10003750
453 Ga0070676_10406023
454 Ga0070683_100275566
455 Ga0070683_100512247
456 Ga0070670_100206532
457 Ga0070666_10385635
458 Ga0070666_10534151
459 Ga0070680_100215403
460 Ga0068868_100172436
461 Ga0068868_100601143
462 Ga0070660_100191480
463 Ga0070691_10184160
464 Ga0070687_100028037
465 Ga0070687_100980037
466 Ga0070668_100250598
467 Ga0070675_100089511
468 Ga0070659_100097196
469 Ga0070659_101319565
470 Ga0070667_100071921
471 Ga0070709_10264137
472 Ga0070713_100401479
473 Ga0070663_100449891
474 Ga0070678_100702484
475 Ga0070662_100050620
476 Ga0070681_10093572
477 Ga0070681_10114783
478 Ga0070681_10222351
479 Ga0070706_100062307
480 Ga0070707_100617917
481 Ga0070699_100098442
482 Ga0070679_100405791
483 Ga0070679_100586175
484 Ga0070684_100323108
485 Ga0070684_100518682
486 Ga0070697_100000134
487 Ga0070697_100153736
488 Ga0068853_100128145
489 Ga0068853_101881990
490 Ga0070696_100076931
491 Ga0068855_100215091
492 Ga0068855_100283789
493 Ga0068855_100593209
494 Ga0070664_100369999
495 Ga0070664_100449783
496 Ga0068856_100122657
497 Ga0068856_100784016
498 Ga0068856_102098395
499 Ga0068859_100092134
500 Ga0068859_100284992
501 Ga0068859_101346876
502 Ga0068864_100155175
503 Ga0068866_10189418
504 Ga0068866_10657254
505 Ga0068861_100395959
506 Ga0068863_100011283
507 Ga0068863_100480615
508 Ga0068860_100000409
509 Ga0068860_100020727
510 Ga0075364_10346231
511 Ga0070712_100786730
512 Ga0075369_10326383
513 Ga0097621_100361991
514 Ga0097621_100672079
515 Ga0075428_100068525
516 Ga0075428_100444189
517 Ga0075430_100002156
518 Ga0075430_100069277
519 Ga0075431_100003788
520 Ga0075431_100088376
521 Ga0075431_100152027
522 Ga0075434_100635935
523 Ga0075434_100943369
524 Ga0075429_100027917
525 Ga0075429_100204718
526 Ga0097620_100092135
527 Ga0097620_100284978
528 Ga0097620_101346519
529 Ga0105240_10000387
530 Ga0105240_10008582
531 Ga0105245_10578939
532 Ga0105245_10751215
533 Ga0105247_10049227
534 Ga0105247_10188226
535 Ga0105247_11200303
536 Ga0114129_10056913
537 Ga0105243_11080613
538 Ga0105248_10228063
539 Ga0105248_11654929
540 Ga0105237_10000577
541 Ga0105237_10033764
542 Ga0105237_10093286
543 Ga0105237_10148544
544 Ga0105237_10218642
545 Ga0105237_11441750
546 Ga0105237_11733418
547 Ga0105238_10041626
548 Ga0105238_10249716
549 Ga0105238_10363295
550 Ga0105249_10483939
551 Ga0105249_10670202
552 Ga0105249_11193000
553 Ga0105239_10006826
554 Ga0105239_10106769
555 Ga0105239_10192513
556 Ga0105239_10844787
557 Ga0105239_11529996
558 Ga0105246_10272565
559 Ga0105246_10963522
560 Ga0105246_11567946
561 Ga0157371_10000970
562 Ga0157370_10005587
563 Ga0157369_10995326
564 Ga0157374_10248001
565 Ga0157374_10939559
566 Ga0163162_10029156
567 Ga0163162_10157318
568 Ga0163162_10242894
569 Ga0163162_10558177
570 Ga0163162_10937889
571 Ga0157372_10010192
572 Ga0157372_10040297
573 Ga0157372_10159637
574 Ga0157372_10221991
575 Ga0157375_11179334
576 Ga0157375_11735739
577 Ga0163163_10493502
578 Ga0157380_10310114
579 Ga0157376_10570137
580 Ga0213872_10041452
581 Ga0213875_10076308
582 Ga0209436_100008
583 Ga0209129_1006573
584 Ga0209233_1012021
585 Ga0209673_1005252
586 Ga0209130_1000019
587 Ga0209758_1000482
588 Ga0209758_1001785
589 Ga0209050_1000118
590 Ga0209256_1001370
591 Ga0207426_1000005
592 Ga0209051_1045927
593 Ga0209051_1086351
594 Ga0209257_1012202
595 Ga0209257_1025243
596 Ga0207692_10460619
597 Ga0207710_10056563
598 Ga0207710_10134560
599 Ga0207680_10294643
600 Ga0207699_10199720
601 Ga0207645_10056934
602 Ga0207645_10080974
603 Ga0207684_10533340
604 Ga0207707_10073098
605 Ga0207695_10000510
606 Ga0207695_10013567
607 Ga0207695_11262181
608 Ga0207671_10001317
609 Ga0207671_10110525
610 Ga0207671_10110669
611 Ga0207671_10144338
612 Ga0207671_10222457
613 Ga0207671_10255243
614 Ga0207671_11271100
615 Ga0207662_10074683
616 Ga0207657_10127125
617 Ga0207652_10255302
618 Ga0207652_10368999
619 Ga0207646_10572368
620 Ga0207694_10030482
621 Ga0207694_10589468
622 Ga0207694_10703147
623 Ga0207650_10049831
624 Ga0207659_10008810
625 Ga0207687_10023885
626 Ga0207687_10524450
627 Ga0207700_10295647
628 Ga0207700_11218538
629 Ga0207690_10155829
630 Ga0207706_10708169
631 Ga0207709_10504770
632 Ga0207661_10376876
633 Ga0207661_11089643
634 Ga0207679_10207497
635 Ga0207667_10193710
636 Ga0207667_10259506
637 Ga0207667_10630646
638 Ga0207712_11040755
639 Ga0207668_10109172
640 Ga0207658_10373905
641 Ga0207677_10233552
642 Ga0207677_11113454
643 Ga0207639_10693256
644 Ga0207678_10218039
645 Ga0207678_10447323
646 Ga0207678_10912974
647 Ga0207702_10879601
648 Ga0207702_10972799
649 Ga0207641_10302133
650 Ga0207641_10333409
651 Ga0207676_11251105
652 Ga0207676_12160954
653 Ga0207675_100109235
654 Ga0207683_10041344
655 Ga0207698_10430595
656 Ga0207428_10710994
657 Ga0268266_10053276
658 Ga0268265_10297667
659 Ga0268264_10000020
660 Ga0268264_10018924
661 Ga0268264_10157935
662 Ga0265338_10768052
663 Ga0307511_10122791
664 Ga0265340_10055886
665 Ga0265340_10197525
666 Ga0265339_10004757
667 Ga0265327_10000700
668 Ga0265327_10008846
669 Ga0265316_10392689
670 Ga0307508_10002697
671 Ga0307508_10050769
672 Ga0307516_10109930
673 Ga0307516_10302747
674 Ga0307410_10315337
675 Ga0307410_10733271
676 Ga0307406_10150611
677 Ga0307412_10877670
678 Ga0307414_10237059
679 Ga0307414_10258490
680 Ga0307507_10037052
681 Ga0373934_0428774
682 Ga0373923_0054514
683 Ga0373939_0275544
684 Ga0373954_0226881
685 Ga0373935_0442052
686 Ga0373927_0026021
687 Ga0373927_0961661
688 Ga0373933_0209009
689 Ga0373937_0167001
690 Ga0373925_0326716
691 Ga0395900_0446094
692 Ga0395898_0281014
693 Ga0395898_0292757
694 Ga0395898_0737097
695 Ga0395905_0304386
696 Ga0436364_0175813
697 Ga0436364_0714717
698 Ga0400490_44737
699 Ga0436365_1354402
700 Ga0436365_1604306
701 Ga0451833_0229023
702 Ga0451833_0840808
703 Ga0451833_0878483
704 Ga0451837_0108500
705 Ga0451841_0858756
706 Ga0451849_1220883
707 Ga0451851_1279256
708 Ga0451843_0546128
709 Ga0451853_0183479
710 Ga0451853_0299950
711 Ga0451853_3672779
712 Ga0439457_049868
713 Ga0466972_0000047
714 Ga0466966_0069528
715 Ga0466961_0112628
716 Ga0453684_0682643
717 Ga0453684_1100977
718 Ga0466957_0095656
719 Ga0466959_0007439
720 Ga0451576_0035399
721 Ga0451576_1293796
722 Ga0466967_0489605
723 Ga0466967_0511721
724 Ga0495629_0835838
725 Ga0495662_0291173
726 Ga0495616_0093175
727 Ga0495630_0152626
728 Ga0495643_0015619
729 Ga0495643_0147890
730 Ga0495643_0309863
731 Ga0495648_0008505
732 Ga0495666_0185131
733 Ga0495642_0018271
734 Ga0495652_0690557
735 Ga0495622_0176958
736 Ga0495656_0088073
737 Ga0495656_0125281
738 Ga0495634_0053809
739 Ga0495611_0204606
740 Ga0495625_0194401
741 Ga0495635_1064523
742 Ga0495658_0217567
743 Ga0495669_0261732
744 Ga0495624_0102393
745 Ga0495671_0500014
746 Ga0495649_0021712
747 Ga0495649_0028845
748 Ga0495581_0083441
749 Ga0495674_0057245
750 Ga0495672_0007947
751 Ga0495684_0286848
752 Ga0495686_0504089
753 Ga0496101_0751151
754 Ga0496102_0044391
755 Ga0496102_0064999
756 Ga0496103_0018310
757 Ga0496106_0001723
758 Ga0496106_1323987
759 Ga0496107_1115896
760 Ga0496109_0400683
761 Ga0496112_0324861
762 Ga0496113_0485009
763 Ga0496116_0011406
764 Ga0496117_0016688
765 Ga0496118_0013737
766 Ga0496120_0103203
767 Ga0496120_0206782
768 Ga0496121_0001584
769 Ga0496121_0003087
770 Ga0496121_0004902
771 Ga0496121_0111065
772 Ga0496121_0176191
773 Ga0496121_0226789
774 Ga0496122_0134578
775 Ga0496124_0008891
776 Ga0496124_0067575
777 Ga0496125_0039879
778 Ga0496125_0046312
779 Ga0496126_0005136
780 Ga0496126_0025679
781 Ga0496126_0295263
782 Ga0496126_0332095
783 Ga0496126_0513151
784 Ga0496126_0696739
785 Ga0501033_0001075
786 Ga0501034_0144985
787 Ga0501034_0663545
788 Ga0501038_0935536
789 Ga0501040_0150605
790 Ga0501046_0062135
791 Ga0501046_0195495
792 Ga0501047_0013983
793 Ga0501047_0022387
794 Ga0501070_0047520
795 Ga0501073_0025069
796 Ga0501073_0387319
797 Ga0501075_0058038
798 Ga0501075_0326563
799 Ga0501076_0215328
800 Ga0501077_0074983
801 Ga0501077_0239540
802 Ga0501243_000169
803 Ga0501225_0000857
804 Ga0501079_0139066
805 Ga0501080_0033362
806 Ga0501080_0109716
807 Ga0501080_0387404
808 Ga0501080_0473225
809 Ga0501080_0675289
810 Ga0501081_0104577
811 Ga0501035_0263938
812 Ga0501044_0000106
813 Ga0501044_0037681
814 Ga0501044_0055787
815 Ga0501044_0261420
816 Ga0501045_0215420
817 nmdc:mga0k408_49682_c1
818 nmdc:mga04h51_234906_c1
819 nmdc:mga07m45_268022_c1
820 nmdc:mga05p37_99563_c1
821 nmdc:mga09592_144384_c1
822 nmdc:mga09592_58055_c2
823 nmdc:mga09592_738854_c1
824 nmdc:mga0qj67_11370_c1
825 nmdc:mga0qj67_12709_c1
826 nmdc:mga0qj67_4133_c1
827 nmdc:mga06r32_182978_c1
828 nmdc:mga06r32_39668_c1
829 nmdc:mga06r32_910_c1
830 nmdc:mga08y16_118761_c1
831 nmdc:mga0sz30_298689_c1
832 Ga0500578_0023317
833 Ga0500646_0000534
834 Ga0500566_0098815
835 Ga0500556_0090495
836 Ga0500557_000007
837 Ga0500572_209464
838 Ga0500592_038011
839 Ga0500595_021265
840 Ga0500658_0210204
841 Ga0500658_0536082
842 Ga0500568_0000217
843 Ga0500590_137740
844 Ga0500616_0050233
845 Ga0500622_0000092
846 Ga0500622_0032206
847 Ga0500633_0000096
848 Ga0500633_0305871
849 Ga0500637_0017173
850 Ga0500625_006466
851 Ga0500601_024969
852 Ga0501084_0003367
853 Ga0501084_0743456
854 Ga0501082_0084620
855 Ga0501082_1231908
856 Ga0530510_1066525
857 2511197000
858 2585550672
859 2766064964
860 2838672363
861 2838703895
862 2842148313
863 2842253379
864 2842289327
865 2842312592
866 2842322624
867 2842401955
868 2842406675
869 2842413829
870 2842420209
871 2842501988
872 2857524470
873 639646702
874 8005278922
875 8005565032
876 8005700608
877 8018179429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

43

78

0.94

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

115

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mzu-assembly2.cif.gz_G crystal structure of fdtd, a bifunctional ketoisomerase/n-acetyltransferase from shewanella denitrificans 0.925 9 156
1sst-assembly1.cif.gz_A-2 serine acetyltransferase- complex with coa 0.9109 45 153
4n6b-assembly2.cif.gz_C soybean serine acetyltransferase complexed with coa 0.8933 45 153
3mc4-assembly2.cif.gz_B crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis 0.887 51 155
3r8y-assembly2.cif.gz_E structure of the bacillus anthracis tetrahydropicolinate succinyltransferase 0.8838 19 153
ID Description Score Start End Superfamily
af_F1QSV4_111_509_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9334 13 64 3.90.550.10
4mzuA01 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8732 12 159 2.160.10.10
4mzuA01 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8673 12 159 2.160.10.10
af_A4HUR5_71_238_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8455 13 158 2.160.10.10
af_Q9NR50_335_449_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8309 24 149 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A833DGQ9-F1-model_v4 N-acetyltransferase 1.003 59 154 GO:0016740
AF-A0A2V6KPX5-F1-model_v4 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase 1.003 103 156 GO:0005829
GO:0008374
AF-A0A7C7IQD4-F1-model_v4 N-acetyltransferase 0.9982 5 154 GO:0016740
AF-A0A3B9I1C8-F1-model_v4 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase 0.998 4 156 GO:0016746
AF-A0A560DY19-F1-model_v4 Succinyltransferase-like protein 0.9978 4 153 GO:0016740

Map