F444282

General Info

Members Datasets Scaffolds Average Seq Length
439 295 439 130

Family's Representative Sequence

Representative Sequence 3300046690|Ga0495624_0873657|Ga0495624_0873657_13_453
Length 146
Sequence MATWKRPPRKIAMLVEQDDRMPIRSSEDVVRVRQAVRARAVGAGLGLVDQTKIITAASEIARNTVNYGGGGEVRIEVLRDGSRRGVRLTFQDQGPGISDLTLALTDGYSTGSGLGLGLTGARRLCNEFDIHSAPGEGTTVVLARWK

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
280 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 2.96
Rhizosphere 96.13
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1008313 3300001977 Bacteria 1568
2 JGI24737J22298_10019777 3300001990 Bacteria 2153
3 JGI24743J22301_10025581 3300001991 Bacteria 1144
4 JGI24749J21850_1001177 3300002076 Bacteria 3708
5 JGI24744J21845_10082392 3300002077 Bacteria 588
6 JGI24034J26672_10022310 3300002239 Bacteria 1000
7 JGI24742J22300_10042580 3300002244 Bacteria 811
8 JGI24751J29686_10002625 3300002459 Bacteria 3611
9 Ga0065704_10071895 3300005289 Bacteria 9667
10 Ga0065712_10073698 3300005290 Bacteria 4305
11 Ga0070658_10000992 3300005327 Bacteria 24343
12 Ga0070658_10001180 3300005327 Bacteria 22343
13 Ga0070658_10202105 3300005327 Bacteria 1677
14 Ga0070658_10217825 3300005327 Bacteria 1614
15 Ga0070658_10379637 3300005327 Unclassified 1212
16 Ga0070676_10000049 3300005328 Bacteria 37836
17 Ga0070683_100598574 3300005329 Bacteria 1055
18 Ga0070690_100001148 3300005330 Bacteria 13634
19 Ga0070690_100298205 3300005330 Bacteria 1155
20 Ga0070670_100005605 3300005331 Bacteria 10593
21 Ga0070677_10000134 3300005333 Bacteria 24781
22 Ga0070677_10225820 3300005333 Bacteria 917
23 Ga0068869_100000696 3300005334 Bacteria 19024
24 Ga0068869_100177926 3300005334 Bacteria 1666
25 Ga0070666_10000394 3300005335 Bacteria 27450
26 Ga0070666_10316207 3300005335 Bacteria 1113
27 Ga0070680_100024189 3300005336 Bacteria 4848
28 Ga0070680_100028475 3300005336 Bacteria 4481
29 Ga0070680_101146833 3300005336 Bacteria 672
30 Ga0068868_100003766 3300005338 Bacteria 10593
31 Ga0068868_101520559 3300005338 Bacteria 627
32 Ga0070660_100000307 3300005339 Bacteria 32493
33 Ga0070689_100000860 3300005340 Bacteria 18871
34 Ga0070689_100329343 3300005340 Bacteria 1277
35 Ga0070691_10024186 3300005341 Bacteria 2823
36 Ga0070687_100000021 3300005343 Bacteria 52715
37 Ga0070661_100000275 3300005344 Bacteria 41665
38 Ga0070661_100792560 3300005344 Bacteria 777
39 Ga0070692_10007480 3300005345 Bacteria 4811
40 Ga0070668_100000879 3300005347 Bacteria 20893
41 Ga0070668_100495076 3300005347 Bacteria 1057
42 Ga0070669_100004057 3300005353 Bacteria 10593
43 Ga0070669_100711147 3300005353 Bacteria 849
44 Ga0070675_100001297 3300005354 Bacteria 18273
45 Ga0070675_101882874 3300005354 Bacteria 552
46 Ga0070671_100001340 3300005355 Bacteria 18459
47 Ga0070671_100778633 3300005355 Bacteria 832
48 Ga0070674_100000604 3300005356 Bacteria 18161
49 Ga0070674_100232599 3300005356 Bacteria 1439
50 Ga0070673_100000776 3300005364 Bacteria 17745
51 Ga0070673_100037590 3300005364 Bacteria 3690
52 Ga0070688_100000455 3300005365 Bacteria 20736
53 Ga0070659_100000146 3300005366 Bacteria 54086
54 Ga0070667_100005480 3300005367 Bacteria 10593
55 Ga0070667_100251125 3300005367 Bacteria 1581
56 Ga0070703_10109803 3300005406 Bacteria 985
57 Ga0070709_10030079 3300005434 Bacteria 3256
58 Ga0070709_10556518 3300005434 Bacteria 878
59 Ga0070714_100681479 3300005435 Bacteria 991
60 Ga0070713_100007391 3300005436 Bacteria 7707
61 Ga0070710_10080199 3300005437 Bacteria 1903
62 Ga0070710_10084739 3300005437 Bacteria 1857
63 Ga0070710_10220323 3300005437 Bacteria 1207
64 Ga0070711_100005208 3300005439 Bacteria 7756
65 Ga0070705_100000514 3300005440 Bacteria 22376
66 Ga0070700_100003107 3300005441 Bacteria 8515
67 Ga0070663_100002068 3300005455 Bacteria 11201
68 Ga0070678_100006026 3300005456 Bacteria 7069
69 Ga0070662_100002769 3300005457 Bacteria 10846
70 Ga0070681_10400891 3300005458 Bacteria 1283
71 Ga0068867_100001051 3300005459 Bacteria 18831
72 Ga0068867_100156754 3300005459 Bacteria 1793
73 Ga0070685_10000788 3300005466 Bacteria 17191
74 Ga0070679_100000928 3300005530 Bacteria 25490
75 Ga0070679_100150510 3300005530 Bacteria 2304
76 Ga0070684_100004673 3300005535 Bacteria 10458
77 Ga0070684_100049842 3300005535 Bacteria 3636
78 Ga0070684_100050704 3300005535 Bacteria 3606
79 Ga0070684_100055313 3300005535 Unclassified 3459
80 Ga0070684_100174336 3300005535 Bacteria 1954
81 Ga0070684_101839048 3300005535 Bacteria 571
82 Ga0068853_100002643 3300005539 Bacteria 13500
83 Ga0070672_100002220 3300005543 Bacteria 12228
84 Ga0070686_100000964 3300005544 Bacteria 16582
85 Ga0070695_100035713 3300005545 Bacteria 3123
86 Ga0070696_100018157 3300005546 Bacteria 4752
87 Ga0070693_100701612 3300005547 Bacteria 741
88 Ga0070665_100008178 3300005548 Bacteria 10593
89 Ga0070665_100053360 3300005548 Unclassified 4054
90 Ga0070704_100007177 3300005549 Bacteria 6622
91 Ga0070704_100785658 3300005549 Bacteria 850
92 Ga0068855_100002538 3300005563 Bacteria 22484
93 Ga0068855_101103415 3300005563 Bacteria 829
94 Ga0070664_100004233 3300005564 Bacteria 11543
95 Ga0070664_100035595 3300005564 Bacteria 4180
96 Ga0070664_101354773 3300005564 Bacteria 672
97 Ga0068857_100001946 3300005577 Bacteria 16673
98 Ga0068854_100001076 3300005578 Bacteria 16440
99 Ga0068856_100002406 3300005614 Bacteria 19258
100 Ga0070702_100002469 3300005615 Bacteria 7996
101 Ga0070702_100913128 3300005615 Bacteria 688
102 Ga0068852_100003552 3300005616 Bacteria 10910
103 Ga0068852_100636502 3300005616 Bacteria 1073
104 Ga0068852_101113092 3300005616 Bacteria 810
105 Ga0068859_100003568 3300005617 Bacteria 15854
106 Ga0068859_100231214 3300005617 Bacteria 1937
107 Ga0068859_101904523 3300005617 Bacteria 657
108 Ga0068864_100000267 3300005618 Bacteria 46395
109 Ga0068866_10000293 3300005718 Bacteria 23883
110 Ga0068861_100001152 3300005719 Bacteria 16465
111 Ga0068861_102289053 3300005719 Bacteria 542
112 Ga0068851_10002548 3300005834 Bacteria 8017
113 Ga0068851_11047513 3300005834 Bacteria 516
114 Ga0068870_10000014 3300005840 Bacteria 63363
115 Ga0068870_10231493 3300005840 Bacteria 1136
116 Ga0068863_100001125 3300005841 Bacteria 26723
117 Ga0068863_100195043 3300005841 Bacteria 1947
118 Ga0068863_100286691 3300005841 Bacteria 1596
119 Ga0068858_100002425 3300005842 Bacteria 18880
120 Ga0068860_100007933 3300005843 Bacteria 10593
121 Ga0068860_100088217 3300005843 Bacteria 2953
122 Ga0068860_100334658 3300005843 Bacteria 1488
123 Ga0068862_100002595 3300005844 Bacteria 15955
124 Ga0081540_1010115 3300005983 Bacteria 6420
125 Ga0081540_1049321 3300005983 Bacteria 2101
126 Ga0070717_10193727 3300006028 Bacteria 1777
127 Ga0075364_10107583 3300006051 Bacteria 1859
128 Ga0075432_10041117 3300006058 Bacteria 1614
129 Ga0070715_10051443 3300006163 Bacteria 1773
130 Ga0070716_100056676 3300006173 Bacteria 2248
131 Ga0070712_100012551 3300006175 Bacteria 5387
132 Ga0070712_100667736 3300006175 Bacteria 884
133 Ga0097621_100007806 3300006237 Bacteria 7677
134 Ga0097621_100069093 3300006237 Bacteria 2916
135 Ga0097621_100727280 3300006237 Bacteria 915
136 Ga0068871_100008918 3300006358 Bacteria 7236
137 Ga0075430_100350775 3300006846 Bacteria 1219
138 Ga0075431_100126546 3300006847 Bacteria 2636
139 Ga0075433_10149918 3300006852 Bacteria 2074
140 Ga0075434_100002404 3300006871 Bacteria 16437
141 Ga0068865_100001006 3300006881 Bacteria 16181
142 Ga0097620_100003569 3300006931 Bacteria 15854
143 Ga0097620_100231215 3300006931 Bacteria 1937
144 Ga0097620_101904570 3300006931 Bacteria 657
145 Ga0075435_100033993 3300007076 Bacteria 4036
146 Ga0075435_100125103 3300007076 Bacteria 2148
147 Ga0075435_100699382 3300007076 Bacteria 881
148 Ga0105244_10518864 3300009036 Unclassified 549
149 Ga0105250_10033885 3300009092 Bacteria 2050
150 Ga0105240_10002245 3300009093 Bacteria 31383
151 Ga0105240_10005551 3300009093 Bacteria 18769
152 Ga0111539_10014741 3300009094 Bacteria 9750
153 Ga0111539_10032830 3300009094 Bacteria 6303
154 Ga0105245_10003327 3300009098 Bacteria 14428
155 Ga0105245_12457019 3300009098 Bacteria 574
156 Ga0105247_10002337 3300009101 Bacteria 12944
157 Ga0114129_11684620 3300009147 Bacteria 774
158 Ga0105243_10003979 3300009148 Bacteria 11781
159 Ga0105243_10264756 3300009148 Bacteria 1541
160 Ga0105241_10006472 3300009174 Bacteria 8635
161 Ga0105241_12592376 3300009174 Unclassified 509
162 Ga0105242_10001831 3300009176 Bacteria 16694
163 Ga0105242_10045491 3300009176 Bacteria 3557
164 Ga0105242_11961024 3300009176 Unclassified 627
165 Ga0105248_10001907 3300009177 Bacteria 23133
166 Ga0105248_10273331 3300009177 Bacteria 1903
167 Ga0105248_11797969 3300009177 Unclassified 695
168 Ga0105237_10000920 3300009545 Bacteria 39577
169 Ga0105237_10420151 3300009545 Bacteria 1342
170 Ga0105238_10000349 3300009551 Bacteria 49771
171 Ga0105238_10540517 3300009551 Bacteria 1169
172 Ga0105238_10886137 3300009551 Bacteria 910
173 Ga0105249_10000378 3300009553 Bacteria 44184
174 Ga0105249_10293271 3300009553 Bacteria 1629
175 Ga0105249_10858522 3300009553 Bacteria 973
176 Ga0105249_12319854 3300009553 Unclassified 609
177 Ga0105239_10000911 3300010375 Bacteria 41958
178 Ga0105239_11182734 3300010375 Bacteria 881
179 Ga0105246_10007207 3300011119 Bacteria 6813
180 Ga0157326_1000516 3300012513 Bacteria 4598
181 Ga0157373_10000740 3300013100 Bacteria 25321
182 Ga0157371_10001951 3300013102 Bacteria 20507
183 Ga0157369_10000611 3300013105 Bacteria 46408
184 Ga0157374_10053862 3300013296 Bacteria 3752
185 Ga0157378_10001378 3300013297 Bacteria 21821
186 Ga0163162_10002286 3300013306 Bacteria 17999
187 Ga0163162_10897423 3300013306 Bacteria 1000
188 Ga0163162_12944009 3300013306 Bacteria 548
189 Ga0157372_10001256 3300013307 Bacteria 27447
190 Ga0157372_11285156 3300013307 Bacteria 844
191 Ga0157375_10003080 3300013308 Bacteria 14473
192 Ga0163163_10019859 3300014325 Bacteria 6319
193 Ga0163163_10485898 3300014325 Bacteria 1296
194 Ga0163163_12252994 3300014325 Bacteria 604
195 Ga0157380_10082040 3300014326 Bacteria 2639
196 Ga0157380_10132440 3300014326 Bacteria 2129
197 Ga0182008_10255241 3300014497 Bacteria 905
198 Ga0157377_10003502 3300014745 Bacteria 7107
199 Ga0157379_10006844 3300014968 Bacteria 9853
200 Ga0157379_10096539 3300014968 Bacteria 2653
201 Ga0157379_10126777 3300014968 Bacteria 2297
202 Ga0157376_10001171 3300014969 Bacteria 17243
203 Ga0157376_10209228 3300014969 Bacteria 1800
204 Ga0157376_11499846 3300014969 Bacteria 707
205 Ga0207697_10000456 3300025315 Bacteria 23062
206 Ga0207656_10000072 3300025321 Bacteria 37238
207 Ga0207653_10080254 3300025885 Bacteria 1128
208 Ga0207682_10000241 3300025893 Bacteria 24805
209 Ga0207692_10019547 3300025898 Bacteria 3063
210 Ga0207692_10086153 3300025898 Bacteria 1692
211 Ga0207642_10003513 3300025899 Bacteria 4957
212 Ga0207710_10001308 3300025900 Bacteria 12581
213 Ga0207688_10000008 3300025901 Bacteria 62580
214 Ga0207680_10002146 3300025903 Bacteria 9249
215 Ga0207680_10308483 3300025903 Bacteria 1104
216 Ga0207647_10001413 3300025904 Bacteria 18437
217 Ga0207685_10011544 3300025905 Bacteria 2659
218 Ga0207699_10056065 3300025906 Bacteria 2347
219 Ga0207645_10000008 3300025907 Bacteria 158682
220 Ga0207643_10000008 3300025908 Bacteria 163521
221 Ga0207643_10443796 3300025908 Bacteria 825
222 Ga0207705_10005175 3300025909 Bacteria 9778
223 Ga0207705_10065630 3300025909 Bacteria 2624
224 Ga0207705_10172190 3300025909 Bacteria 1630
225 Ga0207705_10379342 3300025909 Bacteria 1092
226 Ga0207654_10002231 3300025911 Bacteria 9951
227 Ga0207707_10042145 3300025912 Bacteria 3986
228 Ga0207707_10383500 3300025912 Bacteria 1208
229 Ga0207695_10009830 3300025913 Bacteria 11755
230 Ga0207695_10018237 3300025913 Bacteria 8122
231 Ga0207671_10015742 3300025914 Bacteria 5908
232 Ga0207671_10988725 3300025914 Bacteria 663
233 Ga0207693_10010294 3300025915 Bacteria 7590
234 Ga0207663_10042416 3300025916 Bacteria 2779
235 Ga0207660_10013606 3300025917 Bacteria 5335
236 Ga0207660_10032477 3300025917 Bacteria 3603
237 Ga0207662_10000012 3300025918 Bacteria 90502
238 Ga0207662_10714294 3300025918 Bacteria 703
239 Ga0207657_10000094 3300025919 Bacteria 85112
240 Ga0207649_10001557 3300025920 Bacteria 13418
241 Ga0207649_10690744 3300025920 Bacteria 791
242 Ga0207652_10026299 3300025921 Bacteria 4845
243 Ga0207652_10088054 3300025921 Bacteria 2724
244 Ga0207681_10001267 3300025923 Bacteria 16299
245 Ga0207681_10799112 3300025923 Bacteria 788
246 Ga0207694_10003107 3300025924 Bacteria 13280
247 Ga0207694_10603687 3300025924 Bacteria 923
248 Ga0207650_10000222 3300025925 Bacteria 64400
249 Ga0207650_10150589 3300025925 Bacteria 1836
250 Ga0207659_10000194 3300025926 Bacteria 36228
251 Ga0207687_10012010 3300025927 Bacteria 5665
252 Ga0207700_10042158 3300025928 Bacteria 3344
253 Ga0207700_10075594 3300025928 Bacteria 2611
254 Ga0207644_10001867 3300025931 Bacteria 13702
255 Ga0207644_10187655 3300025931 Bacteria 1624
256 Ga0207690_10004972 3300025932 Bacteria 7850
257 Ga0207706_10000118 3300025933 Bacteria 84834
258 Ga0207686_10016004 3300025934 Bacteria 4203
259 Ga0207670_10000192 3300025936 Bacteria 40572
260 Ga0207669_10001198 3300025937 Bacteria 11035
261 Ga0207704_10001160 3300025938 Bacteria 11731
262 Ga0207665_10127602 3300025939 Bacteria 1802
263 Ga0207691_10000074 3300025940 Bacteria 83272
264 Ga0207711_10003833 3300025941 Bacteria 12935
265 Ga0207711_10210258 3300025941 Bacteria 1777
266 Ga0207689_10000093 3300025942 Bacteria 72709
267 Ga0207689_10067781 3300025942 Bacteria 2932
268 Ga0207661_10003792 3300025944 Bacteria 10540
269 Ga0207661_10015997 3300025944 Bacteria 5529
270 Ga0207661_10599127 3300025944 Bacteria 1011
271 Ga0207679_10001995 3300025945 Bacteria 12665
272 Ga0207679_10004827 3300025945 Bacteria 8405
273 Ga0207667_10009673 3300025949 Bacteria 11340
274 Ga0207651_10000037 3300025960 Bacteria 63878
275 Ga0207712_10002932 3300025961 Bacteria 10897
276 Ga0207668_10002925 3300025972 Bacteria 10021
277 Ga0207668_10993262 3300025972 Bacteria 750
278 Ga0207640_10005156 3300025981 Bacteria 7105
279 Ga0207658_10000162 3300025986 Bacteria 71223
280 Ga0207658_10307178 3300025986 Bacteria 1369
281 Ga0207658_11000254 3300025986 Bacteria 763
282 Ga0207677_10000149 3300026023 Bacteria 56199
283 Ga0207703_10000718 3300026035 Bacteria 32659
284 Ga0207639_10002522 3300026041 Bacteria 12280
285 Ga0207678_10004557 3300026067 Bacteria 12467
286 Ga0207708_10004377 3300026075 Bacteria 10406
287 Ga0207702_10002848 3300026078 Bacteria 16174
288 Ga0207641_10003922 3300026088 Bacteria 13008
289 Ga0207641_10718030 3300026088 Bacteria 985
290 Ga0207648_10000183 3300026089 Bacteria 66175
291 Ga0207648_10480403 3300026089 Unclassified 1135
292 Ga0207676_10004944 3300026095 Bacteria 9447
293 Ga0207674_10005861 3300026116 Bacteria 14562
294 Ga0207675_100000008 3300026118 Bacteria 182355
295 Ga0207683_10000629 3300026121 Bacteria 32310
296 Ga0207698_10001829 3300026142 Bacteria 12438
297 Ga0207698_10261377 3300026142 Bacteria 1590
298 Ga0207428_10005681 3300027907 Bacteria 11589
299 Ga0207428_10051835 3300027907 Bacteria 3279
300 Ga0268266_10000447 3300028379 Bacteria 61156
301 Ga0268266_10258832 3300028379 Bacteria 1612
302 Ga0268266_10465874 3300028379 Bacteria 1203
303 Ga0268265_10000207 3300028380 Bacteria 68399
304 Ga0268264_10001769 3300028381 Bacteria 19752
305 Ga0268264_10055417 3300028381 Bacteria 3313
306 Ga0268264_10160821 3300028381 Bacteria 2023
307 Ga0265760_10022980 3300031090 Bacteria 1809
308 Ga0307408_100005628 3300031548 Bacteria 8378
309 Ga0307413_10019524 3300031824 Bacteria 3584
310 Ga0307410_10122544 3300031852 Bacteria 1898
311 Ga0307406_10194499 3300031901 Bacteria 1488
312 Ga0307407_10088339 3300031903 Bacteria 1893
313 Ga0307407_10369007 3300031903 Bacteria 1021
314 Ga0307409_100091681 3300031995 Bacteria 2491
315 Ga0307409_100255370 3300031995 Bacteria 1605
316 Ga0307409_100286391 3300031995 Bacteria 1526
317 Ga0307409_100660832 3300031995 Bacteria 1040
318 Ga0307416_100017738 3300032002 Bacteria 4991
319 Ga0307416_101749666 3300032002 Bacteria 726
320 Ga0307414_10026505 3300032004 Bacteria 3731
321 Ga0307411_10014298 3300032005 Bacteria 4411
322 Ga0373930_0172631 3300034816 Bacteria 552
323 Ga0373938_0220916 3300034957 Bacteria 532
324 Ga0373934_0020040 3300035086 Bacteria 2571
325 Ga0373923_0195953 3300035111 Bacteria 932
326 Ga0373932_0087372 3300035112 Bacteria 995
327 Ga0373932_0115388 3300035112 Bacteria 890
328 Ga0373936_0444435 3300035113 Unclassified 599
329 Ga0373936_0498015 3300035113 Bacteria 566
330 Ga0373939_0010849 3300035114 Bacteria 2289
331 Ga0373939_0055266 3300035114 Bacteria 1246
332 Ga0373953_0117496 3300035117 Bacteria 1128
333 Ga0373954_0009530 3300035118 Bacteria 4272
334 Ga0373956_0002393 3300035119 Bacteria 7665
335 Ga0373957_0079629 3300035120 Bacteria 1292
336 Ga0373943_0054622 3300035170 Bacteria 1976
337 Ga0373955_0155867 3300035172 Bacteria 1345
338 Ga0373942_0289261 3300035207 Bacteria 566
339 Ga0373962_0052357 3300035242 Bacteria 1179
340 Ga0373924_0040459 3300035410 Bacteria 1908
341 Ga0373931_0902537 3300035691 Bacteria 594
342 Ga0373935_0910828 3300035692 Bacteria 651
343 Ga0373927_0114629 3300035695 Bacteria 1757
344 Ga0373927_0806093 3300035695 Bacteria 620
345 Ga0373933_0077144 3300035724 Bacteria 2036
346 Ga0373933_0154748 3300035724 Bacteria 1454
347 Ga0373937_0008558 3300036401 Bacteria 8888
348 Ga0373925_0366580 3300037068 Bacteria 1171
349 Ga0395900_0177921 3300037418 Bacteria 2163
350 Ga0395898_1258280 3300037466 Unclassified 670
351 Ga0395901_1058581 3300038443 Bacteria 784
352 Ga0436360_0401191 3300039438 Bacteria 1459
353 Ga0466960_0005392 3300044901 Bacteria 5065
354 Ga0466959_0258502 3300045049 Bacteria 1199
355 Ga0466959_0485321 3300045049 Bacteria 836
356 Ga0466967_0178027 3300045976 Bacteria 2004
357 Ga0495592_0122757 3300046454 Bacteria 1825
358 Ga0495651_0233755 3300046462 Bacteria 1264
359 Ga0495653_0096896 3300046463 Bacteria 2144
360 Ga0495639_0061952 3300046475 Bacteria 1716
361 Ga0495662_0164270 3300046476 Bacteria 1094
362 Ga0495664_0005981 3300046477 Bacteria 6706
363 Ga0495608_0005395 3300046511 Bacteria 9135
364 Ga0495618_0178368 3300046514 Bacteria 1350
365 Ga0495618_0207540 3300046514 Bacteria 1239
366 Ga0495628_0081816 3300046516 Bacteria 2508
367 Ga0495628_0329760 3300046516 Bacteria 1125
368 Ga0495630_0634140 3300046517 Bacteria 819
369 Ga0495652_0067895 3300046529 Bacteria 2988
370 Ga0495640_0042844 3300046533 Bacteria 3155
371 Ga0495587_0003175 3300046536 Bacteria 10986
372 Ga0495645_0000553 3300046543 Bacteria 25656
373 Ga0495667_0088314 3300046559 Bacteria 2009
374 Ga0495667_0581342 3300046559 Bacteria 698
375 Ga0495635_0030142 3300046663 Bacteria 3770
376 Ga0495657_0024863 3300046675 Bacteria 4258
377 Ga0495599_0030466 3300046678 Bacteria 3384
378 Ga0495599_0263786 3300046678 Bacteria 1046
379 Ga0495623_0064433 3300046679 Bacteria 2293
380 Ga0495646_0005995 3300046680 Bacteria 7704
381 Ga0495658_0501302 3300046683 Bacteria 777
382 Ga0495624_0873657 3300046690 Bacteria 530
383 Ga0495604_0072638 3300047317 Bacteria 2599
384 Ga0495674_0479040 3300047319 Bacteria 997
385 Ga0495680_0054414 3300047322 Bacteria 3108
386 Ga0495675_0005326 3300047444 Bacteria 7840
387 Ga0495684_0010303 3300047471 Bacteria 7231
388 Ga0495602_0005535 3300048088 Bacteria 13252
389 Ga0495602_0254121 3300048088 Bacteria 1308
390 Ga0496100_0056356 3300048903 Bacteria 2571
391 Ga0496100_0629785 3300048903 Bacteria 834
392 Ga0496102_0004945 3300048905 Bacteria 11293
393 Ga0496103_0086607 3300048906 Bacteria 1975
394 Ga0496103_0263542 3300048906 Bacteria 1109
395 Ga0496104_0459273 3300048907 Bacteria 1185
396 Ga0496106_0003161 3300048909 Bacteria 12295
397 Ga0496107_0014893 3300048910 Bacteria 5445
398 Ga0496107_1102311 3300048910 Unclassified 573
399 Ga0496109_0006943 3300048912 Bacteria 9557
400 Ga0496111_0470192 3300048914 Bacteria 927
401 Ga0496112_0000430 3300048915 Bacteria 27772
402 Ga0496113_0017831 3300048916 Bacteria 4935
403 Ga0496126_0085345 3300048929 Bacteria 2783
404 Ga0496126_0286445 3300048929 Bacteria 1363
405 Ga0501031_0657617 3300049568 Bacteria 673
406 Ga0501036_0103141 3300049572 Bacteria 2413
407 Ga0501039_0325569 3300049575 Bacteria 1208
408 Ga0501039_1225910 3300049575 Bacteria 580
409 Ga0501040_0271596 3300049576 Bacteria 1211
410 Ga0501068_0279500 3300049584 Bacteria 1067
411 Ga0501071_1380366 3300049587 Bacteria 544
412 Ga0501072_1165501 3300049588 Bacteria 599
413 Ga0501076_0030469 3300049592 Bacteria 4202
414 Ga0501076_0055941 3300049592 Bacteria 3130
415 Ga0501077_0240074 3300049593 Bacteria 1152
416 Ga0501199_009386 3300049650 Bacteria 1034
417 Ga0501209_073241 3300049656 Bacteria 977
418 Ga0501080_0423867 3300049742 Bacteria 1195
419 Ga0501080_1572272 3300049742 Bacteria 557
420 Ga0501268_001391 3300049765 Bacteria 3013
421 nmdc:mga00v17_96815_c1 3300050491 Bacteria 1859
422 nmdc:mga05p37_70774_c1 3300050507 Bacteria 1689
423 nmdc:mga08y16_134786_c1 3300050511 Bacteria 2567
424 nmdc:mga08y16_40075_c1 3300050511 Bacteria 4912
425 nmdc:mga0n895_2115_c1 3300050512 Bacteria 15326
426 nmdc:mga0rr50_30630_c1 3300050513 Bacteria 3811
427 nmdc:mga0rr50_564907_c1 3300050513 Bacteria 969
428 nmdc:mga08x19_1276617_c1 3300050514 Unclassified 520
429 nmdc:mga0a205_3719_c1 3300050515 Bacteria 5205
430 Ga0495601_0005040 3300053077 Bacteria 7667
431 Ga0495601_0121762 3300053077 Bacteria 1695
432 Ga0495612_0001349 3300053078 Bacteria 10114
433 Ga0495595_0060142 3300053084 Bacteria 1778
434 Ga0495619_0072590 3300053085 Bacteria 2305
435 Ga0501084_0026883 3300054114 Bacteria 4807
436 Ga0501084_0411136 3300054114 Bacteria 1144
437 Ga0501082_0066915 3300060353 Bacteria 3094
438 Ga0501082_0659399 3300060353 Bacteria 916
439 Ga0501082_1588723 3300060353 Bacteria 571

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100177926 Ga0068869_1001779262 110
2 3300005617 Ga0068859_101904523 Ga0068859_1019045232 110
3 3300005841 Ga0068863_100195043 Ga0068863_1001950432 110
4 3300005843 Ga0068860_100088217 Ga0068860_1000882173 110
5 3300006931 Ga0097620_101904570 Ga0097620_1019045702 110
6 3300025942 Ga0207689_10067781 Ga0207689_100677814 110
7 3300026088 Ga0207641_10718030 Ga0207641_107180302 110
8 3300028381 Ga0268264_10055417 Ga0268264_100554173 110
9 3300049584 Ga0501068_0279500 Ga0501068_0279500_660_1013 117
10 3300049588 Ga0501072_1165501 Ga0501072_1165501_199_552 117
11 3300049592 Ga0501076_0030469 Ga0501076_0030469_1109_1462 117
12 3300049742 Ga0501080_1572272 Ga0501080_1572272_104_457 117
13 3300054114 Ga0501084_0411136 Ga0501084_0411136_240_593 117
14 3300009036 Ga0105244_10518864 Ga0105244_105188641 118
15 3300009092 Ga0105250_10033885 Ga0105250_100338853 118
16 3300009093 Ga0105240_10002245 Ga0105240_1000224527 118
17 3300009098 Ga0105245_10003327 Ga0105245_100033275 118
18 3300009101 Ga0105247_10002337 Ga0105247_100023375 118
19 3300009148 Ga0105243_10003979 Ga0105243_100039793 118
20 3300009174 Ga0105241_10006472 Ga0105241_100064725 118
21 3300009176 Ga0105242_10001831 Ga0105242_100018313 118
22 3300009177 Ga0105248_10001907 Ga0105248_1000190715 118
23 3300009545 Ga0105237_10000920 Ga0105237_1000092031 118
24 3300009551 Ga0105238_10000349 Ga0105238_1000034926 118
25 3300009553 Ga0105249_10000378 Ga0105249_1000037815 118
26 3300010375 Ga0105239_10000911 Ga0105239_1000091129 118
27 3300011119 Ga0105246_10007207 Ga0105246_100072072 118
28 3300013100 Ga0157373_10000740 Ga0157373_1000074012 118
29 3300013102 Ga0157371_10001951 Ga0157371_1000195112 118
30 3300013105 Ga0157369_10000611 Ga0157369_1000061131 118
31 3300013296 Ga0157374_10053862 Ga0157374_100538624 118
32 3300013297 Ga0157378_10001378 Ga0157378_100013788 118
33 3300013306 Ga0163162_10002286 Ga0163162_100022866 118
34 3300013307 Ga0157372_10001256 Ga0157372_1000125625 118
35 3300013308 Ga0157375_10003080 Ga0157375_100030807 118
36 3300014325 Ga0163163_10019859 Ga0163163_100198598 118
37 3300014326 Ga0157380_10082040 Ga0157380_100820402 118
38 3300014745 Ga0157377_10003502 Ga0157377_1000350210 118
39 3300014968 Ga0157379_10006844 Ga0157379_1000684410 118
40 3300014969 Ga0157376_10001171 Ga0157376_1000117115 118
41 3300048903 Ga0496100_0056356 Ga0496100_0056356_1348_1704 118
42 3300048905 Ga0496102_0004945 Ga0496102_0004945_4408_4764 118
43 3300048906 Ga0496103_0086607 Ga0496103_0086607_679_1035 118
44 3300048907 Ga0496104_0459273 Ga0496104_0459273_352_708 118
45 3300048909 Ga0496106_0003161 Ga0496106_0003161_7354_7710 118
46 3300048910 Ga0496107_0014893 Ga0496107_0014893_4427_4783 118
47 3300048912 Ga0496109_0006943 Ga0496109_0006943_8048_8404 118
48 3300048915 Ga0496112_0000430 Ga0496112_0000430_14936_15292 118
49 3300048916 Ga0496113_0017831 Ga0496113_0017831_4087_4443 118
50 3300050513 nmdc:mga0rr50_564907_c1 nmdc:mga0rr50_564907_c1_12_368 118
51 3300005615 Ga0070702_100913128 Ga0070702_1009131281 124
52 3300049593 Ga0501077_0240074 Ga0501077_0240074_435_809 124
53 3300005355 Ga0070671_100778633 Ga0070671_1007786332 125
54 3300014325 Ga0163163_10485898 Ga0163163_104858983 125
55 3300025931 Ga0207644_10187655 Ga0207644_101876552 125
56 3300005327 Ga0070658_10000992 Ga0070658_1000099235 126
57 3300005333 Ga0070677_10225820 Ga0070677_102258202 126
58 3300005367 Ga0070667_100251125 Ga0070667_1002511252 126
59 3300005434 Ga0070709_10030079 Ga0070709_100300794 126
60 3300005435 Ga0070714_100681479 Ga0070714_1006814792 126
61 3300005436 Ga0070713_100007391 Ga0070713_1000073913 126
62 3300005437 Ga0070710_10084739 Ga0070710_100847393 126
63 3300005437 Ga0070710_10220323 Ga0070710_102203231 126
64 3300005439 Ga0070711_100005208 Ga0070711_1000052082 126
65 3300005563 Ga0068855_101103415 Ga0068855_1011034152 126
66 3300005983 Ga0081540_1010115 Ga0081540_10101154 126
67 3300006163 Ga0070715_10051443 Ga0070715_100514433 126
68 3300006173 Ga0070716_100056676 Ga0070716_1000566762 126
69 3300006175 Ga0070712_100012551 Ga0070712_1000125515 126
70 3300006237 Ga0097621_100069093 Ga0097621_1000690933 126
71 3300006237 Ga0097621_100727280 Ga0097621_1007272802 126
72 3300009094 Ga0111539_10014741 Ga0111539_100147418 126
73 3300009176 Ga0105242_10045491 Ga0105242_100454915 126
74 3300009177 Ga0105248_10273331 Ga0105248_102733312 126
75 3300009177 Ga0105248_11797969 Ga0105248_117979692 126
76 3300009551 Ga0105238_10886137 Ga0105238_108861372 126
77 3300014969 Ga0157376_10209228 Ga0157376_102092283 126
78 3300025898 Ga0207692_10019547 Ga0207692_100195472 126
79 3300025903 Ga0207680_10308483 Ga0207680_103084832 126
80 3300025905 Ga0207685_10011544 Ga0207685_100115442 126
81 3300025906 Ga0207699_10056065 Ga0207699_100560652 126
82 3300025914 Ga0207671_10988725 Ga0207671_109887252 126
83 3300025915 Ga0207693_10010294 Ga0207693_100102945 126
84 3300025916 Ga0207663_10042416 Ga0207663_100424162 126
85 3300025924 Ga0207694_10603687 Ga0207694_106036872 126
86 3300025928 Ga0207700_10042158 Ga0207700_100421583 126
87 3300025939 Ga0207665_10127602 Ga0207665_101276023 126
88 3300025941 Ga0207711_10210258 Ga0207711_102102582 126
89 3300025986 Ga0207658_10307178 Ga0207658_103071783 126
90 3300031901 Ga0307406_10194499 Ga0307406_101944992 126
91 3300031903 Ga0307407_10369007 Ga0307407_103690072 126
92 3300031995 Ga0307409_100286391 Ga0307409_1002863912 126
93 3300031995 Ga0307409_100660832 Ga0307409_1006608322 126
94 3300032002 Ga0307416_100017738 Ga0307416_1000177387 126
95 3300032002 Ga0307416_101749666 Ga0307416_1017496662 126
96 3300035086 Ga0373934_0020040 Ga0373934_0020040_1334_1738 126
97 3300035111 Ga0373923_0195953 Ga0373923_0195953_419_823 126
98 3300035113 Ga0373936_0444435 Ga0373936_0444435_92_496 126
99 3300035113 Ga0373936_0498015 Ga0373936_0498015_69_485 126
100 3300035117 Ga0373953_0117496 Ga0373953_0117496_170_574 126
101 3300035118 Ga0373954_0009530 Ga0373954_0009530_3545_3949 126
102 3300035119 Ga0373956_0002393 Ga0373956_0002393_815_1219 126
103 3300035120 Ga0373957_0079629 Ga0373957_0079629_160_564 126
104 3300035170 Ga0373943_0054622 Ga0373943_0054622_1217_1621 126
105 3300035172 Ga0373955_0155867 Ga0373955_0155867_113_517 126
106 3300035410 Ga0373924_0040459 Ga0373924_0040459_570_974 126
107 3300035695 Ga0373927_0806093 Ga0373927_0806093_156_560 126
108 3300035724 Ga0373933_0077144 Ga0373933_0077144_1517_1921 126
109 3300036401 Ga0373937_0008558 Ga0373937_0008558_7968_8372 126
110 3300037068 Ga0373925_0366580 Ga0373925_0366580_90_494 126
111 3300046454 Ga0495592_0122757 Ga0495592_0122757_455_859 126
112 3300046462 Ga0495651_0233755 Ga0495651_0233755_547_951 126
113 3300046463 Ga0495653_0096896 Ga0495653_0096896_1422_1826 126
114 3300046475 Ga0495639_0061952 Ga0495639_0061952_50_466 126
115 3300046476 Ga0495662_0164270 Ga0495662_0164270_408_812 126
116 3300046477 Ga0495664_0005981 Ga0495664_0005981_4706_5110 126
117 3300046511 Ga0495608_0005395 Ga0495608_0005395_1161_1565 126
118 3300046514 Ga0495618_0178368 Ga0495618_0178368_739_1143 126
119 3300046516 Ga0495628_0081816 Ga0495628_0081816_1422_1826 126
120 3300046517 Ga0495630_0634140 Ga0495630_0634140_63_467 126
121 3300046529 Ga0495652_0067895 Ga0495652_0067895_635_1039 126
122 3300046533 Ga0495640_0042844 Ga0495640_0042844_2537_2941 126
123 3300046536 Ga0495587_0003175 Ga0495587_0003175_894_1298 126
124 3300046543 Ga0495645_0000553 Ga0495645_0000553_25168_25572 126
125 3300046559 Ga0495667_0088314 Ga0495667_0088314_1492_1896 126
126 3300046559 Ga0495667_0581342 Ga0495667_0581342_181_585 126
127 3300046663 Ga0495635_0030142 Ga0495635_0030142_2932_3336 126
128 3300046675 Ga0495657_0024863 Ga0495657_0024863_1625_2029 126
129 3300046678 Ga0495599_0030466 Ga0495599_0030466_1299_1703 126
130 3300046679 Ga0495623_0064433 Ga0495623_0064433_1666_2070 126
131 3300046680 Ga0495646_0005995 Ga0495646_0005995_927_1331 126
132 3300047317 Ga0495604_0072638 Ga0495604_0072638_100_504 126
133 3300047319 Ga0495674_0479040 Ga0495674_0479040_482_886 126
134 3300047322 Ga0495680_0054414 Ga0495680_0054414_1501_1905 126
135 3300047444 Ga0495675_0005326 Ga0495675_0005326_1666_2070 126
136 3300047471 Ga0495684_0010303 Ga0495684_0010303_3156_3560 126
137 3300048088 Ga0495602_0005535 Ga0495602_0005535_12083_12487 126
138 3300048929 Ga0496126_0085345 Ga0496126_0085345_1807_2205 126
139 3300049650 Ga0501199_009386 Ga0501199_009386_396_800 126
140 3300049656 Ga0501209_073241 Ga0501209_073241_436_840 126
141 3300049765 Ga0501268_001391 Ga0501268_001391_427_831 126
142 3300053077 Ga0495601_0005040 Ga0495601_0005040_2320_2724 126
143 3300053078 Ga0495612_0001349 Ga0495612_0001349_7410_7814 126
144 3300053085 Ga0495619_0072590 Ga0495619_0072590_1166_1570 126
145 3300005340 Ga0070689_100329343 Ga0070689_1003293431 127
146 3300005347 Ga0070668_100495076 Ga0070668_1004950763 127
147 3300005356 Ga0070674_100232599 Ga0070674_1002325993 127
148 3300005437 Ga0070710_10080199 Ga0070710_100801993 127
149 3300005459 Ga0068867_100156754 Ga0068867_1001567543 127
150 3300005548 Ga0070665_100053360 Ga0070665_1000533603 127
151 3300009553 Ga0105249_12319854 Ga0105249_123198542 127
152 3300025898 Ga0207692_10086153 Ga0207692_100861533 127
153 3300025928 Ga0207700_10075594 Ga0207700_100755944 127
154 3300026089 Ga0207648_10480403 Ga0207648_104804032 127
155 3300028379 Ga0268266_10258832 Ga0268266_102588322 127
156 3300049742 Ga0501080_0423867 Ga0501080_0423867_638_1039 127
157 3300060353 Ga0501082_0659399 Ga0501082_0659399_476_877 127
158 3300005335 Ga0070666_10316207 Ga0070666_103162072 128
159 3300005353 Ga0070669_100711147 Ga0070669_1007111472 128
160 3300005547 Ga0070693_100701612 Ga0070693_1007016122 128
161 3300005549 Ga0070704_100785658 Ga0070704_1007856582 128
162 3300005719 Ga0068861_102289053 Ga0068861_1022890532 128
163 3300005843 Ga0068860_100334658 Ga0068860_1003346582 128
164 3300007076 Ga0075435_100699382 Ga0075435_1006993822 128
165 3300009098 Ga0105245_12457019 Ga0105245_124570191 128
166 3300009148 Ga0105243_10264756 Ga0105243_102647562 128
167 3300009545 Ga0105237_10420151 Ga0105237_104201512 128
168 3300009553 Ga0105249_10858522 Ga0105249_108585222 128
169 3300013306 Ga0163162_10897423 Ga0163162_108974233 128
170 3300013306 Ga0163162_12944009 Ga0163162_129440092 128
171 3300014325 Ga0163163_12252994 Ga0163163_122529942 128
172 3300014968 Ga0157379_10126777 Ga0157379_101267776 128
173 3300025923 Ga0207681_10799112 Ga0207681_107991122 128
174 3300025972 Ga0207668_10993262 Ga0207668_109932622 128
175 3300028379 Ga0268266_10465874 Ga0268266_104658742 128
176 3300028381 Ga0268264_10160821 Ga0268264_101608213 128
177 3300034816 Ga0373930_0172631 Ga0373930_0172631_86_490 128
178 3300035207 Ga0373942_0289261 Ga0373942_0289261_71_475 128
179 3300035691 Ga0373931_0902537 Ga0373931_0902537_173_577 128
180 3300037418 Ga0395900_0177921 Ga0395900_0177921_1231_1635 128
181 3300037466 Ga0395898_1258280 Ga0395898_1258280_151_555 128
182 3300045976 Ga0466967_0178027 Ga0466967_0178027_501_905 128
183 3300048903 Ga0496100_0629785 Ga0496100_0629785_109_540 128
184 3300048906 Ga0496103_0263542 Ga0496103_0263542_17_421 128
185 3300048929 Ga0496126_0286445 Ga0496126_0286445_916_1320 128
186 3300014326 Ga0157380_10132440 Ga0157380_101324402 129
187 3300014968 Ga0157379_10096539 Ga0157379_100965393 129
188 3300035112 Ga0373932_0115388 Ga0373932_0115388_104_493 129
189 3300009174 Ga0105241_12592376 Ga0105241_125923761 131
190 3300044901 Ga0466960_0005392 Ga0466960_0005392_1475_1876 131
191 3300046683 Ga0495658_0501302 Ga0495658_0501302_45_443 131
192 3300005364 Ga0070673_100037590 Ga0070673_1000375902 132
193 3300005535 Ga0070684_100055313 Ga0070684_1000553132 132
194 3300005564 Ga0070664_101354773 Ga0070664_1013547731 132
195 3300013307 Ga0157372_11285156 Ga0157372_112851562 132
196 3300025944 Ga0207661_10015997 Ga0207661_100159976 132
197 3300045049 Ga0466959_0258502 Ga0466959_0258502_594_998 132
198 3300049568 Ga0501031_0657617 Ga0501031_0657617_204_605 132
199 3300049572 Ga0501036_0103141 Ga0501036_0103141_441_842 132
200 3300049575 Ga0501039_1225910 Ga0501039_1225910_155_556 132
201 3300049576 Ga0501040_0271596 Ga0501040_0271596_155_556 132
202 3300049592 Ga0501076_0055941 Ga0501076_0055941_1505_1906 132
203 3300060353 Ga0501082_0066915 Ga0501082_0066915_417_818 132
204 3300001977 JGI24746J21847_1008313 JGI24746J21847_10083133 133
205 3300001990 JGI24737J22298_10019777 JGI24737J22298_100197773 133
206 3300001991 JGI24743J22301_10025581 JGI24743J22301_100255813 133
207 3300002076 JGI24749J21850_1001177 JGI24749J21850_10011777 133
208 3300002077 JGI24744J21845_10082392 JGI24744J21845_100823922 133
209 3300002239 JGI24034J26672_10022310 JGI24034J26672_100223102 133
210 3300002244 JGI24742J22300_10042580 JGI24742J22300_100425802 133
211 3300002459 JGI24751J29686_10002625 JGI24751J29686_100026253 133
212 3300005289 Ga0065704_10071895 Ga0065704_100718955 133
213 3300005290 Ga0065712_10073698 Ga0065712_100736983 133
214 3300005327 Ga0070658_10001180 Ga0070658_1000118014 133
215 3300005327 Ga0070658_10202105 Ga0070658_102021052 133
216 3300005327 Ga0070658_10217825 Ga0070658_102178252 133
217 3300005327 Ga0070658_10379637 Ga0070658_103796371 133
218 3300005328 Ga0070676_10000049 Ga0070676_1000004918 133
219 3300005329 Ga0070683_100598574 Ga0070683_1005985742 133
220 3300005330 Ga0070690_100001148 Ga0070690_1000011485 133
221 3300005330 Ga0070690_100298205 Ga0070690_1002982052 133
222 3300005331 Ga0070670_100005605 Ga0070670_1000056055 133
223 3300005333 Ga0070677_10000134 Ga0070677_1000013422 133
224 3300005334 Ga0068869_100000696 Ga0068869_10000069614 133
225 3300005335 Ga0070666_10000394 Ga0070666_1000039414 133
226 3300005336 Ga0070680_100024189 Ga0070680_1000241894 133
227 3300005336 Ga0070680_100028475 Ga0070680_1000284752 133
228 3300005336 Ga0070680_101146833 Ga0070680_1011468332 133
229 3300005338 Ga0068868_100003766 Ga0068868_1000037665 133
230 3300005338 Ga0068868_101520559 Ga0068868_1015205592 133
231 3300005339 Ga0070660_100000307 Ga0070660_10000030726 133
232 3300005340 Ga0070689_100000860 Ga0070689_1000008609 133
233 3300005341 Ga0070691_10024186 Ga0070691_100241863 133
234 3300005343 Ga0070687_100000021 Ga0070687_10000002133 133
235 3300005344 Ga0070661_100000275 Ga0070661_10000027514 133
236 3300005344 Ga0070661_100792560 Ga0070661_1007925602 133
237 3300005345 Ga0070692_10007480 Ga0070692_100074804 133
238 3300005347 Ga0070668_100000879 Ga0070668_1000008795 133
239 3300005353 Ga0070669_100004057 Ga0070669_1000040575 133
240 3300005354 Ga0070675_100001297 Ga0070675_10000129710 133
241 3300005354 Ga0070675_101882874 Ga0070675_1018828742 133
242 3300005355 Ga0070671_100001340 Ga0070671_1000013406 133
243 3300005356 Ga0070674_100000604 Ga0070674_1000006048 133
244 3300005364 Ga0070673_100000776 Ga0070673_10000077616 133
245 3300005365 Ga0070688_100000455 Ga0070688_10000045511 133
246 3300005366 Ga0070659_100000146 Ga0070659_10000014634 133
247 3300005367 Ga0070667_100005480 Ga0070667_1000054805 133
248 3300005406 Ga0070703_10109803 Ga0070703_101098031 133
249 3300005434 Ga0070709_10556518 Ga0070709_105565182 133
250 3300005440 Ga0070705_100000514 Ga0070705_10000051415 133
251 3300005441 Ga0070700_100003107 Ga0070700_1000031077 133
252 3300005455 Ga0070663_100002068 Ga0070663_10000206810 133
253 3300005456 Ga0070678_100006026 Ga0070678_1000060265 133
254 3300005457 Ga0070662_100002769 Ga0070662_1000027695 133
255 3300005458 Ga0070681_10400891 Ga0070681_104008912 133
256 3300005459 Ga0068867_100001051 Ga0068867_10000105110 133
257 3300005466 Ga0070685_10000788 Ga0070685_100007885 133
258 3300005530 Ga0070679_100000928 Ga0070679_10000092812 133
259 3300005530 Ga0070679_100150510 Ga0070679_1001505103 133
260 3300005535 Ga0070684_100004673 Ga0070684_1000046735 133
261 3300005535 Ga0070684_100049842 Ga0070684_1000498424 133
262 3300005535 Ga0070684_100050704 Ga0070684_1000507043 133
263 3300005535 Ga0070684_100174336 Ga0070684_1001743362 133
264 3300005535 Ga0070684_101839048 Ga0070684_1018390481 133
265 3300005539 Ga0068853_100002643 Ga0068853_10000264311 133
266 3300005543 Ga0070672_100002220 Ga0070672_1000022204 133
267 3300005544 Ga0070686_100000964 Ga0070686_10000096411 133
268 3300005545 Ga0070695_100035713 Ga0070695_1000357132 133
269 3300005546 Ga0070696_100018157 Ga0070696_1000181573 133
270 3300005548 Ga0070665_100008178 Ga0070665_1000081785 133
271 3300005549 Ga0070704_100007177 Ga0070704_1000071773 133
272 3300005563 Ga0068855_100002538 Ga0068855_10000253817 133
273 3300005564 Ga0070664_100004233 Ga0070664_10000423310 133
274 3300005564 Ga0070664_100035595 Ga0070664_1000355955 133
275 3300005577 Ga0068857_100001946 Ga0068857_1000019467 133
276 3300005578 Ga0068854_100001076 Ga0068854_1000010765 133
277 3300005614 Ga0068856_100002406 Ga0068856_10000240613 133
278 3300005615 Ga0070702_100002469 Ga0070702_1000024694 133
279 3300005616 Ga0068852_100003552 Ga0068852_1000035529 133
280 3300005616 Ga0068852_100636502 Ga0068852_1006365022 133
281 3300005616 Ga0068852_101113092 Ga0068852_1011130922 133
282 3300005617 Ga0068859_100003568 Ga0068859_1000035685 133
283 3300005617 Ga0068859_100231214 Ga0068859_1002312142 133
284 3300005618 Ga0068864_100000267 Ga0068864_10000026732 133
285 3300005718 Ga0068866_10000293 Ga0068866_1000029318 133
286 3300005719 Ga0068861_100001152 Ga0068861_10000115210 133
287 3300005834 Ga0068851_10002548 Ga0068851_100025487 133
288 3300005834 Ga0068851_11047513 Ga0068851_110475131 133
289 3300005840 Ga0068870_10000014 Ga0068870_1000001452 133
290 3300005840 Ga0068870_10231493 Ga0068870_102314932 133
291 3300005841 Ga0068863_100001125 Ga0068863_10000112522 133
292 3300005841 Ga0068863_100286691 Ga0068863_1002866912 133
293 3300005842 Ga0068858_100002425 Ga0068858_10000242515 133
294 3300005843 Ga0068860_100007933 Ga0068860_1000079335 133
295 3300005844 Ga0068862_100002595 Ga0068862_1000025959 133
296 3300005983 Ga0081540_1049321 Ga0081540_10493213 133
297 3300006028 Ga0070717_10193727 Ga0070717_101937272 133
298 3300006051 Ga0075364_10107583 Ga0075364_101075833 133
299 3300006058 Ga0075432_10041117 Ga0075432_100411172 133
300 3300006175 Ga0070712_100667736 Ga0070712_1006677362 133
301 3300006237 Ga0097621_100007806 Ga0097621_10000780610 133
302 3300006358 Ga0068871_100008918 Ga0068871_1000089186 133
303 3300006846 Ga0075430_100350775 Ga0075430_1003507752 133
304 3300006847 Ga0075431_100126546 Ga0075431_1001265462 133
305 3300006852 Ga0075433_10149918 Ga0075433_101499183 133
306 3300006871 Ga0075434_100002404 Ga0075434_10000240420 133
307 3300006881 Ga0068865_100001006 Ga0068865_10000100616 133
308 3300006931 Ga0097620_100003569 Ga0097620_1000035695 133
309 3300006931 Ga0097620_100231215 Ga0097620_1002312153 133
310 3300007076 Ga0075435_100033993 Ga0075435_1000339932 133
311 3300007076 Ga0075435_100125103 Ga0075435_1001251033 133
312 3300009093 Ga0105240_10005551 Ga0105240_1000555116 133
313 3300009094 Ga0111539_10032830 Ga0111539_100328304 133
314 3300009147 Ga0114129_11684620 Ga0114129_116846202 133
315 3300009176 Ga0105242_11961024 Ga0105242_119610241 133
316 3300009551 Ga0105238_10540517 Ga0105238_105405172 133
317 3300009553 Ga0105249_10293271 Ga0105249_102932712 133
318 3300010375 Ga0105239_11182734 Ga0105239_111827342 133
319 3300012513 Ga0157326_1000516 Ga0157326_10005163 133
320 3300014497 Ga0182008_10255241 Ga0182008_102552412 133
321 3300014969 Ga0157376_11499846 Ga0157376_114998462 133
322 3300025315 Ga0207697_10000456 Ga0207697_1000045615 133
323 3300025321 Ga0207656_10000072 Ga0207656_1000007229 133
324 3300025885 Ga0207653_10080254 Ga0207653_100802542 133
325 3300025893 Ga0207682_10000241 Ga0207682_1000024122 133
326 3300025899 Ga0207642_10003513 Ga0207642_100035134 133
327 3300025900 Ga0207710_10001308 Ga0207710_1000130811 133
328 3300025901 Ga0207688_10000008 Ga0207688_1000000839 133
329 3300025903 Ga0207680_10002146 Ga0207680_100021466 133
330 3300025904 Ga0207647_10001413 Ga0207647_100014137 133
331 3300025907 Ga0207645_10000008 Ga0207645_1000000815 133
332 3300025908 Ga0207643_10000008 Ga0207643_10000008136 133
333 3300025908 Ga0207643_10443796 Ga0207643_104437962 133
334 3300025909 Ga0207705_10005175 Ga0207705_100051754 133
335 3300025909 Ga0207705_10065630 Ga0207705_100656302 133
336 3300025909 Ga0207705_10172190 Ga0207705_101721903 133
337 3300025909 Ga0207705_10379342 Ga0207705_103793422 133
338 3300025911 Ga0207654_10002231 Ga0207654_100022314 133
339 3300025912 Ga0207707_10042145 Ga0207707_100421455 133
340 3300025912 Ga0207707_10383500 Ga0207707_103835002 133
341 3300025913 Ga0207695_10009830 Ga0207695_1000983016 133
342 3300025913 Ga0207695_10018237 Ga0207695_100182375 133
343 3300025914 Ga0207671_10015742 Ga0207671_100157423 133
344 3300025917 Ga0207660_10013606 Ga0207660_100136064 133
345 3300025917 Ga0207660_10032477 Ga0207660_100324774 133
346 3300025918 Ga0207662_10000012 Ga0207662_1000001261 133
347 3300025918 Ga0207662_10714294 Ga0207662_107142942 133
348 3300025919 Ga0207657_10000094 Ga0207657_1000009447 133
349 3300025920 Ga0207649_10001557 Ga0207649_1000155712 133
350 3300025920 Ga0207649_10690744 Ga0207649_106907442 133
351 3300025921 Ga0207652_10026299 Ga0207652_100262997 133
352 3300025921 Ga0207652_10088054 Ga0207652_100880542 133
353 3300025923 Ga0207681_10001267 Ga0207681_100012676 133
354 3300025924 Ga0207694_10003107 Ga0207694_100031073 133
355 3300025925 Ga0207650_10000222 Ga0207650_1000022221 133
356 3300025925 Ga0207650_10150589 Ga0207650_101505892 133
357 3300025926 Ga0207659_10000194 Ga0207659_1000019411 133
358 3300025927 Ga0207687_10012010 Ga0207687_100120104 133
359 3300025931 Ga0207644_10001867 Ga0207644_1000186712 133
360 3300025932 Ga0207690_10004972 Ga0207690_100049724 133
361 3300025933 Ga0207706_10000118 Ga0207706_1000011847 133
362 3300025934 Ga0207686_10016004 Ga0207686_100160044 133
363 3300025936 Ga0207670_10000192 Ga0207670_1000019232 133
364 3300025937 Ga0207669_10001198 Ga0207669_1000119811 133
365 3300025938 Ga0207704_10001160 Ga0207704_100011604 133
366 3300025940 Ga0207691_10000074 Ga0207691_1000007435 133
367 3300025941 Ga0207711_10003833 Ga0207711_100038335 133
368 3300025942 Ga0207689_10000093 Ga0207689_1000009347 133
369 3300025944 Ga0207661_10003792 Ga0207661_100037922 133
370 3300025944 Ga0207661_10599127 Ga0207661_105991272 133
371 3300025945 Ga0207679_10001995 Ga0207679_100019955 133
372 3300025945 Ga0207679_10004827 Ga0207679_100048276 133
373 3300025949 Ga0207667_10009673 Ga0207667_100096735 133
374 3300025960 Ga0207651_10000037 Ga0207651_1000003746 133
375 3300025961 Ga0207712_10002932 Ga0207712_100029323 133
376 3300025972 Ga0207668_10002925 Ga0207668_100029254 133
377 3300025981 Ga0207640_10005156 Ga0207640_100051564 133
378 3300025986 Ga0207658_10000162 Ga0207658_1000016251 133
379 3300025986 Ga0207658_11000254 Ga0207658_110002541 133
380 3300026023 Ga0207677_10000149 Ga0207677_1000014946 133
381 3300026035 Ga0207703_10000718 Ga0207703_1000071821 133
382 3300026041 Ga0207639_10002522 Ga0207639_100025224 133
383 3300026067 Ga0207678_10004557 Ga0207678_100045576 133
384 3300026075 Ga0207708_10004377 Ga0207708_100043776 133
385 3300026078 Ga0207702_10002848 Ga0207702_100028487 133
386 3300026088 Ga0207641_10003922 Ga0207641_100039223 133
387 3300026089 Ga0207648_10000183 Ga0207648_1000018317 133
388 3300026095 Ga0207676_10004944 Ga0207676_100049444 133
389 3300026116 Ga0207674_10005861 Ga0207674_1000586111 133
390 3300026118 Ga0207675_100000008 Ga0207675_10000000838 133
391 3300026121 Ga0207683_10000629 Ga0207683_1000062925 133
392 3300026142 Ga0207698_10001829 Ga0207698_100018294 133
393 3300026142 Ga0207698_10261377 Ga0207698_102613773 133
394 3300027907 Ga0207428_10005681 Ga0207428_100056814 133
395 3300027907 Ga0207428_10051835 Ga0207428_100518354 133
396 3300028379 Ga0268266_10000447 Ga0268266_1000044746 133
397 3300028380 Ga0268265_10000207 Ga0268265_1000020747 133
398 3300028381 Ga0268264_10001769 Ga0268264_1000176917 133
399 3300031090 Ga0265760_10022980 Ga0265760_100229803 133
400 3300031548 Ga0307408_100005628 Ga0307408_1000056286 133
401 3300031824 Ga0307413_10019524 Ga0307413_100195246 133
402 3300031852 Ga0307410_10122544 Ga0307410_101225442 133
403 3300031903 Ga0307407_10088339 Ga0307407_100883393 133
404 3300031995 Ga0307409_100091681 Ga0307409_1000916813 133
405 3300031995 Ga0307409_100255370 Ga0307409_1002553702 133
406 3300032004 Ga0307414_10026505 Ga0307414_100265053 133
407 3300032005 Ga0307411_10014298 Ga0307411_100142982 133
408 3300034957 Ga0373938_0220916 Ga0373938_0220916_103_504 133
409 3300035112 Ga0373932_0087372 Ga0373932_0087372_475_903 133
410 3300035114 Ga0373939_0010849 Ga0373939_0010849_75_503 133
411 3300035114 Ga0373939_0055266 Ga0373939_0055266_577_984 133
412 3300035242 Ga0373962_0052357 Ga0373962_0052357_680_1108 133
413 3300035692 Ga0373935_0910828 Ga0373935_0910828_75_479 133
414 3300035695 Ga0373927_0114629 Ga0373927_0114629_1151_1555 133
415 3300035724 Ga0373933_0154748 Ga0373933_0154748_467_871 133
416 3300038443 Ga0395901_1058581 Ga0395901_1058581_74_478 133
417 3300039438 Ga0436360_0401191 Ga0436360_0401191_451_855 133
418 3300045049 Ga0466959_0485321 Ga0466959_0485321_382_804 133
419 3300046514 Ga0495618_0207540 Ga0495618_0207540_354_758 133
420 3300046516 Ga0495628_0329760 Ga0495628_0329760_67_471 133
421 3300046678 Ga0495599_0263786 Ga0495599_0263786_563_967 133
422 3300046690 Ga0495624_0873657 Ga0495624_0873657_13_453 133
423 3300048088 Ga0495602_0254121 Ga0495602_0254121_200_604 133
424 3300048910 Ga0496107_1102311 Ga0496107_1102311_115_519 133
425 3300048914 Ga0496111_0470192 Ga0496111_0470192_287_691 133
426 3300049575 Ga0501039_0325569 Ga0501039_0325569_297_701 133
427 3300049587 Ga0501071_1380366 Ga0501071_1380366_119_523 133
428 3300050491 nmdc:mga00v17_96815_c1 nmdc:mga00v17_96815_c1_1353_1757 133
429 3300050507 nmdc:mga05p37_70774_c1 nmdc:mga05p37_70774_c1_840_1244 133
430 3300050511 nmdc:mga08y16_134786_c1 nmdc:mga08y16_134786_c1_2040_2468 133
431 3300050511 nmdc:mga08y16_40075_c1 nmdc:mga08y16_40075_c1_485_889 133
432 3300050512 nmdc:mga0n895_2115_c1 nmdc:mga0n895_2115_c1_462_872 133
433 3300050513 nmdc:mga0rr50_30630_c1 nmdc:mga0rr50_30630_c1_1673_2083 133
434 3300050514 nmdc:mga08x19_1276617_c1 nmdc:mga08x19_1276617_c1_81_482 133
435 3300050515 nmdc:mga0a205_3719_c1 nmdc:mga0a205_3719_c1_1062_1472 133
436 3300053077 Ga0495601_0121762 Ga0495601_0121762_174_578 133
437 3300053084 Ga0495595_0060142 Ga0495595_0060142_635_1039 133
438 3300054114 Ga0501084_0026883 Ga0501084_0026883_3819_4223 133
439 3300060353 Ga0501082_1588723 Ga0501082_1588723_72_476 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

48

146

0.91

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

24

145

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8537 4 132
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8532 3 131
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.841 4 133
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8239 3 131
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8167 4 132
ID Description Score Start End Superfamily
af_P36613_15_185_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.9192 14 48 1.10.472.10
af_Q54JB3_152_315_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8818 16 56 1.10.357.140
3j9x101 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8652 16 52 1.20.58.800
af_Q9Y7Y4_92_240_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8353 12 56 1.10.357.140
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7974 5 131 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A2V7L193-F1-model_v4 ATP-binding protein 0.9761 6 133 GO:0004674
GO:0005524
AF-A0A2V9K0T1-F1-model_v4 ATP-binding protein 0.9748 4 88 GO:0005524
AF-A0A2V2S9I7-F1-model_v4 Anti-sigma regulatory factor 0.9727 4 133
AF-A0A1Q7RXW0-F1-model_v4 ATP-binding protein 0.9719 5 133 GO:0004674
GO:0005524
AF-A0A1Q7EIC2-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9708 4 83

Feature Viewer

pLDDT pTM Quality
89.99 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map