F444239

General Info

Members Datasets Scaffolds Average Seq Length
439 325 878 349

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0219067|Ga0316582_0219067_45_1139
Length 364
Sequence MSERDSTLRDKAFLVLLVLVTLAFGWILLPFYGAILWATVLATVFAPTHRWLLNVNAMAGRPNLAALVTLLIIVGIVLLPLALTVGSLIAEATSLYERVQSGQVDLGSIFQNFLDALPSWASSLFGRLGLTDVGDIQSRLVAILKEGGQFFATQAVLVGQGTANFVISLGIMLYLLFFLLRDGEAIAGAVRHAIPLRSEEKGALYERYTVVVRAMIKGTVLVAVVQGALGGLIFWLLGIHSPVLWGVVMAFMSLLPAIGAAAVWLPVAIYLLVTGAVLKGIVLIAFGAGVIGLVDNLLRPYLVGKSTRMPDFIVLLSTLGGIAILGLNGFVVGPLIAAMFFAAWDIAAGASTGTQAPDGPSQKT

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
132 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
133 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
134 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
153 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
154 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
155 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
156 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
254 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
255 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
256 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
257 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
260 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
261 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
262 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
267 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
268 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
269 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 2511231010 Pseudomonas sp. GM25 Isolate Nodule
273 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
274 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
275 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
276 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
277 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
278 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
279 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
280 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
281 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
282 2643221658 Variovorax sp. Root411 Isolate Unclassified
283 2643221672 Variovorax sp. Root434 Isolate Unclassified
284 2643221683 Variovorax sp. Root473 Isolate Unclassified
285 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
286 2738541277 Variovorax sp. GV051 Isolate Unclassified
287 2738541307 Variovorax sp. GV008 Isolate Unclassified
288 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
289 2738543019 Variovorax sp. GV040 Isolate Unclassified
290 2791355199
291 2818991446 Variovorax sp. 1180 Isolate Unclassified
292 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
293 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
294 2842677519 Variovorax sp. R-72495 Isolate Unclassified
295 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
296 2885198086 Variovorax sp. 679 Isolate Unclassified
297 2885211737 Variovorax sp. 553 Isolate Unclassified
298 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
299 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
300 2899924645 Variovorax sp. 369 Isolate Unclassified
301 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
302 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
303 2904456579 Variovorax sp. 2002 Isolate Unclassified
304 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
305 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
306 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
307 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
308 2928037797 Variovorax sp. 1126 Isolate Unclassified
309 2928044640 Variovorax sp. 1128 Isolate Unclassified
310 2928051484 Variovorax sp. 1133 Isolate Unclassified
311 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
312 2928070936 Variovorax gossypii 1167 Isolate Unclassified
313 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
314 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
315 2929520902 Variovorax beijingensis 502 Isolate Unclassified
316 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
317 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
318 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
319 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
320 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
321 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
322 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
323 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
324 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
325 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.44
Metatranscriptomes 0.23
Isolates 12.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.74
Nodule 3.87
Rhizoplane 3.64
Rhizosphere 53.3
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0219067 3300036647 Bacteria 1301
2 JGI24740J21852_10030794 3300001979 Bacteria 1739
3 JGI25152J39213_1004543 3300002773 Bacteria 4336
4 JGI25150J39212_1000830 3300002774 Bacteria 10388
5 JGI25151J46595_10011705 3300003187 Bacteria 4020
6 JGI25153J46596_10007821 3300003215 Bacteria 5192
7 rootH1_10046429 3300003316 Bacteria 4487
8 Ga0006562J51391_1073750 3300003578 Bacteria 4780
9 Ga0055525_1003271 3300003759 Bacteria 1469
10 Ga0055535_1000075 3300003761 Bacteria 111667
11 Ga0055542_1000059 3300003762 Bacteria 162670
12 Ga0055542_1000492 3300003762 Bacteria 36378
13 Ga0055526_1005342 3300003771 Bacteria 7421
14 Ga0055537_1000837 3300003773 Bacteria 15045
15 Ga0055537_1006347 3300003773 Bacteria 3015
16 Ga0055524_1002063 3300003775 Bacteria 10667
17 Ga0055536_1012972 3300003781 Bacteria 3044
18 Ga0055536_1022343 3300003781 Bacteria 1890
19 Ga0055534_1000736 3300003784 Bacteria 15758
20 Ga0055534_1006835 3300003784 Bacteria 2813
21 Ga0055528_1002672 3300003790 Bacteria 9405
22 Ga0055540_1013419 3300003792 Bacteria 2503
23 Ga0055541_1000400 3300003841 Bacteria 13001
24 Ga0065714_10081624 3300005288 Bacteria 2361
25 Ga0065704_10181552 3300005289 Bacteria 1234
26 Ga0070676_10201864 3300005328 Bacteria 1304
27 Ga0070683_100318551 3300005329 Bacteria 1480
28 Ga0068869_100122372 3300005334 Bacteria 1991
29 Ga0068868_100075276 3300005338 Bacteria 2698
30 Ga0068868_100315538 3300005338 Bacteria 1331
31 Ga0070689_100234804 3300005340 Bacteria 1509
32 Ga0070661_100018105 3300005344 Bacteria 5005
33 Ga0070668_100038744 3300005347 Bacteria 3645
34 Ga0070668_100153639 3300005347 Bacteria 1863
35 Ga0070669_100048663 3300005353 Bacteria 3095
36 Ga0070669_100098562 3300005353 Bacteria 2202
37 Ga0070659_100132942 3300005366 Bacteria 2021
38 Ga0070667_100030847 3300005367 Bacteria 4470
39 Ga0070667_100207945 3300005367 Bacteria 1739
40 Ga0070663_100199494 3300005455 Bacteria 1561
41 Ga0070678_100006298 3300005456 Bacteria 6954
42 Ga0070678_100099661 3300005456 Bacteria 2248
43 Ga0070662_100075115 3300005457 Bacteria 2502
44 Ga0070662_100184008 3300005457 Bacteria 1649
45 Ga0070681_10001556 3300005458 Bacteria 20332
46 Ga0070685_10015586 3300005466 Bacteria 4039
47 Ga0070699_100261424 3300005518 Bacteria 1548
48 Ga0070679_100048657 3300005530 Bacteria 4223
49 Ga0068853_100017694 3300005539 Bacteria 5882
50 Ga0068853_100053977 3300005539 Bacteria 3462
51 Ga0070665_100015331 3300005548 Bacteria 7695
52 Ga0068855_100197533 3300005563 Bacteria 2266
53 Ga0068854_100263736 3300005578 Bacteria 1380
54 Ga0070702_100115724 3300005615 Bacteria 1670
55 Ga0068861_100038336 3300005719 Bacteria 3567
56 Ga0068858_100129256 3300005842 Bacteria 2367
57 Ga0068860_100009962 3300005843 Bacteria 9418
58 Ga0068860_100245597 3300005843 Bacteria 1742
59 Ga0081540_1000373 3300005983 Bacteria 44890
60 Ga0081540_1000904 3300005983 Bacteria 26798
61 Ga0081539_10015306 3300005985 Bacteria 5585
62 Ga0075365_10039301 3300006038 Bacteria 3080
63 Ga0075365_10152165 3300006038 Bacteria 1609
64 Ga0075365_10189872 3300006038 Bacteria 1438
65 Ga0075363_100005081 3300006048 Bacteria 5817
66 Ga0075363_100015875 3300006048 Bacteria 3709
67 Ga0075363_100043973 3300006048 Bacteria 2364
68 Ga0075363_100080752 3300006048 Bacteria 1778
69 Ga0075364_10103684 3300006051 Bacteria 1894
70 Ga0075362_10116737 3300006177 Bacteria 1260
71 Ga0075370_10011621 3300006353 Bacteria 4631
72 Ga0075370_10013642 3300006353 Bacteria 4324
73 Ga0075428_100302855 3300006844 Bacteria 1718
74 Ga0075431_100505225 3300006847 Bacteria 1200
75 Ga0099826_10000504 3300006948 Bacteria 19119
76 Ga0099826_10052343 3300006948 Bacteria 2728
77 Ga0105244_10008305 3300009036 Bacteria 6495
78 Ga0105250_10011219 3300009092 Bacteria 3719
79 Ga0105240_10138574 3300009093 Unclassified 2911
80 Ga0105245_10126806 3300009098 Bacteria 2390
81 Ga0105245_10295607 3300009098 Bacteria 1587
82 Ga0105245_10358390 3300009098 Bacteria 1447
83 Ga0114129_10097158 3300009147 Bacteria 4077
84 Ga0105243_10001924 3300009148 Bacteria 17707
85 Ga0105243_10045835 3300009148 Bacteria 3438
86 Ga0105242_10251734 3300009176 Bacteria 1592
87 Ga0105237_10087650 3300009545 Bacteria 3102
88 Ga0105237_10091963 3300009545 Bacteria 3023
89 Ga0105238_10098758 3300009551 Bacteria 2903
90 Ga0105239_10074442 3300010375 Unclassified 3734
91 Ga0105246_10060672 3300011119 Bacteria 2629
92 Ga0157370_10035531 3300013104 Bacteria 4842
93 Ga0157369_10003782 3300013105 Bacteria 17978
94 Ga0157374_10248465 3300013296 Bacteria 1750
95 Ga0163162_10316130 3300013306 Bacteria 1694
96 Ga0163162_10390199 3300013306 Bacteria 1525
97 Ga0157372_10028982 3300013307 Bacteria 6040
98 Ga0157375_10114095 3300013308 Bacteria 2803
99 Ga0157375_10477532 3300013308 Bacteria 1412
100 Ga0163163_10561971 3300014325 Bacteria 1204
101 Ga0182008_10003982 3300014497 Bacteria 8738
102 Ga0182008_10030820 3300014497 Bacteria 2702
103 Ga0157376_10133491 3300014969 Bacteria 2218
104 Ga0182006_1006221 3300015261 Bacteria 5571
105 Ga0182006_1047574 3300015261 Bacteria 1661
106 Ga0182007_10001421 3300015262 Bacteria 12850
107 Ga0163161_10002814 3300017792 Bacteria 12343
108 Ga0163161_10257860 3300017792 Bacteria 1361
109 Ga0209674_100131 3300025226 Bacteria 118079
110 Ga0209672_100686 3300025228 Bacteria 17031
111 Ga0209147_100661 3300025229 Bacteria 17862
112 Ga0209563_104458 3300025230 Bacteria 2672
113 Ga0209258_100078 3300025242 Bacteria 263996
114 Ga0207425_1000247 3300025245 Bacteria 41129
115 Ga0209646_1000058 3300025246 Bacteria 259999
116 Ga0209148_1000043 3300025254 Bacteria 461531
117 Ga0209148_1000086 3300025254 Bacteria 263996
118 Ga0209759_1002890 3300025256 Bacteria 7248
119 Ga0209129_1000116 3300025258 Bacteria 140716
120 Ga0209129_1003553 3300025258 Bacteria 6707
121 Ga0209129_1005090 3300025258 Bacteria 4819
122 Ga0209565_1000353 3300025263 Bacteria 40174
123 Ga0209565_1000921 3300025263 Bacteria 15679
124 Ga0209673_1000190 3300025273 Bacteria 123411
125 Ga0209673_1002054 3300025273 Bacteria 15226
126 Ga0209130_1000635 3300025284 Bacteria 33021
127 Ga0209130_1000823 3300025284 Bacteria 26100
128 Ga0209675_1000038 3300025291 Bacteria 250481
129 Ga0209675_1000349 3300025291 Bacteria 40171
130 Ga0209676_1000125 3300025292 Bacteria 191565
131 Ga0209676_1001150 3300025292 Bacteria 28948
132 Ga0209025_1000238 3300025294 Bacteria 128478
133 Ga0209025_1000256 3300025294 Bacteria 125758
134 Ga0209025_1000293 3300025294 Bacteria 111845
135 Ga0209025_1011228 3300025294 Bacteria 5935
136 Ga0209564_1000201 3300025295 Bacteria 136907
137 Ga0209564_1000918 3300025295 Bacteria 38443
138 Ga0209758_1000034 3300025297 Bacteria 467637
139 Ga0209758_1004806 3300025297 Bacteria 10912
140 Ga0209758_1005668 3300025297 Bacteria 9448
141 Ga0209758_1009383 3300025297 Bacteria 6092
142 Ga0209050_1000012 3300025298 Bacteria 813717
143 Ga0209050_1021029 3300025298 Bacteria 2399
144 Ga0209256_1000677 3300025299 Bacteria 46076
145 Ga0209256_1000969 3300025299 Bacteria 34493
146 Ga0207426_1000244 3300025302 Bacteria 120371
147 Ga0207426_1000795 3300025302 Bacteria 34244
148 Ga0209051_1000524 3300025303 Bacteria 47751
149 Ga0209051_1002812 3300025303 Bacteria 12006
150 Ga0209257_1000024 3300025304 Bacteria 726068
151 Ga0207656_10001163 3300025321 Bacteria 8646
152 Ga0207655_1041766 3300025728 Bacteria 1961
153 Ga0207688_10065471 3300025901 Bacteria 2054
154 Ga0207645_10133104 3300025907 Bacteria 1619
155 Ga0207707_10009035 3300025912 Bacteria 8661
156 Ga0207695_10068981 3300025913 Bacteria 3620
157 Ga0207649_10010842 3300025920 Bacteria 5010
158 Ga0207652_10083387 3300025921 Bacteria 2799
159 Ga0207681_10100716 3300025923 Bacteria 2083
160 Ga0207694_10167209 3300025924 Bacteria 1779
161 Ga0207690_10023608 3300025932 Bacteria 3840
162 Ga0207709_10000393 3300025935 Bacteria 43216
163 Ga0207709_10000610 3300025935 Bacteria 29558
164 Ga0207709_10002972 3300025935 Bacteria 10334
165 Ga0207709_10026757 3300025935 Bacteria 3316
166 Ga0207689_10015143 3300025942 Bacteria 6537
167 Ga0207679_10156420 3300025945 Bacteria 1862
168 Ga0207712_10047420 3300025961 Bacteria 2983
169 Ga0207712_10079222 3300025961 Bacteria 2386
170 Ga0207668_10017167 3300025972 Bacteria 4530
171 Ga0207640_10185138 3300025981 Bacteria 1565
172 Ga0207658_10151413 3300025986 Bacteria 1890
173 Ga0207639_10016065 3300026041 Bacteria 5289
174 Ga0207639_10069576 3300026041 Bacteria 2746
175 Ga0207639_10155562 3300026041 Bacteria 1920
176 Ga0207678_10116956 3300026067 Bacteria 2275
177 Ga0207678_10160799 3300026067 Bacteria 1918
178 Ga0207648_10045959 3300026089 Bacteria 3828
179 Ga0207674_10113504 3300026116 Bacteria 2682
180 Ga0207683_10064868 3300026121 Bacteria 3219
181 Ga0209282_1000751 3300027666 Bacteria 16345
182 Ga0209282_1037163 3300027666 Bacteria 2930
183 Ga0268266_10000544 3300028379 Bacteria 52629
184 Ga0268266_10072738 3300028379 Bacteria 2982
185 Ga0268266_10254874 3300028379 Bacteria 1624
186 Ga0268265_10148035 3300028380 Bacteria 1976
187 Ga0268265_10384280 3300028380 Bacteria 1292
188 Ga0268264_10037322 3300028381 Bacteria 4006
189 Ga0307517_10123164 3300028786 Bacteria 1906
190 Ga0316177_1189767 3300030731 Bacteria 4096
191 Ga0314311_1075878 3300030733 Bacteria 2697
192 Ga0316180_1125658 3300030736 Bacteria 2121
193 Ga0316183_1055144 3300030742 Bacteria 4359
194 Ga0307509_10208169 3300031507 Bacteria 1784
195 Ga0307408_100284892 3300031548 Bacteria 1377
196 Ga0307516_10244600 3300031730 Bacteria 1491
197 Ga0307405_10070240 3300031731 Bacteria 2248
198 Ga0307405_10152474 3300031731 Bacteria 1627
199 Ga0307413_10038382 3300031824 Bacteria 2775
200 Ga0307410_10113967 3300031852 Bacteria 1961
201 Ga0307406_10004851 3300031901 Bacteria 7325
202 Ga0307406_10072345 3300031901 Bacteria 2263
203 Ga0307412_10036572 3300031911 Bacteria 3147
204 Ga0307412_10116253 3300031911 Bacteria 1918
205 Ga0307412_10282787 3300031911 Bacteria 1303
206 Ga0307416_100222281 3300032002 Bacteria 1812
207 Ga0307416_100327011 3300032002 Bacteria 1539
208 Ga0307411_10045350 3300032005 Bacteria 2827
209 Ga0307411_10115164 3300032005 Bacteria 1933
210 Ga0307415_100034576 3300032126 Bacteria 3292
211 Ga0307415_100195971 3300032126 Bacteria 1598
212 Ga0307415_100241145 3300032126 Bacteria 1462
213 Ga0307510_10004428 3300033180 Bacteria 16533
214 Ga0373931_0020425 3300035691 Bacteria 3315
215 Ga0373935_0233088 3300035692 Bacteria 1283
216 Ga0439466_0021704 3300041411 Bacteria 2272
217 Ga0439465_0013572 3300041413 Bacteria 2538
218 Ga0439465_0019809 3300041413 Bacteria 2104
219 Ga0451800_1505967 3300041459 Bacteria 1234
220 Ga0439442_004832 3300042002 Bacteria 2681
221 Ga0450898_012962 3300042134 Bacteria 1384
222 Ga0450906_020133 3300042145 Bacteria 1194
223 Ga0450910_001575 3300042147 Bacteria 2905
224 Ga0450908_008313 3300042184 Bacteria 1945
225 Ga0439434_0009637 3300042435 Bacteria 2842
226 Ga0450918_001535 3300042531 Bacteria 4555
227 Ga0466965_0025622 3300044683 Bacteria 2855
228 Ga0466957_0012425 3300044842 Bacteria 4928
229 Ga0495627_030027 3300046453 Bacteria 1725
230 Ga0495603_0014166 3300046455 Bacteria 4824
231 Ga0495629_0018559 3300046459 Bacteria 4974
232 Ga0495638_0028723 3300046460 Bacteria 3589
233 Ga0495638_0035509 3300046460 Bacteria 3177
234 Ga0495651_0018464 3300046462 Bacteria 5401
235 Ga0495653_0041874 3300046463 Bacteria 3572
236 Ga0495585_0078032 3300046492 Bacteria 1797
237 Ga0495608_0070542 3300046511 Bacteria 2280
238 Ga0495610_0030640 3300046512 Bacteria 2815
239 Ga0495616_0003489 3300046513 Bacteria 10059
240 Ga0495620_0010863 3300046515 Bacteria 4782
241 Ga0495631_0002133 3300046518 Bacteria 11448
242 Ga0495637_0028620 3300046520 Bacteria 2487
243 Ga0495652_0014113 3300046529 Bacteria 7175
244 Ga0495654_0031035 3300046530 Bacteria 2714
245 Ga0495656_0002595 3300046615 Bacteria 6028
246 Ga0495656_0014493 3300046615 Bacteria 2957
247 Ga0495668_0034699 3300046616 Bacteria 2829
248 Ga0495668_0092277 3300046616 Bacteria 1659
249 Ga0495634_0021794 3300046642 Bacteria 4523
250 Ga0495611_0115649 3300046648 Bacteria 1250
251 Ga0495625_0000317 3300046660 Bacteria 73568
252 Ga0495625_0009575 3300046660 Bacteria 8094
253 Ga0495625_0048587 3300046660 Bacteria 3054
254 Ga0495625_0069593 3300046660 Bacteria 2472
255 Ga0495625_0129951 3300046660 Bacteria 1707
256 Ga0495635_0001873 3300046663 Bacteria 14252
257 Ga0495661_0152012 3300046665 Bacteria 1250
258 Ga0495588_0021600 3300046674 Bacteria 3173
259 Ga0495657_0006464 3300046675 Bacteria 9168
260 Ga0495624_0010228 3300046690 Bacteria 6468
261 Ga0495671_0008968 3300046692 Bacteria 5615
262 Ga0495581_0031582 3300047315 Bacteria 3068
263 Ga0495604_0003570 3300047317 Bacteria 12403
264 Ga0495674_0244407 3300047319 Bacteria 1478
265 Ga0495672_0023819 3300047320 Bacteria 3955
266 Ga0495672_0044892 3300047320 Bacteria 2648
267 Ga0495676_0094010 3300047321 Bacteria 2234
268 Ga0495686_0208146 3300047472 Bacteria 1119
269 Ga0495602_0027002 3300048088 Bacteria 5529
270 Ga0495614_0089648 3300048089 Bacteria 1337
271 Ga0496100_0050567 3300048903 Bacteria 2694
272 Ga0496102_0049264 3300048905 Bacteria 3832
273 Ga0496102_0184469 3300048905 Bacteria 1966
274 Ga0496102_0256303 3300048905 Bacteria 1649
275 Ga0496104_0001785 3300048907 Bacteria 18633
276 Ga0496105_0010712 3300048908 Bacteria 7215
277 Ga0496106_0086583 3300048909 Bacteria 2413
278 Ga0496106_0196507 3300048909 Bacteria 1605
279 Ga0496108_0076893 3300048911 Bacteria 2822
280 Ga0496111_0410949 3300048914 Bacteria 1000
281 Ga0496114_0091418 3300048917 Bacteria 2585
282 Ga0496115_0363675 3300048918 Bacteria 1179
283 Ga0496116_0030763 3300048919 Bacteria 3852
284 Ga0496117_0020413 3300048920 Bacteria 5401
285 Ga0496118_0022408 3300048921 Bacteria 5521
286 Ga0496118_0074779 3300048921 Bacteria 2420
287 Ga0496119_0005077 3300048922 Bacteria 12779
288 Ga0496120_0004945 3300048923 Bacteria 10829
289 Ga0496121_0000657 3300048924 Bacteria 64819
290 Ga0496121_0015817 3300048924 Bacteria 7853
291 Ga0496121_0031555 3300048924 Bacteria 4837
292 Ga0496121_0064316 3300048924 Bacteria 2991
293 Ga0496122_0073088 3300048925 Bacteria 2434
294 Ga0496122_0089630 3300048925 Bacteria 2102
295 Ga0496123_0085320 3300048926 Bacteria 1900
296 Ga0496124_0003777 3300048927 Bacteria 18188
297 Ga0496124_0038288 3300048927 Bacteria 4165
298 Ga0496124_0080905 3300048927 Bacteria 2672
299 Ga0496125_0056895 3300048928 Bacteria 3172
300 Ga0496125_0095611 3300048928 Bacteria 2209
301 Ga0496125_0096287 3300048928 Bacteria 2198
302 Ga0496126_0002447 3300048929 Bacteria 25067
303 Ga0496126_0010928 3300048929 Bacteria 9456
304 Ga0496126_0138551 3300048929 Bacteria 2096
305 Ga0496126_0139919 3300048929 Bacteria 2084
306 Ga0496126_0229862 3300048929 Bacteria 1554
307 Ga0495678_031146 3300049459 Bacteria 2227
308 Ga0501037_0008623 3300049573 Bacteria 7474
309 Ga0501038_0030734 3300049574 Bacteria 4749
310 Ga0501038_0155448 3300049574 Bacteria 1863
311 Ga0501039_0013310 3300049575 Bacteria 6289
312 Ga0501039_0114018 3300049575 Bacteria 2114
313 Ga0501039_0195226 3300049575 Bacteria 1591
314 Ga0501040_0039424 3300049576 Bacteria 3212
315 Ga0501041_0028667 3300049577 Bacteria 3358
316 Ga0501046_0065067 3300049580 Bacteria 2845
317 Ga0501048_0060608 3300049582 Bacteria 2681
318 Ga0501070_0192525 3300049586 Bacteria 1676
319 Ga0501071_0072130 3300049587 Bacteria 2518
320 Ga0501074_0049862 3300049590 Bacteria 3022
321 Ga0501075_0095003 3300049591 Bacteria 2262
322 Ga0501076_0112031 3300049592 Bacteria 2206
323 Ga0501077_0033072 3300049593 Bacteria 3292
324 Ga0501249_003761 3300049679 Bacteria 3059
325 Ga0501225_0005379 3300049705 Bacteria 3762
326 Ga0501079_0341715 3300049741 Bacteria 1173
327 Ga0501080_0090973 3300049742 Bacteria 2834
328 Ga0501081_0036258 3300049743 Bacteria 3362
329 Ga0501083_0005761 3300049744 Bacteria 8767
330 Ga0501262_002652 3300049759 Bacteria 2022
331 Ga0501035_0007303 3300049822 Bacteria 10333
332 Ga0501035_0009010 3300049822 Bacteria 9280
333 Ga0501035_0022843 3300049822 Bacteria 5744
334 Ga0501044_0013034 3300049823 Bacteria 8998
335 Ga0501044_0032718 3300049823 Bacteria 5466
336 Ga0501044_0290445 3300049823 Bacteria 1566
337 Ga0501045_0042693 3300049824 Bacteria 3301
338 nmdc:mga03683_10601_c1 3300050489 Bacteria 3310
339 nmdc:mga03683_10673_c1 3300050489 Bacteria 3300
340 nmdc:mga03n38_54365_c1 3300050490 Bacteria 1799
341 nmdc:mga03n38_8675_c1 3300050490 Bacteria 3661
342 nmdc:mga00v17_33900_c1 3300050491 Bacteria 3029
343 nmdc:mga0yw44_57504_c1 3300050492 Bacteria 2373
344 nmdc:mga0k408_3020_c1 3300050493 Bacteria 8922
345 nmdc:mga0k408_36738_c1 3300050493 Bacteria 2812
346 nmdc:mga06z11_40680_c1 3300050494 Bacteria 2321
347 nmdc:mga07m45_1344_c1 3300050496 Bacteria 11210
348 nmdc:mga07m45_246_c1 3300050496 Bacteria 22038
349 nmdc:mga07m45_3901_c1 3300050496 Bacteria 7244
350 nmdc:mga07m45_5601_c1 3300050496 Bacteria 6272
351 nmdc:mga05p37_116256_c1 3300050507 Bacteria 3287
352 nmdc:mga08y16_310429_c1 3300050511 Bacteria 1624
353 nmdc:mga0sz30_57048_c1 3300050516 Bacteria 1664
354 Ga0500610_0000697 3300053079 Bacteria 10426
355 Ga0500643_000026 3300053087 Bacteria 259231
356 Ga0500643_001825 3300053087 Bacteria 11632
357 Ga0500651_0000028 3300053093 Bacteria 114592
358 Ga0500651_0101277 3300053093 Bacteria 1765
359 Ga0500566_0000678 3300053094 Bacteria 19108
360 Ga0500562_025697 3300053108 Bacteria 1542
361 Ga0500569_027456 3300053109 Bacteria 1569
362 Ga0500571_000350 3300053110 Bacteria 18224
363 Ga0500593_004706 3300053117 Bacteria 5319
364 Ga0500594_0001091 3300053118 Bacteria 5821
365 Ga0500595_008923 3300053119 Bacteria 4073
366 Ga0500595_010510 3300053119 Bacteria 3675
367 Ga0500607_006333 3300053121 Bacteria 7507
368 Ga0500608_013614 3300053122 Bacteria 3608
369 Ga0500618_013219 3300053125 Bacteria 2142
370 Ga0500655_000215 3300053133 Bacteria 13763
371 Ga0500658_0000764 3300053134 Bacteria 13251
372 Ga0500658_0003514 3300053134 Bacteria 5916
373 Ga0500658_0042074 3300053134 Bacteria 1835
374 Ga0500559_0015096 3300053136 Bacteria 3264
375 Ga0500568_0002845 3300053139 Bacteria 9976
376 Ga0500568_0034737 3300053139 Bacteria 2061
377 Ga0500574_013984 3300053141 Bacteria 1881
378 Ga0500590_013608 3300053148 Bacteria 4180
379 Ga0500627_0041207 3300053158 Bacteria 1984
380 Ga0500638_001409 3300053162 Bacteria 7507
381 Ga0500638_084254 3300053162 Bacteria 1506
382 Ga0501084_0115572 3300054114 Bacteria 2255
383 Ga0501082_0020129 3300060353 Bacteria 5750
384 Ga0501082_0085780 3300060353 Bacteria 2716
385 2511288311 2511231010 Bacteria 6373152
386 2513231889 2513020051 Bacteria 6053213
387 2513671508 2513237098 Bacteria 9902361
388 2513693549 2513237101 Bacteria 7952346
389 2524464812 2524023210 Bacteria 9029266
390 2599623011 2599185214 Bacteria 8209958
391 2599674658 2599185226 Bacteria 8233575
392 2599680615 2599185227 Bacteria 8246414
393 2599692630 2599185229 Bacteria 8216126
394 2644162026 2643221628 Bacteria 5745828
395 2644325297 2643221658 Bacteria 6064537
396 2644399034 2643221672 Bacteria 6322190
397 2644467302 2643221683 Bacteria 5749203
398 2723848442 2721755755 Bacteria 8322773
399 2738720906 2738541277 Bacteria 7458140
400 2738886348 2738541307 Bacteria 8606193
401 2739267631 2738543016 Bacteria 5657564
402 2739280105 2738543019 Bacteria 7459457
403 2793080992
404 2819602525 2818991446 Bacteria 7757362
405 2831272057 2831265667 Bacteria 7184833
406 2838059876 2838054893 Bacteria 7451788
407 2842677748 2842677519 Bacteria 5615038
408 2874609217 2874604998 Bacteria 7834745
409 2885198480 2885198086 Bacteria 7212419
410 2885212140 2885211737 Bacteria 7212420
411 2885388495 2885383462 Bacteria 9473874
412 2889036992 2889033259 Bacteria 9099371
413 2889038651 2889033259 Bacteria 9099371
414 2899928674 2899924645 Bacteria 7487985
415 2903773315 2903768456 Bacteria 9749579
416 2904452011 2904449895 Bacteria 6927402
417 2904458843 2904456579 Bacteria 6819253
418 2904547458 2904541872 Bacteria 8915136
419 2919467599 2919462493 Bacteria 5817112
420 2922363626 2922361189 Bacteria 7436256
421 2922392805 2922386360 Bacteria 7017218
422 2928043381 2928037797 Bacteria 7273642
423 2928050823 2928044640 Bacteria 7271509
424 2928056275 2928051484 Bacteria 7773759
425 2928066242 2928064002 Bacteria 7419480
426 2928075879 2928070936 Bacteria 8062541
427 2928090078 2928084124 Bacteria 7159212
428 2929165040 2929160207 Bacteria 9075316
429 2929523450 2929520902 Bacteria 6765052
430 2945910352 2945909444 Bacteria 7065066
431 2945946319 2945945610 Bacteria 5951079
432 2945975920 2945972063 Bacteria 6086495
433 2945987606 2945984333 Bacteria 7358892
434 2954768659 2954767861 Bacteria 5535784
435 8006967882 8006964411 Bacteria 8966052
436 8006988923 8006984368 Bacteria 9651211
437 8006999620 8006994254 Bacteria 8309700
438 8056676900 8056673599 Bacteria 7871253
439 8056683755 8056681323 Bacteria 8472857
440 Ga0316582_0219067
441 JGI24740J21852_10030794
442 JGI25152J39213_1004543
443 JGI25150J39212_1000830
444 JGI25151J46595_10011705
445 JGI25153J46596_10007821
446 rootH1_10046429
447 Ga0006562J51391_1073750
448 Ga0055525_1003271
449 Ga0055535_1000075
450 Ga0055542_1000059
451 Ga0055542_1000492
452 Ga0055526_1005342
453 Ga0055537_1000837
454 Ga0055537_1006347
455 Ga0055524_1002063
456 Ga0055536_1012972
457 Ga0055536_1022343
458 Ga0055534_1000736
459 Ga0055534_1006835
460 Ga0055528_1002672
461 Ga0055540_1013419
462 Ga0055541_1000400
463 Ga0065714_10081624
464 Ga0065704_10181552
465 Ga0070676_10201864
466 Ga0070683_100318551
467 Ga0068869_100122372
468 Ga0068868_100075276
469 Ga0068868_100315538
470 Ga0070689_100234804
471 Ga0070661_100018105
472 Ga0070668_100038744
473 Ga0070668_100153639
474 Ga0070669_100048663
475 Ga0070669_100098562
476 Ga0070659_100132942
477 Ga0070667_100030847
478 Ga0070667_100207945
479 Ga0070663_100199494
480 Ga0070678_100006298
481 Ga0070678_100099661
482 Ga0070662_100075115
483 Ga0070662_100184008
484 Ga0070681_10001556
485 Ga0070685_10015586
486 Ga0070699_100261424
487 Ga0070679_100048657
488 Ga0068853_100017694
489 Ga0068853_100053977
490 Ga0070665_100015331
491 Ga0068855_100197533
492 Ga0068854_100263736
493 Ga0070702_100115724
494 Ga0068861_100038336
495 Ga0068858_100129256
496 Ga0068860_100009962
497 Ga0068860_100245597
498 Ga0081540_1000373
499 Ga0081540_1000904
500 Ga0081539_10015306
501 Ga0075365_10039301
502 Ga0075365_10152165
503 Ga0075365_10189872
504 Ga0075363_100005081
505 Ga0075363_100015875
506 Ga0075363_100043973
507 Ga0075363_100080752
508 Ga0075364_10103684
509 Ga0075362_10116737
510 Ga0075370_10011621
511 Ga0075370_10013642
512 Ga0075428_100302855
513 Ga0075431_100505225
514 Ga0099826_10000504
515 Ga0099826_10052343
516 Ga0105244_10008305
517 Ga0105250_10011219
518 Ga0105240_10138574
519 Ga0105245_10126806
520 Ga0105245_10295607
521 Ga0105245_10358390
522 Ga0114129_10097158
523 Ga0105243_10001924
524 Ga0105243_10045835
525 Ga0105242_10251734
526 Ga0105237_10087650
527 Ga0105237_10091963
528 Ga0105238_10098758
529 Ga0105239_10074442
530 Ga0105246_10060672
531 Ga0157370_10035531
532 Ga0157369_10003782
533 Ga0157374_10248465
534 Ga0163162_10316130
535 Ga0163162_10390199
536 Ga0157372_10028982
537 Ga0157375_10114095
538 Ga0157375_10477532
539 Ga0163163_10561971
540 Ga0182008_10003982
541 Ga0182008_10030820
542 Ga0157376_10133491
543 Ga0182006_1006221
544 Ga0182006_1047574
545 Ga0182007_10001421
546 Ga0163161_10002814
547 Ga0163161_10257860
548 Ga0209674_100131
549 Ga0209672_100686
550 Ga0209147_100661
551 Ga0209563_104458
552 Ga0209258_100078
553 Ga0207425_1000247
554 Ga0209646_1000058
555 Ga0209148_1000043
556 Ga0209148_1000086
557 Ga0209759_1002890
558 Ga0209129_1000116
559 Ga0209129_1003553
560 Ga0209129_1005090
561 Ga0209565_1000353
562 Ga0209565_1000921
563 Ga0209673_1000190
564 Ga0209673_1002054
565 Ga0209130_1000635
566 Ga0209130_1000823
567 Ga0209675_1000038
568 Ga0209675_1000349
569 Ga0209676_1000125
570 Ga0209676_1001150
571 Ga0209025_1000238
572 Ga0209025_1000256
573 Ga0209025_1000293
574 Ga0209025_1011228
575 Ga0209564_1000201
576 Ga0209564_1000918
577 Ga0209758_1000034
578 Ga0209758_1004806
579 Ga0209758_1005668
580 Ga0209758_1009383
581 Ga0209050_1000012
582 Ga0209050_1021029
583 Ga0209256_1000677
584 Ga0209256_1000969
585 Ga0207426_1000244
586 Ga0207426_1000795
587 Ga0209051_1000524
588 Ga0209051_1002812
589 Ga0209257_1000024
590 Ga0207656_10001163
591 Ga0207655_1041766
592 Ga0207688_10065471
593 Ga0207645_10133104
594 Ga0207707_10009035
595 Ga0207695_10068981
596 Ga0207649_10010842
597 Ga0207652_10083387
598 Ga0207681_10100716
599 Ga0207694_10167209
600 Ga0207690_10023608
601 Ga0207709_10000393
602 Ga0207709_10000610
603 Ga0207709_10002972
604 Ga0207709_10026757
605 Ga0207689_10015143
606 Ga0207679_10156420
607 Ga0207712_10047420
608 Ga0207712_10079222
609 Ga0207668_10017167
610 Ga0207640_10185138
611 Ga0207658_10151413
612 Ga0207639_10016065
613 Ga0207639_10069576
614 Ga0207639_10155562
615 Ga0207678_10116956
616 Ga0207678_10160799
617 Ga0207648_10045959
618 Ga0207674_10113504
619 Ga0207683_10064868
620 Ga0209282_1000751
621 Ga0209282_1037163
622 Ga0268266_10000544
623 Ga0268266_10072738
624 Ga0268266_10254874
625 Ga0268265_10148035
626 Ga0268265_10384280
627 Ga0268264_10037322
628 Ga0307517_10123164
629 Ga0316177_1189767
630 Ga0314311_1075878
631 Ga0316180_1125658
632 Ga0316183_1055144
633 Ga0307509_10208169
634 Ga0307408_100284892
635 Ga0307516_10244600
636 Ga0307405_10070240
637 Ga0307405_10152474
638 Ga0307413_10038382
639 Ga0307410_10113967
640 Ga0307406_10004851
641 Ga0307406_10072345
642 Ga0307412_10036572
643 Ga0307412_10116253
644 Ga0307412_10282787
645 Ga0307416_100222281
646 Ga0307416_100327011
647 Ga0307411_10045350
648 Ga0307411_10115164
649 Ga0307415_100034576
650 Ga0307415_100195971
651 Ga0307415_100241145
652 Ga0307510_10004428
653 Ga0373931_0020425
654 Ga0373935_0233088
655 Ga0439466_0021704
656 Ga0439465_0013572
657 Ga0439465_0019809
658 Ga0451800_1505967
659 Ga0439442_004832
660 Ga0450898_012962
661 Ga0450906_020133
662 Ga0450910_001575
663 Ga0450908_008313
664 Ga0439434_0009637
665 Ga0450918_001535
666 Ga0466965_0025622
667 Ga0466957_0012425
668 Ga0495627_030027
669 Ga0495603_0014166
670 Ga0495629_0018559
671 Ga0495638_0028723
672 Ga0495638_0035509
673 Ga0495651_0018464
674 Ga0495653_0041874
675 Ga0495585_0078032
676 Ga0495608_0070542
677 Ga0495610_0030640
678 Ga0495616_0003489
679 Ga0495620_0010863
680 Ga0495631_0002133
681 Ga0495637_0028620
682 Ga0495652_0014113
683 Ga0495654_0031035
684 Ga0495656_0002595
685 Ga0495656_0014493
686 Ga0495668_0034699
687 Ga0495668_0092277
688 Ga0495634_0021794
689 Ga0495611_0115649
690 Ga0495625_0000317
691 Ga0495625_0009575
692 Ga0495625_0048587
693 Ga0495625_0069593
694 Ga0495625_0129951
695 Ga0495635_0001873
696 Ga0495661_0152012
697 Ga0495588_0021600
698 Ga0495657_0006464
699 Ga0495624_0010228
700 Ga0495671_0008968
701 Ga0495581_0031582
702 Ga0495604_0003570
703 Ga0495674_0244407
704 Ga0495672_0023819
705 Ga0495672_0044892
706 Ga0495676_0094010
707 Ga0495686_0208146
708 Ga0495602_0027002
709 Ga0495614_0089648
710 Ga0496100_0050567
711 Ga0496102_0049264
712 Ga0496102_0184469
713 Ga0496102_0256303
714 Ga0496104_0001785
715 Ga0496105_0010712
716 Ga0496106_0086583
717 Ga0496106_0196507
718 Ga0496108_0076893
719 Ga0496111_0410949
720 Ga0496114_0091418
721 Ga0496115_0363675
722 Ga0496116_0030763
723 Ga0496117_0020413
724 Ga0496118_0022408
725 Ga0496118_0074779
726 Ga0496119_0005077
727 Ga0496120_0004945
728 Ga0496121_0000657
729 Ga0496121_0015817
730 Ga0496121_0031555
731 Ga0496121_0064316
732 Ga0496122_0073088
733 Ga0496122_0089630
734 Ga0496123_0085320
735 Ga0496124_0003777
736 Ga0496124_0038288
737 Ga0496124_0080905
738 Ga0496125_0056895
739 Ga0496125_0095611
740 Ga0496125_0096287
741 Ga0496126_0002447
742 Ga0496126_0010928
743 Ga0496126_0138551
744 Ga0496126_0139919
745 Ga0496126_0229862
746 Ga0495678_031146
747 Ga0501037_0008623
748 Ga0501038_0030734
749 Ga0501038_0155448
750 Ga0501039_0013310
751 Ga0501039_0114018
752 Ga0501039_0195226
753 Ga0501040_0039424
754 Ga0501041_0028667
755 Ga0501046_0065067
756 Ga0501048_0060608
757 Ga0501070_0192525
758 Ga0501071_0072130
759 Ga0501074_0049862
760 Ga0501075_0095003
761 Ga0501076_0112031
762 Ga0501077_0033072
763 Ga0501249_003761
764 Ga0501225_0005379
765 Ga0501079_0341715
766 Ga0501080_0090973
767 Ga0501081_0036258
768 Ga0501083_0005761
769 Ga0501262_002652
770 Ga0501035_0007303
771 Ga0501035_0009010
772 Ga0501035_0022843
773 Ga0501044_0013034
774 Ga0501044_0032718
775 Ga0501044_0290445
776 Ga0501045_0042693
777 nmdc:mga03683_10601_c1
778 nmdc:mga03683_10673_c1
779 nmdc:mga03n38_54365_c1
780 nmdc:mga03n38_8675_c1
781 nmdc:mga00v17_33900_c1
782 nmdc:mga0yw44_57504_c1
783 nmdc:mga0k408_3020_c1
784 nmdc:mga0k408_36738_c1
785 nmdc:mga06z11_40680_c1
786 nmdc:mga07m45_1344_c1
787 nmdc:mga07m45_246_c1
788 nmdc:mga07m45_3901_c1
789 nmdc:mga07m45_5601_c1
790 nmdc:mga05p37_116256_c1
791 nmdc:mga08y16_310429_c1
792 nmdc:mga0sz30_57048_c1
793 Ga0500610_0000697
794 Ga0500643_000026
795 Ga0500643_001825
796 Ga0500651_0000028
797 Ga0500651_0101277
798 Ga0500566_0000678
799 Ga0500562_025697
800 Ga0500569_027456
801 Ga0500571_000350
802 Ga0500593_004706
803 Ga0500594_0001091
804 Ga0500595_008923
805 Ga0500595_010510
806 Ga0500607_006333
807 Ga0500608_013614
808 Ga0500618_013219
809 Ga0500655_000215
810 Ga0500658_0000764
811 Ga0500658_0003514
812 Ga0500658_0042074
813 Ga0500559_0015096
814 Ga0500568_0002845
815 Ga0500568_0034737
816 Ga0500574_013984
817 Ga0500590_013608
818 Ga0500627_0041207
819 Ga0500638_001409
820 Ga0500638_084254
821 Ga0501084_0115572
822 Ga0501082_0020129
823 Ga0501082_0085780
824 2511288311
825 2513231889
826 2513671508
827 2513693549
828 2524464812
829 2599623011
830 2599674658
831 2599680615
832 2599692630
833 2644162026
834 2644325297
835 2644399034
836 2644467302
837 2723848442
838 2738720906
839 2738886348
840 2739267631
841 2739280105
842 2793080992
843 2819602525
844 2831272057
845 2838059876
846 2842677748
847 2874609217
848 2885198480
849 2885212140
850 2885388495
851 2889036992
852 2889038651
853 2899928674
854 2903773315
855 2904452011
856 2904458843
857 2904547458
858 2919467599
859 2922363626
860 2922392805
861 2928043381
862 2928050823
863 2928056275
864 2928066242
865 2928075879
866 2928090078
867 2929165040
868 2929523450
869 2945910352
870 2945946319
871 2945975920
872 2945987606
873 2954768659
874 8006967882
875 8006988923
876 8006999620
877 8056676900
878 8056683755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01594

AI-2E_transport

AI-2E family transporter

14

347

0.93

Map