F444282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 439 | 295 | 439 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300046690|Ga0495624_0873657|Ga0495624_0873657_13_453 |
| Length | 146 |
| Sequence | MATWKRPPRKIAMLVEQDDRMPIRSSEDVVRVRQAVRARAVGAGLGLVDQTKIITAASEIARNTVNYGGGGEVRIEVLRDGSRRGVRLTFQDQGPGISDLTLALTDGYSTGSGLGLGLTGARRLCNEFDIHSAPGEGTTVVLARWK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 280 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 283 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.46 |
| Nodule | 0 |
| Rhizoplane | 2.96 |
| Rhizosphere | 96.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1008313 | 3300001977 | Bacteria | 1568 |
| 2 | JGI24737J22298_10019777 | 3300001990 | Bacteria | 2153 |
| 3 | JGI24743J22301_10025581 | 3300001991 | Bacteria | 1144 |
| 4 | JGI24749J21850_1001177 | 3300002076 | Bacteria | 3708 |
| 5 | JGI24744J21845_10082392 | 3300002077 | Bacteria | 588 |
| 6 | JGI24034J26672_10022310 | 3300002239 | Bacteria | 1000 |
| 7 | JGI24742J22300_10042580 | 3300002244 | Bacteria | 811 |
| 8 | JGI24751J29686_10002625 | 3300002459 | Bacteria | 3611 |
| 9 | Ga0065704_10071895 | 3300005289 | Bacteria | 9667 |
| 10 | Ga0065712_10073698 | 3300005290 | Bacteria | 4305 |
| 11 | Ga0070658_10000992 | 3300005327 | Bacteria | 24343 |
| 12 | Ga0070658_10001180 | 3300005327 | Bacteria | 22343 |
| 13 | Ga0070658_10202105 | 3300005327 | Bacteria | 1677 |
| 14 | Ga0070658_10217825 | 3300005327 | Bacteria | 1614 |
| 15 | Ga0070658_10379637 | 3300005327 | Unclassified | 1212 |
| 16 | Ga0070676_10000049 | 3300005328 | Bacteria | 37836 |
| 17 | Ga0070683_100598574 | 3300005329 | Bacteria | 1055 |
| 18 | Ga0070690_100001148 | 3300005330 | Bacteria | 13634 |
| 19 | Ga0070690_100298205 | 3300005330 | Bacteria | 1155 |
| 20 | Ga0070670_100005605 | 3300005331 | Bacteria | 10593 |
| 21 | Ga0070677_10000134 | 3300005333 | Bacteria | 24781 |
| 22 | Ga0070677_10225820 | 3300005333 | Bacteria | 917 |
| 23 | Ga0068869_100000696 | 3300005334 | Bacteria | 19024 |
| 24 | Ga0068869_100177926 | 3300005334 | Bacteria | 1666 |
| 25 | Ga0070666_10000394 | 3300005335 | Bacteria | 27450 |
| 26 | Ga0070666_10316207 | 3300005335 | Bacteria | 1113 |
| 27 | Ga0070680_100024189 | 3300005336 | Bacteria | 4848 |
| 28 | Ga0070680_100028475 | 3300005336 | Bacteria | 4481 |
| 29 | Ga0070680_101146833 | 3300005336 | Bacteria | 672 |
| 30 | Ga0068868_100003766 | 3300005338 | Bacteria | 10593 |
| 31 | Ga0068868_101520559 | 3300005338 | Bacteria | 627 |
| 32 | Ga0070660_100000307 | 3300005339 | Bacteria | 32493 |
| 33 | Ga0070689_100000860 | 3300005340 | Bacteria | 18871 |
| 34 | Ga0070689_100329343 | 3300005340 | Bacteria | 1277 |
| 35 | Ga0070691_10024186 | 3300005341 | Bacteria | 2823 |
| 36 | Ga0070687_100000021 | 3300005343 | Bacteria | 52715 |
| 37 | Ga0070661_100000275 | 3300005344 | Bacteria | 41665 |
| 38 | Ga0070661_100792560 | 3300005344 | Bacteria | 777 |
| 39 | Ga0070692_10007480 | 3300005345 | Bacteria | 4811 |
| 40 | Ga0070668_100000879 | 3300005347 | Bacteria | 20893 |
| 41 | Ga0070668_100495076 | 3300005347 | Bacteria | 1057 |
| 42 | Ga0070669_100004057 | 3300005353 | Bacteria | 10593 |
| 43 | Ga0070669_100711147 | 3300005353 | Bacteria | 849 |
| 44 | Ga0070675_100001297 | 3300005354 | Bacteria | 18273 |
| 45 | Ga0070675_101882874 | 3300005354 | Bacteria | 552 |
| 46 | Ga0070671_100001340 | 3300005355 | Bacteria | 18459 |
| 47 | Ga0070671_100778633 | 3300005355 | Bacteria | 832 |
| 48 | Ga0070674_100000604 | 3300005356 | Bacteria | 18161 |
| 49 | Ga0070674_100232599 | 3300005356 | Bacteria | 1439 |
| 50 | Ga0070673_100000776 | 3300005364 | Bacteria | 17745 |
| 51 | Ga0070673_100037590 | 3300005364 | Bacteria | 3690 |
| 52 | Ga0070688_100000455 | 3300005365 | Bacteria | 20736 |
| 53 | Ga0070659_100000146 | 3300005366 | Bacteria | 54086 |
| 54 | Ga0070667_100005480 | 3300005367 | Bacteria | 10593 |
| 55 | Ga0070667_100251125 | 3300005367 | Bacteria | 1581 |
| 56 | Ga0070703_10109803 | 3300005406 | Bacteria | 985 |
| 57 | Ga0070709_10030079 | 3300005434 | Bacteria | 3256 |
| 58 | Ga0070709_10556518 | 3300005434 | Bacteria | 878 |
| 59 | Ga0070714_100681479 | 3300005435 | Bacteria | 991 |
| 60 | Ga0070713_100007391 | 3300005436 | Bacteria | 7707 |
| 61 | Ga0070710_10080199 | 3300005437 | Bacteria | 1903 |
| 62 | Ga0070710_10084739 | 3300005437 | Bacteria | 1857 |
| 63 | Ga0070710_10220323 | 3300005437 | Bacteria | 1207 |
| 64 | Ga0070711_100005208 | 3300005439 | Bacteria | 7756 |
| 65 | Ga0070705_100000514 | 3300005440 | Bacteria | 22376 |
| 66 | Ga0070700_100003107 | 3300005441 | Bacteria | 8515 |
| 67 | Ga0070663_100002068 | 3300005455 | Bacteria | 11201 |
| 68 | Ga0070678_100006026 | 3300005456 | Bacteria | 7069 |
| 69 | Ga0070662_100002769 | 3300005457 | Bacteria | 10846 |
| 70 | Ga0070681_10400891 | 3300005458 | Bacteria | 1283 |
| 71 | Ga0068867_100001051 | 3300005459 | Bacteria | 18831 |
| 72 | Ga0068867_100156754 | 3300005459 | Bacteria | 1793 |
| 73 | Ga0070685_10000788 | 3300005466 | Bacteria | 17191 |
| 74 | Ga0070679_100000928 | 3300005530 | Bacteria | 25490 |
| 75 | Ga0070679_100150510 | 3300005530 | Bacteria | 2304 |
| 76 | Ga0070684_100004673 | 3300005535 | Bacteria | 10458 |
| 77 | Ga0070684_100049842 | 3300005535 | Bacteria | 3636 |
| 78 | Ga0070684_100050704 | 3300005535 | Bacteria | 3606 |
| 79 | Ga0070684_100055313 | 3300005535 | Unclassified | 3459 |
| 80 | Ga0070684_100174336 | 3300005535 | Bacteria | 1954 |
| 81 | Ga0070684_101839048 | 3300005535 | Bacteria | 571 |
| 82 | Ga0068853_100002643 | 3300005539 | Bacteria | 13500 |
| 83 | Ga0070672_100002220 | 3300005543 | Bacteria | 12228 |
| 84 | Ga0070686_100000964 | 3300005544 | Bacteria | 16582 |
| 85 | Ga0070695_100035713 | 3300005545 | Bacteria | 3123 |
| 86 | Ga0070696_100018157 | 3300005546 | Bacteria | 4752 |
| 87 | Ga0070693_100701612 | 3300005547 | Bacteria | 741 |
| 88 | Ga0070665_100008178 | 3300005548 | Bacteria | 10593 |
| 89 | Ga0070665_100053360 | 3300005548 | Unclassified | 4054 |
| 90 | Ga0070704_100007177 | 3300005549 | Bacteria | 6622 |
| 91 | Ga0070704_100785658 | 3300005549 | Bacteria | 850 |
| 92 | Ga0068855_100002538 | 3300005563 | Bacteria | 22484 |
| 93 | Ga0068855_101103415 | 3300005563 | Bacteria | 829 |
| 94 | Ga0070664_100004233 | 3300005564 | Bacteria | 11543 |
| 95 | Ga0070664_100035595 | 3300005564 | Bacteria | 4180 |
| 96 | Ga0070664_101354773 | 3300005564 | Bacteria | 672 |
| 97 | Ga0068857_100001946 | 3300005577 | Bacteria | 16673 |
| 98 | Ga0068854_100001076 | 3300005578 | Bacteria | 16440 |
| 99 | Ga0068856_100002406 | 3300005614 | Bacteria | 19258 |
| 100 | Ga0070702_100002469 | 3300005615 | Bacteria | 7996 |
| 101 | Ga0070702_100913128 | 3300005615 | Bacteria | 688 |
| 102 | Ga0068852_100003552 | 3300005616 | Bacteria | 10910 |
| 103 | Ga0068852_100636502 | 3300005616 | Bacteria | 1073 |
| 104 | Ga0068852_101113092 | 3300005616 | Bacteria | 810 |
| 105 | Ga0068859_100003568 | 3300005617 | Bacteria | 15854 |
| 106 | Ga0068859_100231214 | 3300005617 | Bacteria | 1937 |
| 107 | Ga0068859_101904523 | 3300005617 | Bacteria | 657 |
| 108 | Ga0068864_100000267 | 3300005618 | Bacteria | 46395 |
| 109 | Ga0068866_10000293 | 3300005718 | Bacteria | 23883 |
| 110 | Ga0068861_100001152 | 3300005719 | Bacteria | 16465 |
| 111 | Ga0068861_102289053 | 3300005719 | Bacteria | 542 |
| 112 | Ga0068851_10002548 | 3300005834 | Bacteria | 8017 |
| 113 | Ga0068851_11047513 | 3300005834 | Bacteria | 516 |
| 114 | Ga0068870_10000014 | 3300005840 | Bacteria | 63363 |
| 115 | Ga0068870_10231493 | 3300005840 | Bacteria | 1136 |
| 116 | Ga0068863_100001125 | 3300005841 | Bacteria | 26723 |
| 117 | Ga0068863_100195043 | 3300005841 | Bacteria | 1947 |
| 118 | Ga0068863_100286691 | 3300005841 | Bacteria | 1596 |
| 119 | Ga0068858_100002425 | 3300005842 | Bacteria | 18880 |
| 120 | Ga0068860_100007933 | 3300005843 | Bacteria | 10593 |
| 121 | Ga0068860_100088217 | 3300005843 | Bacteria | 2953 |
| 122 | Ga0068860_100334658 | 3300005843 | Bacteria | 1488 |
| 123 | Ga0068862_100002595 | 3300005844 | Bacteria | 15955 |
| 124 | Ga0081540_1010115 | 3300005983 | Bacteria | 6420 |
| 125 | Ga0081540_1049321 | 3300005983 | Bacteria | 2101 |
| 126 | Ga0070717_10193727 | 3300006028 | Bacteria | 1777 |
| 127 | Ga0075364_10107583 | 3300006051 | Bacteria | 1859 |
| 128 | Ga0075432_10041117 | 3300006058 | Bacteria | 1614 |
| 129 | Ga0070715_10051443 | 3300006163 | Bacteria | 1773 |
| 130 | Ga0070716_100056676 | 3300006173 | Bacteria | 2248 |
| 131 | Ga0070712_100012551 | 3300006175 | Bacteria | 5387 |
| 132 | Ga0070712_100667736 | 3300006175 | Bacteria | 884 |
| 133 | Ga0097621_100007806 | 3300006237 | Bacteria | 7677 |
| 134 | Ga0097621_100069093 | 3300006237 | Bacteria | 2916 |
| 135 | Ga0097621_100727280 | 3300006237 | Bacteria | 915 |
| 136 | Ga0068871_100008918 | 3300006358 | Bacteria | 7236 |
| 137 | Ga0075430_100350775 | 3300006846 | Bacteria | 1219 |
| 138 | Ga0075431_100126546 | 3300006847 | Bacteria | 2636 |
| 139 | Ga0075433_10149918 | 3300006852 | Bacteria | 2074 |
| 140 | Ga0075434_100002404 | 3300006871 | Bacteria | 16437 |
| 141 | Ga0068865_100001006 | 3300006881 | Bacteria | 16181 |
| 142 | Ga0097620_100003569 | 3300006931 | Bacteria | 15854 |
| 143 | Ga0097620_100231215 | 3300006931 | Bacteria | 1937 |
| 144 | Ga0097620_101904570 | 3300006931 | Bacteria | 657 |
| 145 | Ga0075435_100033993 | 3300007076 | Bacteria | 4036 |
| 146 | Ga0075435_100125103 | 3300007076 | Bacteria | 2148 |
| 147 | Ga0075435_100699382 | 3300007076 | Bacteria | 881 |
| 148 | Ga0105244_10518864 | 3300009036 | Unclassified | 549 |
| 149 | Ga0105250_10033885 | 3300009092 | Bacteria | 2050 |
| 150 | Ga0105240_10002245 | 3300009093 | Bacteria | 31383 |
| 151 | Ga0105240_10005551 | 3300009093 | Bacteria | 18769 |
| 152 | Ga0111539_10014741 | 3300009094 | Bacteria | 9750 |
| 153 | Ga0111539_10032830 | 3300009094 | Bacteria | 6303 |
| 154 | Ga0105245_10003327 | 3300009098 | Bacteria | 14428 |
| 155 | Ga0105245_12457019 | 3300009098 | Bacteria | 574 |
| 156 | Ga0105247_10002337 | 3300009101 | Bacteria | 12944 |
| 157 | Ga0114129_11684620 | 3300009147 | Bacteria | 774 |
| 158 | Ga0105243_10003979 | 3300009148 | Bacteria | 11781 |
| 159 | Ga0105243_10264756 | 3300009148 | Bacteria | 1541 |
| 160 | Ga0105241_10006472 | 3300009174 | Bacteria | 8635 |
| 161 | Ga0105241_12592376 | 3300009174 | Unclassified | 509 |
| 162 | Ga0105242_10001831 | 3300009176 | Bacteria | 16694 |
| 163 | Ga0105242_10045491 | 3300009176 | Bacteria | 3557 |
| 164 | Ga0105242_11961024 | 3300009176 | Unclassified | 627 |
| 165 | Ga0105248_10001907 | 3300009177 | Bacteria | 23133 |
| 166 | Ga0105248_10273331 | 3300009177 | Bacteria | 1903 |
| 167 | Ga0105248_11797969 | 3300009177 | Unclassified | 695 |
| 168 | Ga0105237_10000920 | 3300009545 | Bacteria | 39577 |
| 169 | Ga0105237_10420151 | 3300009545 | Bacteria | 1342 |
| 170 | Ga0105238_10000349 | 3300009551 | Bacteria | 49771 |
| 171 | Ga0105238_10540517 | 3300009551 | Bacteria | 1169 |
| 172 | Ga0105238_10886137 | 3300009551 | Bacteria | 910 |
| 173 | Ga0105249_10000378 | 3300009553 | Bacteria | 44184 |
| 174 | Ga0105249_10293271 | 3300009553 | Bacteria | 1629 |
| 175 | Ga0105249_10858522 | 3300009553 | Bacteria | 973 |
| 176 | Ga0105249_12319854 | 3300009553 | Unclassified | 609 |
| 177 | Ga0105239_10000911 | 3300010375 | Bacteria | 41958 |
| 178 | Ga0105239_11182734 | 3300010375 | Bacteria | 881 |
| 179 | Ga0105246_10007207 | 3300011119 | Bacteria | 6813 |
| 180 | Ga0157326_1000516 | 3300012513 | Bacteria | 4598 |
| 181 | Ga0157373_10000740 | 3300013100 | Bacteria | 25321 |
| 182 | Ga0157371_10001951 | 3300013102 | Bacteria | 20507 |
| 183 | Ga0157369_10000611 | 3300013105 | Bacteria | 46408 |
| 184 | Ga0157374_10053862 | 3300013296 | Bacteria | 3752 |
| 185 | Ga0157378_10001378 | 3300013297 | Bacteria | 21821 |
| 186 | Ga0163162_10002286 | 3300013306 | Bacteria | 17999 |
| 187 | Ga0163162_10897423 | 3300013306 | Bacteria | 1000 |
| 188 | Ga0163162_12944009 | 3300013306 | Bacteria | 548 |
| 189 | Ga0157372_10001256 | 3300013307 | Bacteria | 27447 |
| 190 | Ga0157372_11285156 | 3300013307 | Bacteria | 844 |
| 191 | Ga0157375_10003080 | 3300013308 | Bacteria | 14473 |
| 192 | Ga0163163_10019859 | 3300014325 | Bacteria | 6319 |
| 193 | Ga0163163_10485898 | 3300014325 | Bacteria | 1296 |
| 194 | Ga0163163_12252994 | 3300014325 | Bacteria | 604 |
| 195 | Ga0157380_10082040 | 3300014326 | Bacteria | 2639 |
| 196 | Ga0157380_10132440 | 3300014326 | Bacteria | 2129 |
| 197 | Ga0182008_10255241 | 3300014497 | Bacteria | 905 |
| 198 | Ga0157377_10003502 | 3300014745 | Bacteria | 7107 |
| 199 | Ga0157379_10006844 | 3300014968 | Bacteria | 9853 |
| 200 | Ga0157379_10096539 | 3300014968 | Bacteria | 2653 |
| 201 | Ga0157379_10126777 | 3300014968 | Bacteria | 2297 |
| 202 | Ga0157376_10001171 | 3300014969 | Bacteria | 17243 |
| 203 | Ga0157376_10209228 | 3300014969 | Bacteria | 1800 |
| 204 | Ga0157376_11499846 | 3300014969 | Bacteria | 707 |
| 205 | Ga0207697_10000456 | 3300025315 | Bacteria | 23062 |
| 206 | Ga0207656_10000072 | 3300025321 | Bacteria | 37238 |
| 207 | Ga0207653_10080254 | 3300025885 | Bacteria | 1128 |
| 208 | Ga0207682_10000241 | 3300025893 | Bacteria | 24805 |
| 209 | Ga0207692_10019547 | 3300025898 | Bacteria | 3063 |
| 210 | Ga0207692_10086153 | 3300025898 | Bacteria | 1692 |
| 211 | Ga0207642_10003513 | 3300025899 | Bacteria | 4957 |
| 212 | Ga0207710_10001308 | 3300025900 | Bacteria | 12581 |
| 213 | Ga0207688_10000008 | 3300025901 | Bacteria | 62580 |
| 214 | Ga0207680_10002146 | 3300025903 | Bacteria | 9249 |
| 215 | Ga0207680_10308483 | 3300025903 | Bacteria | 1104 |
| 216 | Ga0207647_10001413 | 3300025904 | Bacteria | 18437 |
| 217 | Ga0207685_10011544 | 3300025905 | Bacteria | 2659 |
| 218 | Ga0207699_10056065 | 3300025906 | Bacteria | 2347 |
| 219 | Ga0207645_10000008 | 3300025907 | Bacteria | 158682 |
| 220 | Ga0207643_10000008 | 3300025908 | Bacteria | 163521 |
| 221 | Ga0207643_10443796 | 3300025908 | Bacteria | 825 |
| 222 | Ga0207705_10005175 | 3300025909 | Bacteria | 9778 |
| 223 | Ga0207705_10065630 | 3300025909 | Bacteria | 2624 |
| 224 | Ga0207705_10172190 | 3300025909 | Bacteria | 1630 |
| 225 | Ga0207705_10379342 | 3300025909 | Bacteria | 1092 |
| 226 | Ga0207654_10002231 | 3300025911 | Bacteria | 9951 |
| 227 | Ga0207707_10042145 | 3300025912 | Bacteria | 3986 |
| 228 | Ga0207707_10383500 | 3300025912 | Bacteria | 1208 |
| 229 | Ga0207695_10009830 | 3300025913 | Bacteria | 11755 |
| 230 | Ga0207695_10018237 | 3300025913 | Bacteria | 8122 |
| 231 | Ga0207671_10015742 | 3300025914 | Bacteria | 5908 |
| 232 | Ga0207671_10988725 | 3300025914 | Bacteria | 663 |
| 233 | Ga0207693_10010294 | 3300025915 | Bacteria | 7590 |
| 234 | Ga0207663_10042416 | 3300025916 | Bacteria | 2779 |
| 235 | Ga0207660_10013606 | 3300025917 | Bacteria | 5335 |
| 236 | Ga0207660_10032477 | 3300025917 | Bacteria | 3603 |
| 237 | Ga0207662_10000012 | 3300025918 | Bacteria | 90502 |
| 238 | Ga0207662_10714294 | 3300025918 | Bacteria | 703 |
| 239 | Ga0207657_10000094 | 3300025919 | Bacteria | 85112 |
| 240 | Ga0207649_10001557 | 3300025920 | Bacteria | 13418 |
| 241 | Ga0207649_10690744 | 3300025920 | Bacteria | 791 |
| 242 | Ga0207652_10026299 | 3300025921 | Bacteria | 4845 |
| 243 | Ga0207652_10088054 | 3300025921 | Bacteria | 2724 |
| 244 | Ga0207681_10001267 | 3300025923 | Bacteria | 16299 |
| 245 | Ga0207681_10799112 | 3300025923 | Bacteria | 788 |
| 246 | Ga0207694_10003107 | 3300025924 | Bacteria | 13280 |
| 247 | Ga0207694_10603687 | 3300025924 | Bacteria | 923 |
| 248 | Ga0207650_10000222 | 3300025925 | Bacteria | 64400 |
| 249 | Ga0207650_10150589 | 3300025925 | Bacteria | 1836 |
| 250 | Ga0207659_10000194 | 3300025926 | Bacteria | 36228 |
| 251 | Ga0207687_10012010 | 3300025927 | Bacteria | 5665 |
| 252 | Ga0207700_10042158 | 3300025928 | Bacteria | 3344 |
| 253 | Ga0207700_10075594 | 3300025928 | Bacteria | 2611 |
| 254 | Ga0207644_10001867 | 3300025931 | Bacteria | 13702 |
| 255 | Ga0207644_10187655 | 3300025931 | Bacteria | 1624 |
| 256 | Ga0207690_10004972 | 3300025932 | Bacteria | 7850 |
| 257 | Ga0207706_10000118 | 3300025933 | Bacteria | 84834 |
| 258 | Ga0207686_10016004 | 3300025934 | Bacteria | 4203 |
| 259 | Ga0207670_10000192 | 3300025936 | Bacteria | 40572 |
| 260 | Ga0207669_10001198 | 3300025937 | Bacteria | 11035 |
| 261 | Ga0207704_10001160 | 3300025938 | Bacteria | 11731 |
| 262 | Ga0207665_10127602 | 3300025939 | Bacteria | 1802 |
| 263 | Ga0207691_10000074 | 3300025940 | Bacteria | 83272 |
| 264 | Ga0207711_10003833 | 3300025941 | Bacteria | 12935 |
| 265 | Ga0207711_10210258 | 3300025941 | Bacteria | 1777 |
| 266 | Ga0207689_10000093 | 3300025942 | Bacteria | 72709 |
| 267 | Ga0207689_10067781 | 3300025942 | Bacteria | 2932 |
| 268 | Ga0207661_10003792 | 3300025944 | Bacteria | 10540 |
| 269 | Ga0207661_10015997 | 3300025944 | Bacteria | 5529 |
| 270 | Ga0207661_10599127 | 3300025944 | Bacteria | 1011 |
| 271 | Ga0207679_10001995 | 3300025945 | Bacteria | 12665 |
| 272 | Ga0207679_10004827 | 3300025945 | Bacteria | 8405 |
| 273 | Ga0207667_10009673 | 3300025949 | Bacteria | 11340 |
| 274 | Ga0207651_10000037 | 3300025960 | Bacteria | 63878 |
| 275 | Ga0207712_10002932 | 3300025961 | Bacteria | 10897 |
| 276 | Ga0207668_10002925 | 3300025972 | Bacteria | 10021 |
| 277 | Ga0207668_10993262 | 3300025972 | Bacteria | 750 |
| 278 | Ga0207640_10005156 | 3300025981 | Bacteria | 7105 |
| 279 | Ga0207658_10000162 | 3300025986 | Bacteria | 71223 |
| 280 | Ga0207658_10307178 | 3300025986 | Bacteria | 1369 |
| 281 | Ga0207658_11000254 | 3300025986 | Bacteria | 763 |
| 282 | Ga0207677_10000149 | 3300026023 | Bacteria | 56199 |
| 283 | Ga0207703_10000718 | 3300026035 | Bacteria | 32659 |
| 284 | Ga0207639_10002522 | 3300026041 | Bacteria | 12280 |
| 285 | Ga0207678_10004557 | 3300026067 | Bacteria | 12467 |
| 286 | Ga0207708_10004377 | 3300026075 | Bacteria | 10406 |
| 287 | Ga0207702_10002848 | 3300026078 | Bacteria | 16174 |
| 288 | Ga0207641_10003922 | 3300026088 | Bacteria | 13008 |
| 289 | Ga0207641_10718030 | 3300026088 | Bacteria | 985 |
| 290 | Ga0207648_10000183 | 3300026089 | Bacteria | 66175 |
| 291 | Ga0207648_10480403 | 3300026089 | Unclassified | 1135 |
| 292 | Ga0207676_10004944 | 3300026095 | Bacteria | 9447 |
| 293 | Ga0207674_10005861 | 3300026116 | Bacteria | 14562 |
| 294 | Ga0207675_100000008 | 3300026118 | Bacteria | 182355 |
| 295 | Ga0207683_10000629 | 3300026121 | Bacteria | 32310 |
| 296 | Ga0207698_10001829 | 3300026142 | Bacteria | 12438 |
| 297 | Ga0207698_10261377 | 3300026142 | Bacteria | 1590 |
| 298 | Ga0207428_10005681 | 3300027907 | Bacteria | 11589 |
| 299 | Ga0207428_10051835 | 3300027907 | Bacteria | 3279 |
| 300 | Ga0268266_10000447 | 3300028379 | Bacteria | 61156 |
| 301 | Ga0268266_10258832 | 3300028379 | Bacteria | 1612 |
| 302 | Ga0268266_10465874 | 3300028379 | Bacteria | 1203 |
| 303 | Ga0268265_10000207 | 3300028380 | Bacteria | 68399 |
| 304 | Ga0268264_10001769 | 3300028381 | Bacteria | 19752 |
| 305 | Ga0268264_10055417 | 3300028381 | Bacteria | 3313 |
| 306 | Ga0268264_10160821 | 3300028381 | Bacteria | 2023 |
| 307 | Ga0265760_10022980 | 3300031090 | Bacteria | 1809 |
| 308 | Ga0307408_100005628 | 3300031548 | Bacteria | 8378 |
| 309 | Ga0307413_10019524 | 3300031824 | Bacteria | 3584 |
| 310 | Ga0307410_10122544 | 3300031852 | Bacteria | 1898 |
| 311 | Ga0307406_10194499 | 3300031901 | Bacteria | 1488 |
| 312 | Ga0307407_10088339 | 3300031903 | Bacteria | 1893 |
| 313 | Ga0307407_10369007 | 3300031903 | Bacteria | 1021 |
| 314 | Ga0307409_100091681 | 3300031995 | Bacteria | 2491 |
| 315 | Ga0307409_100255370 | 3300031995 | Bacteria | 1605 |
| 316 | Ga0307409_100286391 | 3300031995 | Bacteria | 1526 |
| 317 | Ga0307409_100660832 | 3300031995 | Bacteria | 1040 |
| 318 | Ga0307416_100017738 | 3300032002 | Bacteria | 4991 |
| 319 | Ga0307416_101749666 | 3300032002 | Bacteria | 726 |
| 320 | Ga0307414_10026505 | 3300032004 | Bacteria | 3731 |
| 321 | Ga0307411_10014298 | 3300032005 | Bacteria | 4411 |
| 322 | Ga0373930_0172631 | 3300034816 | Bacteria | 552 |
| 323 | Ga0373938_0220916 | 3300034957 | Bacteria | 532 |
| 324 | Ga0373934_0020040 | 3300035086 | Bacteria | 2571 |
| 325 | Ga0373923_0195953 | 3300035111 | Bacteria | 932 |
| 326 | Ga0373932_0087372 | 3300035112 | Bacteria | 995 |
| 327 | Ga0373932_0115388 | 3300035112 | Bacteria | 890 |
| 328 | Ga0373936_0444435 | 3300035113 | Unclassified | 599 |
| 329 | Ga0373936_0498015 | 3300035113 | Bacteria | 566 |
| 330 | Ga0373939_0010849 | 3300035114 | Bacteria | 2289 |
| 331 | Ga0373939_0055266 | 3300035114 | Bacteria | 1246 |
| 332 | Ga0373953_0117496 | 3300035117 | Bacteria | 1128 |
| 333 | Ga0373954_0009530 | 3300035118 | Bacteria | 4272 |
| 334 | Ga0373956_0002393 | 3300035119 | Bacteria | 7665 |
| 335 | Ga0373957_0079629 | 3300035120 | Bacteria | 1292 |
| 336 | Ga0373943_0054622 | 3300035170 | Bacteria | 1976 |
| 337 | Ga0373955_0155867 | 3300035172 | Bacteria | 1345 |
| 338 | Ga0373942_0289261 | 3300035207 | Bacteria | 566 |
| 339 | Ga0373962_0052357 | 3300035242 | Bacteria | 1179 |
| 340 | Ga0373924_0040459 | 3300035410 | Bacteria | 1908 |
| 341 | Ga0373931_0902537 | 3300035691 | Bacteria | 594 |
| 342 | Ga0373935_0910828 | 3300035692 | Bacteria | 651 |
| 343 | Ga0373927_0114629 | 3300035695 | Bacteria | 1757 |
| 344 | Ga0373927_0806093 | 3300035695 | Bacteria | 620 |
| 345 | Ga0373933_0077144 | 3300035724 | Bacteria | 2036 |
| 346 | Ga0373933_0154748 | 3300035724 | Bacteria | 1454 |
| 347 | Ga0373937_0008558 | 3300036401 | Bacteria | 8888 |
| 348 | Ga0373925_0366580 | 3300037068 | Bacteria | 1171 |
| 349 | Ga0395900_0177921 | 3300037418 | Bacteria | 2163 |
| 350 | Ga0395898_1258280 | 3300037466 | Unclassified | 670 |
| 351 | Ga0395901_1058581 | 3300038443 | Bacteria | 784 |
| 352 | Ga0436360_0401191 | 3300039438 | Bacteria | 1459 |
| 353 | Ga0466960_0005392 | 3300044901 | Bacteria | 5065 |
| 354 | Ga0466959_0258502 | 3300045049 | Bacteria | 1199 |
| 355 | Ga0466959_0485321 | 3300045049 | Bacteria | 836 |
| 356 | Ga0466967_0178027 | 3300045976 | Bacteria | 2004 |
| 357 | Ga0495592_0122757 | 3300046454 | Bacteria | 1825 |
| 358 | Ga0495651_0233755 | 3300046462 | Bacteria | 1264 |
| 359 | Ga0495653_0096896 | 3300046463 | Bacteria | 2144 |
| 360 | Ga0495639_0061952 | 3300046475 | Bacteria | 1716 |
| 361 | Ga0495662_0164270 | 3300046476 | Bacteria | 1094 |
| 362 | Ga0495664_0005981 | 3300046477 | Bacteria | 6706 |
| 363 | Ga0495608_0005395 | 3300046511 | Bacteria | 9135 |
| 364 | Ga0495618_0178368 | 3300046514 | Bacteria | 1350 |
| 365 | Ga0495618_0207540 | 3300046514 | Bacteria | 1239 |
| 366 | Ga0495628_0081816 | 3300046516 | Bacteria | 2508 |
| 367 | Ga0495628_0329760 | 3300046516 | Bacteria | 1125 |
| 368 | Ga0495630_0634140 | 3300046517 | Bacteria | 819 |
| 369 | Ga0495652_0067895 | 3300046529 | Bacteria | 2988 |
| 370 | Ga0495640_0042844 | 3300046533 | Bacteria | 3155 |
| 371 | Ga0495587_0003175 | 3300046536 | Bacteria | 10986 |
| 372 | Ga0495645_0000553 | 3300046543 | Bacteria | 25656 |
| 373 | Ga0495667_0088314 | 3300046559 | Bacteria | 2009 |
| 374 | Ga0495667_0581342 | 3300046559 | Bacteria | 698 |
| 375 | Ga0495635_0030142 | 3300046663 | Bacteria | 3770 |
| 376 | Ga0495657_0024863 | 3300046675 | Bacteria | 4258 |
| 377 | Ga0495599_0030466 | 3300046678 | Bacteria | 3384 |
| 378 | Ga0495599_0263786 | 3300046678 | Bacteria | 1046 |
| 379 | Ga0495623_0064433 | 3300046679 | Bacteria | 2293 |
| 380 | Ga0495646_0005995 | 3300046680 | Bacteria | 7704 |
| 381 | Ga0495658_0501302 | 3300046683 | Bacteria | 777 |
| 382 | Ga0495624_0873657 | 3300046690 | Bacteria | 530 |
| 383 | Ga0495604_0072638 | 3300047317 | Bacteria | 2599 |
| 384 | Ga0495674_0479040 | 3300047319 | Bacteria | 997 |
| 385 | Ga0495680_0054414 | 3300047322 | Bacteria | 3108 |
| 386 | Ga0495675_0005326 | 3300047444 | Bacteria | 7840 |
| 387 | Ga0495684_0010303 | 3300047471 | Bacteria | 7231 |
| 388 | Ga0495602_0005535 | 3300048088 | Bacteria | 13252 |
| 389 | Ga0495602_0254121 | 3300048088 | Bacteria | 1308 |
| 390 | Ga0496100_0056356 | 3300048903 | Bacteria | 2571 |
| 391 | Ga0496100_0629785 | 3300048903 | Bacteria | 834 |
| 392 | Ga0496102_0004945 | 3300048905 | Bacteria | 11293 |
| 393 | Ga0496103_0086607 | 3300048906 | Bacteria | 1975 |
| 394 | Ga0496103_0263542 | 3300048906 | Bacteria | 1109 |
| 395 | Ga0496104_0459273 | 3300048907 | Bacteria | 1185 |
| 396 | Ga0496106_0003161 | 3300048909 | Bacteria | 12295 |
| 397 | Ga0496107_0014893 | 3300048910 | Bacteria | 5445 |
| 398 | Ga0496107_1102311 | 3300048910 | Unclassified | 573 |
| 399 | Ga0496109_0006943 | 3300048912 | Bacteria | 9557 |
| 400 | Ga0496111_0470192 | 3300048914 | Bacteria | 927 |
| 401 | Ga0496112_0000430 | 3300048915 | Bacteria | 27772 |
| 402 | Ga0496113_0017831 | 3300048916 | Bacteria | 4935 |
| 403 | Ga0496126_0085345 | 3300048929 | Bacteria | 2783 |
| 404 | Ga0496126_0286445 | 3300048929 | Bacteria | 1363 |
| 405 | Ga0501031_0657617 | 3300049568 | Bacteria | 673 |
| 406 | Ga0501036_0103141 | 3300049572 | Bacteria | 2413 |
| 407 | Ga0501039_0325569 | 3300049575 | Bacteria | 1208 |
| 408 | Ga0501039_1225910 | 3300049575 | Bacteria | 580 |
| 409 | Ga0501040_0271596 | 3300049576 | Bacteria | 1211 |
| 410 | Ga0501068_0279500 | 3300049584 | Bacteria | 1067 |
| 411 | Ga0501071_1380366 | 3300049587 | Bacteria | 544 |
| 412 | Ga0501072_1165501 | 3300049588 | Bacteria | 599 |
| 413 | Ga0501076_0030469 | 3300049592 | Bacteria | 4202 |
| 414 | Ga0501076_0055941 | 3300049592 | Bacteria | 3130 |
| 415 | Ga0501077_0240074 | 3300049593 | Bacteria | 1152 |
| 416 | Ga0501199_009386 | 3300049650 | Bacteria | 1034 |
| 417 | Ga0501209_073241 | 3300049656 | Bacteria | 977 |
| 418 | Ga0501080_0423867 | 3300049742 | Bacteria | 1195 |
| 419 | Ga0501080_1572272 | 3300049742 | Bacteria | 557 |
| 420 | Ga0501268_001391 | 3300049765 | Bacteria | 3013 |
| 421 | nmdc:mga00v17_96815_c1 | 3300050491 | Bacteria | 1859 |
| 422 | nmdc:mga05p37_70774_c1 | 3300050507 | Bacteria | 1689 |
| 423 | nmdc:mga08y16_134786_c1 | 3300050511 | Bacteria | 2567 |
| 424 | nmdc:mga08y16_40075_c1 | 3300050511 | Bacteria | 4912 |
| 425 | nmdc:mga0n895_2115_c1 | 3300050512 | Bacteria | 15326 |
| 426 | nmdc:mga0rr50_30630_c1 | 3300050513 | Bacteria | 3811 |
| 427 | nmdc:mga0rr50_564907_c1 | 3300050513 | Bacteria | 969 |
| 428 | nmdc:mga08x19_1276617_c1 | 3300050514 | Unclassified | 520 |
| 429 | nmdc:mga0a205_3719_c1 | 3300050515 | Bacteria | 5205 |
| 430 | Ga0495601_0005040 | 3300053077 | Bacteria | 7667 |
| 431 | Ga0495601_0121762 | 3300053077 | Bacteria | 1695 |
| 432 | Ga0495612_0001349 | 3300053078 | Bacteria | 10114 |
| 433 | Ga0495595_0060142 | 3300053084 | Bacteria | 1778 |
| 434 | Ga0495619_0072590 | 3300053085 | Bacteria | 2305 |
| 435 | Ga0501084_0026883 | 3300054114 | Bacteria | 4807 |
| 436 | Ga0501084_0411136 | 3300054114 | Bacteria | 1144 |
| 437 | Ga0501082_0066915 | 3300060353 | Bacteria | 3094 |
| 438 | Ga0501082_0659399 | 3300060353 | Bacteria | 916 |
| 439 | Ga0501082_1588723 | 3300060353 | Bacteria | 571 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100177926 | Ga0068869_1001779262 | 110 |
| 2 | 3300005617 | Ga0068859_101904523 | Ga0068859_1019045232 | 110 |
| 3 | 3300005841 | Ga0068863_100195043 | Ga0068863_1001950432 | 110 |
| 4 | 3300005843 | Ga0068860_100088217 | Ga0068860_1000882173 | 110 |
| 5 | 3300006931 | Ga0097620_101904570 | Ga0097620_1019045702 | 110 |
| 6 | 3300025942 | Ga0207689_10067781 | Ga0207689_100677814 | 110 |
| 7 | 3300026088 | Ga0207641_10718030 | Ga0207641_107180302 | 110 |
| 8 | 3300028381 | Ga0268264_10055417 | Ga0268264_100554173 | 110 |
| 9 | 3300049584 | Ga0501068_0279500 | Ga0501068_0279500_660_1013 | 117 |
| 10 | 3300049588 | Ga0501072_1165501 | Ga0501072_1165501_199_552 | 117 |
| 11 | 3300049592 | Ga0501076_0030469 | Ga0501076_0030469_1109_1462 | 117 |
| 12 | 3300049742 | Ga0501080_1572272 | Ga0501080_1572272_104_457 | 117 |
| 13 | 3300054114 | Ga0501084_0411136 | Ga0501084_0411136_240_593 | 117 |
| 14 | 3300009036 | Ga0105244_10518864 | Ga0105244_105188641 | 118 |
| 15 | 3300009092 | Ga0105250_10033885 | Ga0105250_100338853 | 118 |
| 16 | 3300009093 | Ga0105240_10002245 | Ga0105240_1000224527 | 118 |
| 17 | 3300009098 | Ga0105245_10003327 | Ga0105245_100033275 | 118 |
| 18 | 3300009101 | Ga0105247_10002337 | Ga0105247_100023375 | 118 |
| 19 | 3300009148 | Ga0105243_10003979 | Ga0105243_100039793 | 118 |
| 20 | 3300009174 | Ga0105241_10006472 | Ga0105241_100064725 | 118 |
| 21 | 3300009176 | Ga0105242_10001831 | Ga0105242_100018313 | 118 |
| 22 | 3300009177 | Ga0105248_10001907 | Ga0105248_1000190715 | 118 |
| 23 | 3300009545 | Ga0105237_10000920 | Ga0105237_1000092031 | 118 |
| 24 | 3300009551 | Ga0105238_10000349 | Ga0105238_1000034926 | 118 |
| 25 | 3300009553 | Ga0105249_10000378 | Ga0105249_1000037815 | 118 |
| 26 | 3300010375 | Ga0105239_10000911 | Ga0105239_1000091129 | 118 |
| 27 | 3300011119 | Ga0105246_10007207 | Ga0105246_100072072 | 118 |
| 28 | 3300013100 | Ga0157373_10000740 | Ga0157373_1000074012 | 118 |
| 29 | 3300013102 | Ga0157371_10001951 | Ga0157371_1000195112 | 118 |
| 30 | 3300013105 | Ga0157369_10000611 | Ga0157369_1000061131 | 118 |
| 31 | 3300013296 | Ga0157374_10053862 | Ga0157374_100538624 | 118 |
| 32 | 3300013297 | Ga0157378_10001378 | Ga0157378_100013788 | 118 |
| 33 | 3300013306 | Ga0163162_10002286 | Ga0163162_100022866 | 118 |
| 34 | 3300013307 | Ga0157372_10001256 | Ga0157372_1000125625 | 118 |
| 35 | 3300013308 | Ga0157375_10003080 | Ga0157375_100030807 | 118 |
| 36 | 3300014325 | Ga0163163_10019859 | Ga0163163_100198598 | 118 |
| 37 | 3300014326 | Ga0157380_10082040 | Ga0157380_100820402 | 118 |
| 38 | 3300014745 | Ga0157377_10003502 | Ga0157377_1000350210 | 118 |
| 39 | 3300014968 | Ga0157379_10006844 | Ga0157379_1000684410 | 118 |
| 40 | 3300014969 | Ga0157376_10001171 | Ga0157376_1000117115 | 118 |
| 41 | 3300048903 | Ga0496100_0056356 | Ga0496100_0056356_1348_1704 | 118 |
| 42 | 3300048905 | Ga0496102_0004945 | Ga0496102_0004945_4408_4764 | 118 |
| 43 | 3300048906 | Ga0496103_0086607 | Ga0496103_0086607_679_1035 | 118 |
| 44 | 3300048907 | Ga0496104_0459273 | Ga0496104_0459273_352_708 | 118 |
| 45 | 3300048909 | Ga0496106_0003161 | Ga0496106_0003161_7354_7710 | 118 |
| 46 | 3300048910 | Ga0496107_0014893 | Ga0496107_0014893_4427_4783 | 118 |
| 47 | 3300048912 | Ga0496109_0006943 | Ga0496109_0006943_8048_8404 | 118 |
| 48 | 3300048915 | Ga0496112_0000430 | Ga0496112_0000430_14936_15292 | 118 |
| 49 | 3300048916 | Ga0496113_0017831 | Ga0496113_0017831_4087_4443 | 118 |
| 50 | 3300050513 | nmdc:mga0rr50_564907_c1 | nmdc:mga0rr50_564907_c1_12_368 | 118 |
| 51 | 3300005615 | Ga0070702_100913128 | Ga0070702_1009131281 | 124 |
| 52 | 3300049593 | Ga0501077_0240074 | Ga0501077_0240074_435_809 | 124 |
| 53 | 3300005355 | Ga0070671_100778633 | Ga0070671_1007786332 | 125 |
| 54 | 3300014325 | Ga0163163_10485898 | Ga0163163_104858983 | 125 |
| 55 | 3300025931 | Ga0207644_10187655 | Ga0207644_101876552 | 125 |
| 56 | 3300005327 | Ga0070658_10000992 | Ga0070658_1000099235 | 126 |
| 57 | 3300005333 | Ga0070677_10225820 | Ga0070677_102258202 | 126 |
| 58 | 3300005367 | Ga0070667_100251125 | Ga0070667_1002511252 | 126 |
| 59 | 3300005434 | Ga0070709_10030079 | Ga0070709_100300794 | 126 |
| 60 | 3300005435 | Ga0070714_100681479 | Ga0070714_1006814792 | 126 |
| 61 | 3300005436 | Ga0070713_100007391 | Ga0070713_1000073913 | 126 |
| 62 | 3300005437 | Ga0070710_10084739 | Ga0070710_100847393 | 126 |
| 63 | 3300005437 | Ga0070710_10220323 | Ga0070710_102203231 | 126 |
| 64 | 3300005439 | Ga0070711_100005208 | Ga0070711_1000052082 | 126 |
| 65 | 3300005563 | Ga0068855_101103415 | Ga0068855_1011034152 | 126 |
| 66 | 3300005983 | Ga0081540_1010115 | Ga0081540_10101154 | 126 |
| 67 | 3300006163 | Ga0070715_10051443 | Ga0070715_100514433 | 126 |
| 68 | 3300006173 | Ga0070716_100056676 | Ga0070716_1000566762 | 126 |
| 69 | 3300006175 | Ga0070712_100012551 | Ga0070712_1000125515 | 126 |
| 70 | 3300006237 | Ga0097621_100069093 | Ga0097621_1000690933 | 126 |
| 71 | 3300006237 | Ga0097621_100727280 | Ga0097621_1007272802 | 126 |
| 72 | 3300009094 | Ga0111539_10014741 | Ga0111539_100147418 | 126 |
| 73 | 3300009176 | Ga0105242_10045491 | Ga0105242_100454915 | 126 |
| 74 | 3300009177 | Ga0105248_10273331 | Ga0105248_102733312 | 126 |
| 75 | 3300009177 | Ga0105248_11797969 | Ga0105248_117979692 | 126 |
| 76 | 3300009551 | Ga0105238_10886137 | Ga0105238_108861372 | 126 |
| 77 | 3300014969 | Ga0157376_10209228 | Ga0157376_102092283 | 126 |
| 78 | 3300025898 | Ga0207692_10019547 | Ga0207692_100195472 | 126 |
| 79 | 3300025903 | Ga0207680_10308483 | Ga0207680_103084832 | 126 |
| 80 | 3300025905 | Ga0207685_10011544 | Ga0207685_100115442 | 126 |
| 81 | 3300025906 | Ga0207699_10056065 | Ga0207699_100560652 | 126 |
| 82 | 3300025914 | Ga0207671_10988725 | Ga0207671_109887252 | 126 |
| 83 | 3300025915 | Ga0207693_10010294 | Ga0207693_100102945 | 126 |
| 84 | 3300025916 | Ga0207663_10042416 | Ga0207663_100424162 | 126 |
| 85 | 3300025924 | Ga0207694_10603687 | Ga0207694_106036872 | 126 |
| 86 | 3300025928 | Ga0207700_10042158 | Ga0207700_100421583 | 126 |
| 87 | 3300025939 | Ga0207665_10127602 | Ga0207665_101276023 | 126 |
| 88 | 3300025941 | Ga0207711_10210258 | Ga0207711_102102582 | 126 |
| 89 | 3300025986 | Ga0207658_10307178 | Ga0207658_103071783 | 126 |
| 90 | 3300031901 | Ga0307406_10194499 | Ga0307406_101944992 | 126 |
| 91 | 3300031903 | Ga0307407_10369007 | Ga0307407_103690072 | 126 |
| 92 | 3300031995 | Ga0307409_100286391 | Ga0307409_1002863912 | 126 |
| 93 | 3300031995 | Ga0307409_100660832 | Ga0307409_1006608322 | 126 |
| 94 | 3300032002 | Ga0307416_100017738 | Ga0307416_1000177387 | 126 |
| 95 | 3300032002 | Ga0307416_101749666 | Ga0307416_1017496662 | 126 |
| 96 | 3300035086 | Ga0373934_0020040 | Ga0373934_0020040_1334_1738 | 126 |
| 97 | 3300035111 | Ga0373923_0195953 | Ga0373923_0195953_419_823 | 126 |
| 98 | 3300035113 | Ga0373936_0444435 | Ga0373936_0444435_92_496 | 126 |
| 99 | 3300035113 | Ga0373936_0498015 | Ga0373936_0498015_69_485 | 126 |
| 100 | 3300035117 | Ga0373953_0117496 | Ga0373953_0117496_170_574 | 126 |
| 101 | 3300035118 | Ga0373954_0009530 | Ga0373954_0009530_3545_3949 | 126 |
| 102 | 3300035119 | Ga0373956_0002393 | Ga0373956_0002393_815_1219 | 126 |
| 103 | 3300035120 | Ga0373957_0079629 | Ga0373957_0079629_160_564 | 126 |
| 104 | 3300035170 | Ga0373943_0054622 | Ga0373943_0054622_1217_1621 | 126 |
| 105 | 3300035172 | Ga0373955_0155867 | Ga0373955_0155867_113_517 | 126 |
| 106 | 3300035410 | Ga0373924_0040459 | Ga0373924_0040459_570_974 | 126 |
| 107 | 3300035695 | Ga0373927_0806093 | Ga0373927_0806093_156_560 | 126 |
| 108 | 3300035724 | Ga0373933_0077144 | Ga0373933_0077144_1517_1921 | 126 |
| 109 | 3300036401 | Ga0373937_0008558 | Ga0373937_0008558_7968_8372 | 126 |
| 110 | 3300037068 | Ga0373925_0366580 | Ga0373925_0366580_90_494 | 126 |
| 111 | 3300046454 | Ga0495592_0122757 | Ga0495592_0122757_455_859 | 126 |
| 112 | 3300046462 | Ga0495651_0233755 | Ga0495651_0233755_547_951 | 126 |
| 113 | 3300046463 | Ga0495653_0096896 | Ga0495653_0096896_1422_1826 | 126 |
| 114 | 3300046475 | Ga0495639_0061952 | Ga0495639_0061952_50_466 | 126 |
| 115 | 3300046476 | Ga0495662_0164270 | Ga0495662_0164270_408_812 | 126 |
| 116 | 3300046477 | Ga0495664_0005981 | Ga0495664_0005981_4706_5110 | 126 |
| 117 | 3300046511 | Ga0495608_0005395 | Ga0495608_0005395_1161_1565 | 126 |
| 118 | 3300046514 | Ga0495618_0178368 | Ga0495618_0178368_739_1143 | 126 |
| 119 | 3300046516 | Ga0495628_0081816 | Ga0495628_0081816_1422_1826 | 126 |
| 120 | 3300046517 | Ga0495630_0634140 | Ga0495630_0634140_63_467 | 126 |
| 121 | 3300046529 | Ga0495652_0067895 | Ga0495652_0067895_635_1039 | 126 |
| 122 | 3300046533 | Ga0495640_0042844 | Ga0495640_0042844_2537_2941 | 126 |
| 123 | 3300046536 | Ga0495587_0003175 | Ga0495587_0003175_894_1298 | 126 |
| 124 | 3300046543 | Ga0495645_0000553 | Ga0495645_0000553_25168_25572 | 126 |
| 125 | 3300046559 | Ga0495667_0088314 | Ga0495667_0088314_1492_1896 | 126 |
| 126 | 3300046559 | Ga0495667_0581342 | Ga0495667_0581342_181_585 | 126 |
| 127 | 3300046663 | Ga0495635_0030142 | Ga0495635_0030142_2932_3336 | 126 |
| 128 | 3300046675 | Ga0495657_0024863 | Ga0495657_0024863_1625_2029 | 126 |
| 129 | 3300046678 | Ga0495599_0030466 | Ga0495599_0030466_1299_1703 | 126 |
| 130 | 3300046679 | Ga0495623_0064433 | Ga0495623_0064433_1666_2070 | 126 |
| 131 | 3300046680 | Ga0495646_0005995 | Ga0495646_0005995_927_1331 | 126 |
| 132 | 3300047317 | Ga0495604_0072638 | Ga0495604_0072638_100_504 | 126 |
| 133 | 3300047319 | Ga0495674_0479040 | Ga0495674_0479040_482_886 | 126 |
| 134 | 3300047322 | Ga0495680_0054414 | Ga0495680_0054414_1501_1905 | 126 |
| 135 | 3300047444 | Ga0495675_0005326 | Ga0495675_0005326_1666_2070 | 126 |
| 136 | 3300047471 | Ga0495684_0010303 | Ga0495684_0010303_3156_3560 | 126 |
| 137 | 3300048088 | Ga0495602_0005535 | Ga0495602_0005535_12083_12487 | 126 |
| 138 | 3300048929 | Ga0496126_0085345 | Ga0496126_0085345_1807_2205 | 126 |
| 139 | 3300049650 | Ga0501199_009386 | Ga0501199_009386_396_800 | 126 |
| 140 | 3300049656 | Ga0501209_073241 | Ga0501209_073241_436_840 | 126 |
| 141 | 3300049765 | Ga0501268_001391 | Ga0501268_001391_427_831 | 126 |
| 142 | 3300053077 | Ga0495601_0005040 | Ga0495601_0005040_2320_2724 | 126 |
| 143 | 3300053078 | Ga0495612_0001349 | Ga0495612_0001349_7410_7814 | 126 |
| 144 | 3300053085 | Ga0495619_0072590 | Ga0495619_0072590_1166_1570 | 126 |
| 145 | 3300005340 | Ga0070689_100329343 | Ga0070689_1003293431 | 127 |
| 146 | 3300005347 | Ga0070668_100495076 | Ga0070668_1004950763 | 127 |
| 147 | 3300005356 | Ga0070674_100232599 | Ga0070674_1002325993 | 127 |
| 148 | 3300005437 | Ga0070710_10080199 | Ga0070710_100801993 | 127 |
| 149 | 3300005459 | Ga0068867_100156754 | Ga0068867_1001567543 | 127 |
| 150 | 3300005548 | Ga0070665_100053360 | Ga0070665_1000533603 | 127 |
| 151 | 3300009553 | Ga0105249_12319854 | Ga0105249_123198542 | 127 |
| 152 | 3300025898 | Ga0207692_10086153 | Ga0207692_100861533 | 127 |
| 153 | 3300025928 | Ga0207700_10075594 | Ga0207700_100755944 | 127 |
| 154 | 3300026089 | Ga0207648_10480403 | Ga0207648_104804032 | 127 |
| 155 | 3300028379 | Ga0268266_10258832 | Ga0268266_102588322 | 127 |
| 156 | 3300049742 | Ga0501080_0423867 | Ga0501080_0423867_638_1039 | 127 |
| 157 | 3300060353 | Ga0501082_0659399 | Ga0501082_0659399_476_877 | 127 |
| 158 | 3300005335 | Ga0070666_10316207 | Ga0070666_103162072 | 128 |
| 159 | 3300005353 | Ga0070669_100711147 | Ga0070669_1007111472 | 128 |
| 160 | 3300005547 | Ga0070693_100701612 | Ga0070693_1007016122 | 128 |
| 161 | 3300005549 | Ga0070704_100785658 | Ga0070704_1007856582 | 128 |
| 162 | 3300005719 | Ga0068861_102289053 | Ga0068861_1022890532 | 128 |
| 163 | 3300005843 | Ga0068860_100334658 | Ga0068860_1003346582 | 128 |
| 164 | 3300007076 | Ga0075435_100699382 | Ga0075435_1006993822 | 128 |
| 165 | 3300009098 | Ga0105245_12457019 | Ga0105245_124570191 | 128 |
| 166 | 3300009148 | Ga0105243_10264756 | Ga0105243_102647562 | 128 |
| 167 | 3300009545 | Ga0105237_10420151 | Ga0105237_104201512 | 128 |
| 168 | 3300009553 | Ga0105249_10858522 | Ga0105249_108585222 | 128 |
| 169 | 3300013306 | Ga0163162_10897423 | Ga0163162_108974233 | 128 |
| 170 | 3300013306 | Ga0163162_12944009 | Ga0163162_129440092 | 128 |
| 171 | 3300014325 | Ga0163163_12252994 | Ga0163163_122529942 | 128 |
| 172 | 3300014968 | Ga0157379_10126777 | Ga0157379_101267776 | 128 |
| 173 | 3300025923 | Ga0207681_10799112 | Ga0207681_107991122 | 128 |
| 174 | 3300025972 | Ga0207668_10993262 | Ga0207668_109932622 | 128 |
| 175 | 3300028379 | Ga0268266_10465874 | Ga0268266_104658742 | 128 |
| 176 | 3300028381 | Ga0268264_10160821 | Ga0268264_101608213 | 128 |
| 177 | 3300034816 | Ga0373930_0172631 | Ga0373930_0172631_86_490 | 128 |
| 178 | 3300035207 | Ga0373942_0289261 | Ga0373942_0289261_71_475 | 128 |
| 179 | 3300035691 | Ga0373931_0902537 | Ga0373931_0902537_173_577 | 128 |
| 180 | 3300037418 | Ga0395900_0177921 | Ga0395900_0177921_1231_1635 | 128 |
| 181 | 3300037466 | Ga0395898_1258280 | Ga0395898_1258280_151_555 | 128 |
| 182 | 3300045976 | Ga0466967_0178027 | Ga0466967_0178027_501_905 | 128 |
| 183 | 3300048903 | Ga0496100_0629785 | Ga0496100_0629785_109_540 | 128 |
| 184 | 3300048906 | Ga0496103_0263542 | Ga0496103_0263542_17_421 | 128 |
| 185 | 3300048929 | Ga0496126_0286445 | Ga0496126_0286445_916_1320 | 128 |
| 186 | 3300014326 | Ga0157380_10132440 | Ga0157380_101324402 | 129 |
| 187 | 3300014968 | Ga0157379_10096539 | Ga0157379_100965393 | 129 |
| 188 | 3300035112 | Ga0373932_0115388 | Ga0373932_0115388_104_493 | 129 |
| 189 | 3300009174 | Ga0105241_12592376 | Ga0105241_125923761 | 131 |
| 190 | 3300044901 | Ga0466960_0005392 | Ga0466960_0005392_1475_1876 | 131 |
| 191 | 3300046683 | Ga0495658_0501302 | Ga0495658_0501302_45_443 | 131 |
| 192 | 3300005364 | Ga0070673_100037590 | Ga0070673_1000375902 | 132 |
| 193 | 3300005535 | Ga0070684_100055313 | Ga0070684_1000553132 | 132 |
| 194 | 3300005564 | Ga0070664_101354773 | Ga0070664_1013547731 | 132 |
| 195 | 3300013307 | Ga0157372_11285156 | Ga0157372_112851562 | 132 |
| 196 | 3300025944 | Ga0207661_10015997 | Ga0207661_100159976 | 132 |
| 197 | 3300045049 | Ga0466959_0258502 | Ga0466959_0258502_594_998 | 132 |
| 198 | 3300049568 | Ga0501031_0657617 | Ga0501031_0657617_204_605 | 132 |
| 199 | 3300049572 | Ga0501036_0103141 | Ga0501036_0103141_441_842 | 132 |
| 200 | 3300049575 | Ga0501039_1225910 | Ga0501039_1225910_155_556 | 132 |
| 201 | 3300049576 | Ga0501040_0271596 | Ga0501040_0271596_155_556 | 132 |
| 202 | 3300049592 | Ga0501076_0055941 | Ga0501076_0055941_1505_1906 | 132 |
| 203 | 3300060353 | Ga0501082_0066915 | Ga0501082_0066915_417_818 | 132 |
| 204 | 3300001977 | JGI24746J21847_1008313 | JGI24746J21847_10083133 | 133 |
| 205 | 3300001990 | JGI24737J22298_10019777 | JGI24737J22298_100197773 | 133 |
| 206 | 3300001991 | JGI24743J22301_10025581 | JGI24743J22301_100255813 | 133 |
| 207 | 3300002076 | JGI24749J21850_1001177 | JGI24749J21850_10011777 | 133 |
| 208 | 3300002077 | JGI24744J21845_10082392 | JGI24744J21845_100823922 | 133 |
| 209 | 3300002239 | JGI24034J26672_10022310 | JGI24034J26672_100223102 | 133 |
| 210 | 3300002244 | JGI24742J22300_10042580 | JGI24742J22300_100425802 | 133 |
| 211 | 3300002459 | JGI24751J29686_10002625 | JGI24751J29686_100026253 | 133 |
| 212 | 3300005289 | Ga0065704_10071895 | Ga0065704_100718955 | 133 |
| 213 | 3300005290 | Ga0065712_10073698 | Ga0065712_100736983 | 133 |
| 214 | 3300005327 | Ga0070658_10001180 | Ga0070658_1000118014 | 133 |
| 215 | 3300005327 | Ga0070658_10202105 | Ga0070658_102021052 | 133 |
| 216 | 3300005327 | Ga0070658_10217825 | Ga0070658_102178252 | 133 |
| 217 | 3300005327 | Ga0070658_10379637 | Ga0070658_103796371 | 133 |
| 218 | 3300005328 | Ga0070676_10000049 | Ga0070676_1000004918 | 133 |
| 219 | 3300005329 | Ga0070683_100598574 | Ga0070683_1005985742 | 133 |
| 220 | 3300005330 | Ga0070690_100001148 | Ga0070690_1000011485 | 133 |
| 221 | 3300005330 | Ga0070690_100298205 | Ga0070690_1002982052 | 133 |
| 222 | 3300005331 | Ga0070670_100005605 | Ga0070670_1000056055 | 133 |
| 223 | 3300005333 | Ga0070677_10000134 | Ga0070677_1000013422 | 133 |
| 224 | 3300005334 | Ga0068869_100000696 | Ga0068869_10000069614 | 133 |
| 225 | 3300005335 | Ga0070666_10000394 | Ga0070666_1000039414 | 133 |
| 226 | 3300005336 | Ga0070680_100024189 | Ga0070680_1000241894 | 133 |
| 227 | 3300005336 | Ga0070680_100028475 | Ga0070680_1000284752 | 133 |
| 228 | 3300005336 | Ga0070680_101146833 | Ga0070680_1011468332 | 133 |
| 229 | 3300005338 | Ga0068868_100003766 | Ga0068868_1000037665 | 133 |
| 230 | 3300005338 | Ga0068868_101520559 | Ga0068868_1015205592 | 133 |
| 231 | 3300005339 | Ga0070660_100000307 | Ga0070660_10000030726 | 133 |
| 232 | 3300005340 | Ga0070689_100000860 | Ga0070689_1000008609 | 133 |
| 233 | 3300005341 | Ga0070691_10024186 | Ga0070691_100241863 | 133 |
| 234 | 3300005343 | Ga0070687_100000021 | Ga0070687_10000002133 | 133 |
| 235 | 3300005344 | Ga0070661_100000275 | Ga0070661_10000027514 | 133 |
| 236 | 3300005344 | Ga0070661_100792560 | Ga0070661_1007925602 | 133 |
| 237 | 3300005345 | Ga0070692_10007480 | Ga0070692_100074804 | 133 |
| 238 | 3300005347 | Ga0070668_100000879 | Ga0070668_1000008795 | 133 |
| 239 | 3300005353 | Ga0070669_100004057 | Ga0070669_1000040575 | 133 |
| 240 | 3300005354 | Ga0070675_100001297 | Ga0070675_10000129710 | 133 |
| 241 | 3300005354 | Ga0070675_101882874 | Ga0070675_1018828742 | 133 |
| 242 | 3300005355 | Ga0070671_100001340 | Ga0070671_1000013406 | 133 |
| 243 | 3300005356 | Ga0070674_100000604 | Ga0070674_1000006048 | 133 |
| 244 | 3300005364 | Ga0070673_100000776 | Ga0070673_10000077616 | 133 |
| 245 | 3300005365 | Ga0070688_100000455 | Ga0070688_10000045511 | 133 |
| 246 | 3300005366 | Ga0070659_100000146 | Ga0070659_10000014634 | 133 |
| 247 | 3300005367 | Ga0070667_100005480 | Ga0070667_1000054805 | 133 |
| 248 | 3300005406 | Ga0070703_10109803 | Ga0070703_101098031 | 133 |
| 249 | 3300005434 | Ga0070709_10556518 | Ga0070709_105565182 | 133 |
| 250 | 3300005440 | Ga0070705_100000514 | Ga0070705_10000051415 | 133 |
| 251 | 3300005441 | Ga0070700_100003107 | Ga0070700_1000031077 | 133 |
| 252 | 3300005455 | Ga0070663_100002068 | Ga0070663_10000206810 | 133 |
| 253 | 3300005456 | Ga0070678_100006026 | Ga0070678_1000060265 | 133 |
| 254 | 3300005457 | Ga0070662_100002769 | Ga0070662_1000027695 | 133 |
| 255 | 3300005458 | Ga0070681_10400891 | Ga0070681_104008912 | 133 |
| 256 | 3300005459 | Ga0068867_100001051 | Ga0068867_10000105110 | 133 |
| 257 | 3300005466 | Ga0070685_10000788 | Ga0070685_100007885 | 133 |
| 258 | 3300005530 | Ga0070679_100000928 | Ga0070679_10000092812 | 133 |
| 259 | 3300005530 | Ga0070679_100150510 | Ga0070679_1001505103 | 133 |
| 260 | 3300005535 | Ga0070684_100004673 | Ga0070684_1000046735 | 133 |
| 261 | 3300005535 | Ga0070684_100049842 | Ga0070684_1000498424 | 133 |
| 262 | 3300005535 | Ga0070684_100050704 | Ga0070684_1000507043 | 133 |
| 263 | 3300005535 | Ga0070684_100174336 | Ga0070684_1001743362 | 133 |
| 264 | 3300005535 | Ga0070684_101839048 | Ga0070684_1018390481 | 133 |
| 265 | 3300005539 | Ga0068853_100002643 | Ga0068853_10000264311 | 133 |
| 266 | 3300005543 | Ga0070672_100002220 | Ga0070672_1000022204 | 133 |
| 267 | 3300005544 | Ga0070686_100000964 | Ga0070686_10000096411 | 133 |
| 268 | 3300005545 | Ga0070695_100035713 | Ga0070695_1000357132 | 133 |
| 269 | 3300005546 | Ga0070696_100018157 | Ga0070696_1000181573 | 133 |
| 270 | 3300005548 | Ga0070665_100008178 | Ga0070665_1000081785 | 133 |
| 271 | 3300005549 | Ga0070704_100007177 | Ga0070704_1000071773 | 133 |
| 272 | 3300005563 | Ga0068855_100002538 | Ga0068855_10000253817 | 133 |
| 273 | 3300005564 | Ga0070664_100004233 | Ga0070664_10000423310 | 133 |
| 274 | 3300005564 | Ga0070664_100035595 | Ga0070664_1000355955 | 133 |
| 275 | 3300005577 | Ga0068857_100001946 | Ga0068857_1000019467 | 133 |
| 276 | 3300005578 | Ga0068854_100001076 | Ga0068854_1000010765 | 133 |
| 277 | 3300005614 | Ga0068856_100002406 | Ga0068856_10000240613 | 133 |
| 278 | 3300005615 | Ga0070702_100002469 | Ga0070702_1000024694 | 133 |
| 279 | 3300005616 | Ga0068852_100003552 | Ga0068852_1000035529 | 133 |
| 280 | 3300005616 | Ga0068852_100636502 | Ga0068852_1006365022 | 133 |
| 281 | 3300005616 | Ga0068852_101113092 | Ga0068852_1011130922 | 133 |
| 282 | 3300005617 | Ga0068859_100003568 | Ga0068859_1000035685 | 133 |
| 283 | 3300005617 | Ga0068859_100231214 | Ga0068859_1002312142 | 133 |
| 284 | 3300005618 | Ga0068864_100000267 | Ga0068864_10000026732 | 133 |
| 285 | 3300005718 | Ga0068866_10000293 | Ga0068866_1000029318 | 133 |
| 286 | 3300005719 | Ga0068861_100001152 | Ga0068861_10000115210 | 133 |
| 287 | 3300005834 | Ga0068851_10002548 | Ga0068851_100025487 | 133 |
| 288 | 3300005834 | Ga0068851_11047513 | Ga0068851_110475131 | 133 |
| 289 | 3300005840 | Ga0068870_10000014 | Ga0068870_1000001452 | 133 |
| 290 | 3300005840 | Ga0068870_10231493 | Ga0068870_102314932 | 133 |
| 291 | 3300005841 | Ga0068863_100001125 | Ga0068863_10000112522 | 133 |
| 292 | 3300005841 | Ga0068863_100286691 | Ga0068863_1002866912 | 133 |
| 293 | 3300005842 | Ga0068858_100002425 | Ga0068858_10000242515 | 133 |
| 294 | 3300005843 | Ga0068860_100007933 | Ga0068860_1000079335 | 133 |
| 295 | 3300005844 | Ga0068862_100002595 | Ga0068862_1000025959 | 133 |
| 296 | 3300005983 | Ga0081540_1049321 | Ga0081540_10493213 | 133 |
| 297 | 3300006028 | Ga0070717_10193727 | Ga0070717_101937272 | 133 |
| 298 | 3300006051 | Ga0075364_10107583 | Ga0075364_101075833 | 133 |
| 299 | 3300006058 | Ga0075432_10041117 | Ga0075432_100411172 | 133 |
| 300 | 3300006175 | Ga0070712_100667736 | Ga0070712_1006677362 | 133 |
| 301 | 3300006237 | Ga0097621_100007806 | Ga0097621_10000780610 | 133 |
| 302 | 3300006358 | Ga0068871_100008918 | Ga0068871_1000089186 | 133 |
| 303 | 3300006846 | Ga0075430_100350775 | Ga0075430_1003507752 | 133 |
| 304 | 3300006847 | Ga0075431_100126546 | Ga0075431_1001265462 | 133 |
| 305 | 3300006852 | Ga0075433_10149918 | Ga0075433_101499183 | 133 |
| 306 | 3300006871 | Ga0075434_100002404 | Ga0075434_10000240420 | 133 |
| 307 | 3300006881 | Ga0068865_100001006 | Ga0068865_10000100616 | 133 |
| 308 | 3300006931 | Ga0097620_100003569 | Ga0097620_1000035695 | 133 |
| 309 | 3300006931 | Ga0097620_100231215 | Ga0097620_1002312153 | 133 |
| 310 | 3300007076 | Ga0075435_100033993 | Ga0075435_1000339932 | 133 |
| 311 | 3300007076 | Ga0075435_100125103 | Ga0075435_1001251033 | 133 |
| 312 | 3300009093 | Ga0105240_10005551 | Ga0105240_1000555116 | 133 |
| 313 | 3300009094 | Ga0111539_10032830 | Ga0111539_100328304 | 133 |
| 314 | 3300009147 | Ga0114129_11684620 | Ga0114129_116846202 | 133 |
| 315 | 3300009176 | Ga0105242_11961024 | Ga0105242_119610241 | 133 |
| 316 | 3300009551 | Ga0105238_10540517 | Ga0105238_105405172 | 133 |
| 317 | 3300009553 | Ga0105249_10293271 | Ga0105249_102932712 | 133 |
| 318 | 3300010375 | Ga0105239_11182734 | Ga0105239_111827342 | 133 |
| 319 | 3300012513 | Ga0157326_1000516 | Ga0157326_10005163 | 133 |
| 320 | 3300014497 | Ga0182008_10255241 | Ga0182008_102552412 | 133 |
| 321 | 3300014969 | Ga0157376_11499846 | Ga0157376_114998462 | 133 |
| 322 | 3300025315 | Ga0207697_10000456 | Ga0207697_1000045615 | 133 |
| 323 | 3300025321 | Ga0207656_10000072 | Ga0207656_1000007229 | 133 |
| 324 | 3300025885 | Ga0207653_10080254 | Ga0207653_100802542 | 133 |
| 325 | 3300025893 | Ga0207682_10000241 | Ga0207682_1000024122 | 133 |
| 326 | 3300025899 | Ga0207642_10003513 | Ga0207642_100035134 | 133 |
| 327 | 3300025900 | Ga0207710_10001308 | Ga0207710_1000130811 | 133 |
| 328 | 3300025901 | Ga0207688_10000008 | Ga0207688_1000000839 | 133 |
| 329 | 3300025903 | Ga0207680_10002146 | Ga0207680_100021466 | 133 |
| 330 | 3300025904 | Ga0207647_10001413 | Ga0207647_100014137 | 133 |
| 331 | 3300025907 | Ga0207645_10000008 | Ga0207645_1000000815 | 133 |
| 332 | 3300025908 | Ga0207643_10000008 | Ga0207643_10000008136 | 133 |
| 333 | 3300025908 | Ga0207643_10443796 | Ga0207643_104437962 | 133 |
| 334 | 3300025909 | Ga0207705_10005175 | Ga0207705_100051754 | 133 |
| 335 | 3300025909 | Ga0207705_10065630 | Ga0207705_100656302 | 133 |
| 336 | 3300025909 | Ga0207705_10172190 | Ga0207705_101721903 | 133 |
| 337 | 3300025909 | Ga0207705_10379342 | Ga0207705_103793422 | 133 |
| 338 | 3300025911 | Ga0207654_10002231 | Ga0207654_100022314 | 133 |
| 339 | 3300025912 | Ga0207707_10042145 | Ga0207707_100421455 | 133 |
| 340 | 3300025912 | Ga0207707_10383500 | Ga0207707_103835002 | 133 |
| 341 | 3300025913 | Ga0207695_10009830 | Ga0207695_1000983016 | 133 |
| 342 | 3300025913 | Ga0207695_10018237 | Ga0207695_100182375 | 133 |
| 343 | 3300025914 | Ga0207671_10015742 | Ga0207671_100157423 | 133 |
| 344 | 3300025917 | Ga0207660_10013606 | Ga0207660_100136064 | 133 |
| 345 | 3300025917 | Ga0207660_10032477 | Ga0207660_100324774 | 133 |
| 346 | 3300025918 | Ga0207662_10000012 | Ga0207662_1000001261 | 133 |
| 347 | 3300025918 | Ga0207662_10714294 | Ga0207662_107142942 | 133 |
| 348 | 3300025919 | Ga0207657_10000094 | Ga0207657_1000009447 | 133 |
| 349 | 3300025920 | Ga0207649_10001557 | Ga0207649_1000155712 | 133 |
| 350 | 3300025920 | Ga0207649_10690744 | Ga0207649_106907442 | 133 |
| 351 | 3300025921 | Ga0207652_10026299 | Ga0207652_100262997 | 133 |
| 352 | 3300025921 | Ga0207652_10088054 | Ga0207652_100880542 | 133 |
| 353 | 3300025923 | Ga0207681_10001267 | Ga0207681_100012676 | 133 |
| 354 | 3300025924 | Ga0207694_10003107 | Ga0207694_100031073 | 133 |
| 355 | 3300025925 | Ga0207650_10000222 | Ga0207650_1000022221 | 133 |
| 356 | 3300025925 | Ga0207650_10150589 | Ga0207650_101505892 | 133 |
| 357 | 3300025926 | Ga0207659_10000194 | Ga0207659_1000019411 | 133 |
| 358 | 3300025927 | Ga0207687_10012010 | Ga0207687_100120104 | 133 |
| 359 | 3300025931 | Ga0207644_10001867 | Ga0207644_1000186712 | 133 |
| 360 | 3300025932 | Ga0207690_10004972 | Ga0207690_100049724 | 133 |
| 361 | 3300025933 | Ga0207706_10000118 | Ga0207706_1000011847 | 133 |
| 362 | 3300025934 | Ga0207686_10016004 | Ga0207686_100160044 | 133 |
| 363 | 3300025936 | Ga0207670_10000192 | Ga0207670_1000019232 | 133 |
| 364 | 3300025937 | Ga0207669_10001198 | Ga0207669_1000119811 | 133 |
| 365 | 3300025938 | Ga0207704_10001160 | Ga0207704_100011604 | 133 |
| 366 | 3300025940 | Ga0207691_10000074 | Ga0207691_1000007435 | 133 |
| 367 | 3300025941 | Ga0207711_10003833 | Ga0207711_100038335 | 133 |
| 368 | 3300025942 | Ga0207689_10000093 | Ga0207689_1000009347 | 133 |
| 369 | 3300025944 | Ga0207661_10003792 | Ga0207661_100037922 | 133 |
| 370 | 3300025944 | Ga0207661_10599127 | Ga0207661_105991272 | 133 |
| 371 | 3300025945 | Ga0207679_10001995 | Ga0207679_100019955 | 133 |
| 372 | 3300025945 | Ga0207679_10004827 | Ga0207679_100048276 | 133 |
| 373 | 3300025949 | Ga0207667_10009673 | Ga0207667_100096735 | 133 |
| 374 | 3300025960 | Ga0207651_10000037 | Ga0207651_1000003746 | 133 |
| 375 | 3300025961 | Ga0207712_10002932 | Ga0207712_100029323 | 133 |
| 376 | 3300025972 | Ga0207668_10002925 | Ga0207668_100029254 | 133 |
| 377 | 3300025981 | Ga0207640_10005156 | Ga0207640_100051564 | 133 |
| 378 | 3300025986 | Ga0207658_10000162 | Ga0207658_1000016251 | 133 |
| 379 | 3300025986 | Ga0207658_11000254 | Ga0207658_110002541 | 133 |
| 380 | 3300026023 | Ga0207677_10000149 | Ga0207677_1000014946 | 133 |
| 381 | 3300026035 | Ga0207703_10000718 | Ga0207703_1000071821 | 133 |
| 382 | 3300026041 | Ga0207639_10002522 | Ga0207639_100025224 | 133 |
| 383 | 3300026067 | Ga0207678_10004557 | Ga0207678_100045576 | 133 |
| 384 | 3300026075 | Ga0207708_10004377 | Ga0207708_100043776 | 133 |
| 385 | 3300026078 | Ga0207702_10002848 | Ga0207702_100028487 | 133 |
| 386 | 3300026088 | Ga0207641_10003922 | Ga0207641_100039223 | 133 |
| 387 | 3300026089 | Ga0207648_10000183 | Ga0207648_1000018317 | 133 |
| 388 | 3300026095 | Ga0207676_10004944 | Ga0207676_100049444 | 133 |
| 389 | 3300026116 | Ga0207674_10005861 | Ga0207674_1000586111 | 133 |
| 390 | 3300026118 | Ga0207675_100000008 | Ga0207675_10000000838 | 133 |
| 391 | 3300026121 | Ga0207683_10000629 | Ga0207683_1000062925 | 133 |
| 392 | 3300026142 | Ga0207698_10001829 | Ga0207698_100018294 | 133 |
| 393 | 3300026142 | Ga0207698_10261377 | Ga0207698_102613773 | 133 |
| 394 | 3300027907 | Ga0207428_10005681 | Ga0207428_100056814 | 133 |
| 395 | 3300027907 | Ga0207428_10051835 | Ga0207428_100518354 | 133 |
| 396 | 3300028379 | Ga0268266_10000447 | Ga0268266_1000044746 | 133 |
| 397 | 3300028380 | Ga0268265_10000207 | Ga0268265_1000020747 | 133 |
| 398 | 3300028381 | Ga0268264_10001769 | Ga0268264_1000176917 | 133 |
| 399 | 3300031090 | Ga0265760_10022980 | Ga0265760_100229803 | 133 |
| 400 | 3300031548 | Ga0307408_100005628 | Ga0307408_1000056286 | 133 |
| 401 | 3300031824 | Ga0307413_10019524 | Ga0307413_100195246 | 133 |
| 402 | 3300031852 | Ga0307410_10122544 | Ga0307410_101225442 | 133 |
| 403 | 3300031903 | Ga0307407_10088339 | Ga0307407_100883393 | 133 |
| 404 | 3300031995 | Ga0307409_100091681 | Ga0307409_1000916813 | 133 |
| 405 | 3300031995 | Ga0307409_100255370 | Ga0307409_1002553702 | 133 |
| 406 | 3300032004 | Ga0307414_10026505 | Ga0307414_100265053 | 133 |
| 407 | 3300032005 | Ga0307411_10014298 | Ga0307411_100142982 | 133 |
| 408 | 3300034957 | Ga0373938_0220916 | Ga0373938_0220916_103_504 | 133 |
| 409 | 3300035112 | Ga0373932_0087372 | Ga0373932_0087372_475_903 | 133 |
| 410 | 3300035114 | Ga0373939_0010849 | Ga0373939_0010849_75_503 | 133 |
| 411 | 3300035114 | Ga0373939_0055266 | Ga0373939_0055266_577_984 | 133 |
| 412 | 3300035242 | Ga0373962_0052357 | Ga0373962_0052357_680_1108 | 133 |
| 413 | 3300035692 | Ga0373935_0910828 | Ga0373935_0910828_75_479 | 133 |
| 414 | 3300035695 | Ga0373927_0114629 | Ga0373927_0114629_1151_1555 | 133 |
| 415 | 3300035724 | Ga0373933_0154748 | Ga0373933_0154748_467_871 | 133 |
| 416 | 3300038443 | Ga0395901_1058581 | Ga0395901_1058581_74_478 | 133 |
| 417 | 3300039438 | Ga0436360_0401191 | Ga0436360_0401191_451_855 | 133 |
| 418 | 3300045049 | Ga0466959_0485321 | Ga0466959_0485321_382_804 | 133 |
| 419 | 3300046514 | Ga0495618_0207540 | Ga0495618_0207540_354_758 | 133 |
| 420 | 3300046516 | Ga0495628_0329760 | Ga0495628_0329760_67_471 | 133 |
| 421 | 3300046678 | Ga0495599_0263786 | Ga0495599_0263786_563_967 | 133 |
| 422 | 3300046690 | Ga0495624_0873657 | Ga0495624_0873657_13_453 | 133 |
| 423 | 3300048088 | Ga0495602_0254121 | Ga0495602_0254121_200_604 | 133 |
| 424 | 3300048910 | Ga0496107_1102311 | Ga0496107_1102311_115_519 | 133 |
| 425 | 3300048914 | Ga0496111_0470192 | Ga0496111_0470192_287_691 | 133 |
| 426 | 3300049575 | Ga0501039_0325569 | Ga0501039_0325569_297_701 | 133 |
| 427 | 3300049587 | Ga0501071_1380366 | Ga0501071_1380366_119_523 | 133 |
| 428 | 3300050491 | nmdc:mga00v17_96815_c1 | nmdc:mga00v17_96815_c1_1353_1757 | 133 |
| 429 | 3300050507 | nmdc:mga05p37_70774_c1 | nmdc:mga05p37_70774_c1_840_1244 | 133 |
| 430 | 3300050511 | nmdc:mga08y16_134786_c1 | nmdc:mga08y16_134786_c1_2040_2468 | 133 |
| 431 | 3300050511 | nmdc:mga08y16_40075_c1 | nmdc:mga08y16_40075_c1_485_889 | 133 |
| 432 | 3300050512 | nmdc:mga0n895_2115_c1 | nmdc:mga0n895_2115_c1_462_872 | 133 |
| 433 | 3300050513 | nmdc:mga0rr50_30630_c1 | nmdc:mga0rr50_30630_c1_1673_2083 | 133 |
| 434 | 3300050514 | nmdc:mga08x19_1276617_c1 | nmdc:mga08x19_1276617_c1_81_482 | 133 |
| 435 | 3300050515 | nmdc:mga0a205_3719_c1 | nmdc:mga0a205_3719_c1_1062_1472 | 133 |
| 436 | 3300053077 | Ga0495601_0121762 | Ga0495601_0121762_174_578 | 133 |
| 437 | 3300053084 | Ga0495595_0060142 | Ga0495595_0060142_635_1039 | 133 |
| 438 | 3300054114 | Ga0501084_0026883 | Ga0501084_0026883_3819_4223 | 133 |
| 439 | 3300060353 | Ga0501082_1588723 | Ga0501082_1588723_72_476 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m36-assembly1.cif.gz_G | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.8537 | 4 | 132 |
| 1thn-assembly1.cif.gz_A | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i | 0.8532 | 3 | 131 |
| 6m36-assembly2.cif.gz_K | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.841 | 4 | 133 |
| 1thn-assembly1.cif.gz_A | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i | 0.8239 | 3 | 131 |
| 6m36-assembly1.cif.gz_G | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.8167 | 4 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36613_15_185_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.9192 | 14 | 48 | 1.10.472.10 |
| af_Q54JB3_152_315_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8818 | 16 | 56 | 1.10.357.140 |
| 3j9x101 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8652 | 16 | 52 | 1.20.58.800 |
| af_Q9Y7Y4_92_240_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8353 | 12 | 56 | 1.10.357.140 |
| 1tidC00 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7974 | 5 | 131 | 3.30.565.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7L193-F1-model_v4 | ATP-binding protein | 0.9761 | 6 | 133 |
GO:0004674
GO:0005524 |
| AF-A0A2V9K0T1-F1-model_v4 | ATP-binding protein | 0.9748 | 4 | 88 |
GO:0005524
|
| AF-A0A2V2S9I7-F1-model_v4 | Anti-sigma regulatory factor | 0.9727 | 4 | 133 |
|
| AF-A0A1Q7RXW0-F1-model_v4 | ATP-binding protein | 0.9719 | 5 | 133 |
GO:0004674
GO:0005524 |
| AF-A0A1Q7EIC2-F1-model_v4 | Histidine kinase/HSP90-like ATPase domain-containing protein | 0.9708 | 4 | 83 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar