F444296

General Info

Members Datasets Scaffolds Average Seq Length
439 208 439 330

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0194218|Ga0501036_0194218_152_1294
Length 364
Sequence MRFQLKTSYADDLGLFRDNVQRNWYVALLAALIVLPRLLPDYTADISLVFIYALCGLSLMVLAGYTGLVSLGHAAFLGIGAYTHVYLMQDLRLPWIAAVAGACAVTAAIGVLVGLPALRMTGIYLTIATLAFALIIQEVFARWDGVTGGLKGKAVDKAVVFGVSFASEPAFYYLCLAVGIGGLWLTANVLRAPTGRAWVAIRDSEIAAQSMGVNLAVYKTMAFAYSAALMGIAGALFSHRIGFLAPDIFSVLLSIQLLLMVVVGGLGSLHSQARDSVPGLVATALAPLGGGVADAAFLMVDRFVKQPGLEPGLFGLILVLFILFEPLGIYGRWAKIKLYFALFPLYKRATFRRQKAYMRSERLR

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
157 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 1.59
Rhizosphere 97.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10000918 3300005328 Bacteria 14587
2 Ga0070683_100263926 3300005329 Bacteria 1638
3 Ga0070670_100002798 3300005331 Bacteria 14429
4 Ga0068869_100001909 3300005334 Bacteria 12529
5 Ga0068869_100021072 3300005334 Bacteria 4480
6 Ga0070666_10052674 3300005335 Bacteria 2743
7 Ga0070680_100000266 3300005336 Bacteria 34632
8 Ga0070680_100071745 3300005336 Bacteria 2846
9 Ga0070680_100169847 3300005336 Bacteria 1835
10 Ga0070680_100212043 3300005336 Bacteria 1634
11 Ga0070680_100263101 3300005336 Bacteria 1459
12 Ga0070682_100000518 3300005337 Bacteria 24177
13 Ga0068868_100136048 3300005338 Bacteria 2014
14 Ga0068868_100259477 3300005338 Bacteria 1465
15 Ga0070660_100001036 3300005339 Bacteria 18682
16 Ga0070689_100088839 3300005340 Bacteria 2433
17 Ga0070689_100257536 3300005340 Bacteria 1441
18 Ga0070691_10002644 3300005341 Bacteria 7975
19 Ga0070691_10016126 3300005341 Bacteria 3433
20 Ga0070661_100000703 3300005344 Bacteria 24523
21 Ga0070661_100206474 3300005344 Bacteria 1502
22 Ga0070692_10000029 3300005345 Bacteria 27136
23 Ga0070669_100033343 3300005353 Bacteria 3724
24 Ga0070669_100127946 3300005353 Bacteria 1945
25 Ga0070659_100003576 3300005366 Bacteria 11064
26 Ga0070659_100046194 3300005366 Bacteria 3413
27 Ga0070703_10016316 3300005406 Bacteria 2131
28 Ga0070703_10041382 3300005406 Bacteria 1436
29 Ga0070713_100074043 3300005436 Bacteria 2884
30 Ga0070701_10027409 3300005438 Bacteria 2790
31 Ga0070701_10101250 3300005438 Bacteria 1596
32 Ga0070705_100000602 3300005440 Bacteria 20833
33 Ga0070694_100000833 3300005444 Bacteria 17315
34 Ga0070694_100008968 3300005444 Bacteria 6128
35 Ga0070694_100025142 3300005444 Bacteria 3851
36 Ga0070694_100076685 3300005444 Bacteria 2315
37 Ga0070694_100176495 3300005444 Bacteria 1577
38 Ga0070708_100019168 3300005445 Bacteria 5743
39 Ga0070708_100029231 3300005445 Bacteria 4751
40 Ga0070708_100032641 3300005445 Bacteria 4518
41 Ga0070708_100154823 3300005445 Bacteria 2133
42 Ga0070708_100252804 3300005445 Bacteria 1656
43 Ga0070708_100265920 3300005445 Bacteria 1613
44 Ga0070662_100051947 3300005457 Bacteria 2962
45 Ga0070681_10023799 3300005458 Bacteria 6165
46 Ga0068867_100001309 3300005459 Bacteria 17226
47 Ga0070706_100012087 3300005467 Bacteria 8012
48 Ga0070706_100020153 3300005467 Bacteria 6145
49 Ga0070706_100080975 3300005467 Bacteria 3007
50 Ga0070707_100034142 3300005468 Bacteria 4851
51 Ga0070707_100041886 3300005468 Bacteria 4383
52 Ga0070707_100104761 3300005468 Bacteria 2742
53 Ga0070698_100001806 3300005471 Bacteria 23799
54 Ga0070698_100002225 3300005471 Bacteria 21473
55 Ga0070698_100013190 3300005471 Bacteria 8745
56 Ga0070698_100023546 3300005471 Bacteria 6437
57 Ga0070698_100058110 3300005471 Bacteria 3911
58 Ga0070699_100001487 3300005518 Bacteria 21471
59 Ga0070699_100046288 3300005518 Bacteria 3764
60 Ga0070699_100055179 3300005518 Bacteria 3440
61 Ga0070699_100081308 3300005518 Bacteria 2824
62 Ga0070699_100101571 3300005518 Bacteria 2521
63 Ga0070679_100002143 3300005530 Bacteria 17792
64 Ga0070684_100078544 3300005535 Bacteria 2916
65 Ga0070684_100262126 3300005535 Bacteria 1581
66 Ga0070697_100009892 3300005536 Bacteria 7437
67 Ga0070697_100016929 3300005536 Bacteria 5731
68 Ga0070697_100100287 3300005536 Bacteria 2405
69 Ga0070697_100114164 3300005536 Bacteria 2254
70 Ga0070697_100124162 3300005536 Bacteria 2162
71 Ga0070697_100178451 3300005536 Bacteria 1800
72 Ga0068853_100000808 3300005539 Bacteria 21801
73 Ga0070695_100000221 3300005545 Bacteria 27872
74 Ga0070695_100000954 3300005545 Bacteria 15706
75 Ga0070695_100006415 3300005545 Bacteria 6956
76 Ga0070695_100012294 3300005545 Bacteria 5133
77 Ga0070695_100215401 3300005545 Bacteria 1381
78 Ga0070696_100001094 3300005546 Bacteria 17529
79 Ga0070696_100201111 3300005546 Bacteria 1487
80 Ga0070693_100000045 3300005547 Bacteria 47582
81 Ga0070704_100000240 3300005549 Bacteria 23438
82 Ga0070704_100038744 3300005549 Bacteria 3268
83 Ga0068855_100000462 3300005563 Bacteria 50016
84 Ga0070664_100002902 3300005564 Bacteria 13870
85 Ga0068857_100008050 3300005577 Bacteria 9090
86 Ga0068857_100021244 3300005577 Bacteria 5713
87 Ga0068857_100058694 3300005577 Bacteria 3418
88 Ga0068854_100007822 3300005578 Bacteria 6841
89 Ga0068856_100002716 3300005614 Bacteria 18136
90 Ga0068856_100024423 3300005614 Bacteria 5884
91 Ga0070702_100056816 3300005615 Bacteria 2262
92 Ga0068852_100112040 3300005616 Bacteria 2482
93 Ga0068859_100002495 3300005617 Bacteria 18707
94 Ga0068859_100102443 3300005617 Bacteria 2920
95 Ga0068864_100001334 3300005618 Bacteria 20531
96 Ga0068861_100009309 3300005719 Bacteria 6778
97 Ga0068861_100064621 3300005719 Bacteria 2816
98 Ga0068861_100077458 3300005719 Bacteria 2593
99 Ga0068861_100386622 3300005719 Bacteria 1238
100 Ga0068870_10000934 3300005840 Bacteria 11459
101 Ga0068863_100122956 3300005841 Bacteria 2476
102 Ga0068858_100020465 3300005842 Bacteria 6185
103 Ga0068858_100333585 3300005842 Bacteria 1451
104 Ga0068860_100051698 3300005843 Bacteria 3909
105 Ga0068860_100081094 3300005843 Bacteria 3085
106 Ga0068860_100194423 3300005843 Bacteria 1964
107 Ga0068862_100002748 3300005844 Bacteria 15437
108 Ga0068862_100268009 3300005844 Bacteria 1561
109 Ga0081455_10000034 3300005937 Bacteria 138695
110 Ga0081455_10000074 3300005937 Bacteria 107319
111 Ga0081455_10004333 3300005937 Bacteria 15981
112 Ga0081455_10216038 3300005937 Bacteria 1425
113 Ga0081538_10022379 3300005981 Bacteria 4580
114 Ga0081538_10056629 3300005981 Bacteria 2294
115 Ga0081540_1005226 3300005983 Bacteria 9717
116 Ga0081539_10000266 3300005985 Bacteria 119926
117 Ga0075364_10062718 3300006051 Bacteria 2439
118 Ga0075369_10012292 3300006186 Bacteria 3381
119 Ga0075428_100000331 3300006844 Bacteria 46981
120 Ga0075428_100000400 3300006844 Bacteria 43027
121 Ga0075428_100013632 3300006844 Bacteria 9051
122 Ga0075428_100026860 3300006844 Bacteria 6374
123 Ga0075428_100056744 3300006844 Bacteria 4288
124 Ga0075428_100237908 3300006844 Bacteria 1965
125 Ga0075430_100000096 3300006846 Bacteria 52072
126 Ga0075430_100001087 3300006846 Bacteria 21577
127 Ga0075430_100007365 3300006846 Bacteria 9296
128 Ga0075430_100011494 3300006846 Bacteria 7522
129 Ga0075430_100022035 3300006846 Bacteria 5415
130 Ga0075430_100255753 3300006846 Bacteria 1451
131 Ga0075431_100000833 3300006847 Bacteria 26945
132 Ga0075431_100001593 3300006847 Bacteria 21127
133 Ga0075431_100002162 3300006847 Bacteria 18799
134 Ga0075431_100006591 3300006847 Bacteria 11533
135 Ga0075431_100008769 3300006847 Bacteria 10133
136 Ga0075431_100008892 3300006847 Bacteria 10061
137 Ga0075431_100018519 3300006847 Bacteria 7093
138 Ga0075431_100036755 3300006847 Bacteria 5044
139 Ga0075431_100057958 3300006847 Bacteria 3995
140 Ga0075431_100105772 3300006847 Bacteria 2903
141 Ga0075431_100169824 3300006847 Bacteria 2241
142 Ga0075433_10006931 3300006852 Bacteria 8979
143 Ga0075433_10007309 3300006852 Bacteria 8763
144 Ga0075433_10009404 3300006852 Bacteria 7810
145 Ga0075433_10014523 3300006852 Bacteria 6438
146 Ga0075433_10015525 3300006852 Bacteria 6251
147 Ga0075433_10024429 3300006852 Bacteria 5100
148 Ga0075433_10043601 3300006852 Bacteria 3895
149 Ga0075433_10091296 3300006852 Bacteria 2692
150 Ga0075433_10303413 3300006852 Bacteria 1414
151 Ga0075434_100013252 3300006871 Bacteria 7836
152 Ga0075434_100016899 3300006871 Bacteria 7019
153 Ga0075434_100020564 3300006871 Bacteria 6403
154 Ga0075434_100056781 3300006871 Bacteria 3891
155 Ga0075434_100085431 3300006871 Bacteria 3155
156 Ga0075434_100187933 3300006871 Bacteria 2086
157 Ga0075429_100000001 3300006880 Bacteria 139031
158 Ga0075429_100016643 3300006880 Bacteria 6368
159 Ga0075429_100017322 3300006880 Bacteria 6230
160 Ga0075429_100032538 3300006880 Bacteria 4532
161 Ga0075429_100035877 3300006880 Bacteria 4312
162 Ga0075436_100013005 3300006914 Bacteria 5706
163 Ga0075436_100024006 3300006914 Bacteria 4191
164 Ga0097620_100002495 3300006931 Bacteria 18707
165 Ga0097620_100102445 3300006931 Bacteria 2920
166 Ga0075435_100001922 3300007076 Bacteria 13535
167 Ga0075435_100012226 3300007076 Bacteria 6349
168 Ga0075435_100030135 3300007076 Bacteria 4263
169 Ga0075435_100075108 3300007076 Bacteria 2766
170 Ga0075435_100095919 3300007076 Bacteria 2453
171 Ga0099794_10001445 3300007265 Bacteria 8309
172 Ga0105240_10242374 3300009093 Bacteria 2089
173 Ga0105240_10278492 3300009093 Bacteria 1922
174 Ga0111539_10001187 3300009094 Bacteria 34615
175 Ga0111539_10007289 3300009094 Bacteria 14161
176 Ga0111539_10008035 3300009094 Bacteria 13457
177 Ga0111539_10358009 3300009094 Bacteria 1698
178 Ga0105245_10052690 3300009098 Bacteria 3649
179 Ga0105247_10086526 3300009101 Bacteria 1983
180 Ga0114129_10006597 3300009147 Bacteria 16472
181 Ga0114129_10008686 3300009147 Bacteria 14482
182 Ga0114129_10017939 3300009147 Bacteria 10076
183 Ga0114129_10036423 3300009147 Bacteria 6947
184 Ga0114129_10043638 3300009147 Bacteria 6309
185 Ga0114129_10053306 3300009147 Bacteria 5673
186 Ga0114129_10055160 3300009147 Bacteria 5571
187 Ga0114129_10057129 3300009147 Bacteria 5463
188 Ga0114129_10058741 3300009147 Bacteria 5380
189 Ga0114129_10094036 3300009147 Bacteria 4152
190 Ga0114129_10096583 3300009147 Bacteria 4091
191 Ga0114129_10283680 3300009147 Bacteria 2212
192 Ga0105241_10000334 3300009174 Bacteria 35635
193 Ga0105242_10352237 3300009176 Bacteria 1360
194 Ga0105242_10415100 3300009176 Bacteria 1260
195 Ga0105248_10082402 3300009177 Bacteria 3617
196 Ga0105249_10116555 3300009553 Bacteria 2532
197 Ga0157373_10000379 3300013100 Bacteria 35641
198 Ga0157370_10005430 3300013104 Bacteria 14301
199 Ga0157370_10435787 3300013104 Bacteria 1205
200 Ga0157369_10062088 3300013105 Bacteria 4027
201 Ga0157369_10135490 3300013105 Bacteria 2608
202 Ga0157374_10117185 3300013296 Bacteria 2567
203 Ga0157378_10058820 3300013297 Bacteria 3428
204 Ga0157378_10290461 3300013297 Bacteria 1579
205 Ga0163162_10245060 3300013306 Bacteria 1924
206 Ga0157372_10000135 3300013307 Bacteria 81209
207 Ga0157375_10106549 3300013308 Bacteria 2895
208 Ga0206356_10485432 3300020070 Bacteria 1756
209 Ga0207653_10012894 3300025885 Bacteria 2612
210 Ga0207653_10020446 3300025885 Bacteria 2095
211 Ga0207688_10033434 3300025901 Bacteria 2845
212 Ga0207680_10072056 3300025903 Bacteria 2144
213 Ga0207647_10046585 3300025904 Bacteria 2701
214 Ga0207647_10068461 3300025904 Bacteria 2149
215 Ga0207645_10000075 3300025907 Bacteria 71333
216 Ga0207643_10000146 3300025908 Bacteria 48070
217 Ga0207684_10001638 3300025910 Bacteria 23790
218 Ga0207684_10005533 3300025910 Bacteria 11637
219 Ga0207684_10008109 3300025910 Bacteria 9364
220 Ga0207684_10008946 3300025910 Bacteria 8880
221 Ga0207684_10090431 3300025910 Bacteria 2608
222 Ga0207654_10053970 3300025911 Bacteria 2322
223 Ga0207654_10092866 3300025911 Bacteria 1844
224 Ga0207707_10000135 3300025912 Bacteria 76964
225 Ga0207671_10133070 3300025914 Bacteria 1910
226 Ga0207693_10014327 3300025915 Bacteria 6379
227 Ga0207693_10094634 3300025915 Bacteria 2341
228 Ga0207660_10002799 3300025917 Bacteria 11432
229 Ga0207660_10026261 3300025917 Bacteria 3964
230 Ga0207660_10044164 3300025917 Bacteria 3135
231 Ga0207660_10141584 3300025917 Bacteria 1839
232 Ga0207657_10000037 3300025919 Bacteria 124230
233 Ga0207649_10029197 3300025920 Bacteria 3255
234 Ga0207652_10001525 3300025921 Bacteria 20432
235 Ga0207646_10001729 3300025922 Bacteria 26558
236 Ga0207646_10008854 3300025922 Bacteria 10028
237 Ga0207646_10069904 3300025922 Bacteria 3136
238 Ga0207681_10040187 3300025923 Bacteria 3111
239 Ga0207681_10091109 3300025923 Bacteria 2177
240 Ga0207650_10035645 3300025925 Bacteria 3615
241 Ga0207690_10021908 3300025932 Bacteria 3969
242 Ga0207706_10053726 3300025933 Bacteria 3556
243 Ga0207670_10015743 3300025936 Bacteria 4526
244 Ga0207665_10000576 3300025939 Bacteria 24692
245 Ga0207711_10063872 3300025941 Bacteria 3179
246 Ga0207689_10000029 3300025942 Bacteria 100016
247 Ga0207689_10033196 3300025942 Bacteria 4289
248 Ga0207661_10101332 3300025944 Bacteria 2419
249 Ga0207679_10002294 3300025945 Bacteria 11794
250 Ga0207667_10000652 3300025949 Bacteria 45007
251 Ga0207667_10196621 3300025949 Bacteria 2069
252 Ga0207640_10014544 3300025981 Bacteria 4534
253 Ga0207677_10123553 3300026023 Bacteria 1952
254 Ga0207703_10221694 3300026035 Bacteria 1691
255 Ga0207639_10004221 3300026041 Bacteria 9683
256 Ga0207678_10005618 3300026067 Bacteria 11215
257 Ga0207708_10228421 3300026075 Bacteria 1493
258 Ga0207708_10248039 3300026075 Bacteria 1434
259 Ga0207702_10007290 3300026078 Bacteria 9457
260 Ga0207702_10093351 3300026078 Bacteria 2639
261 Ga0207641_10017579 3300026088 Bacteria 5854
262 Ga0207641_10117997 3300026088 Bacteria 2363
263 Ga0207648_10000552 3300026089 Bacteria 41984
264 Ga0207676_10102768 3300026095 Bacteria 2373
265 Ga0207674_10000306 3300026116 Bacteria 62216
266 Ga0207674_10102814 3300026116 Bacteria 2837
267 Ga0207675_100010607 3300026118 Bacteria 8629
268 Ga0207675_100251665 3300026118 Bacteria 1710
269 Ga0207698_10024733 3300026142 Bacteria 4220
270 Ga0207698_10133142 3300026142 Bacteria 2128
271 Ga0210000_1001013 3300027462 Bacteria 3920
272 Ga0209995_1000576 3300027471 Bacteria 5584
273 Ga0209968_1000254 3300027526 Bacteria 9110
274 Ga0209999_1000422 3300027543 Bacteria 6540
275 Ga0209982_1001324 3300027552 Bacteria 3357
276 Ga0209983_1000146 3300027665 Bacteria 13016
277 Ga0209588_1000952 3300027671 Bacteria 7398
278 Ga0209971_1000008 3300027682 Bacteria 102612
279 Ga0209966_1000187 3300027695 Bacteria 25599
280 Ga0209966_1008699 3300027695 Bacteria 1806
281 Ga0209998_10000016 3300027717 Bacteria 85166
282 Ga0209974_10000710 3300027876 Bacteria 11372
283 Ga0207428_10000227 3300027907 Bacteria 77877
284 Ga0207428_10000392 3300027907 Bacteria 54780
285 Ga0207428_10026546 3300027907 Bacteria 4834
286 Ga0268266_10145934 3300028379 Bacteria 2127
287 Ga0268265_10003670 3300028380 Bacteria 10947
288 Ga0268265_10012016 3300028380 Bacteria 5860
289 Ga0268265_10229803 3300028380 Bacteria 1629
290 Ga0268264_10038337 3300028381 Bacteria 3955
291 Ga0268264_10162373 3300028381 Bacteria 2014
292 Ga0268264_10238533 3300028381 Bacteria 1683
293 Ga0307408_100024396 3300031548 Bacteria 4130
294 Ga0307408_100032995 3300031548 Bacteria 3614
295 Ga0307406_10128053 3300031901 Bacteria 1777
296 Ga0307412_10137952 3300031911 Bacteria 1782
297 Ga0307416_100439673 3300032002 Bacteria 1354
298 Ga0373951_0008323 3300035091 Bacteria 2345
299 Ga0373941_0004881 3300035115 Bacteria 3126
300 Ga0373961_0002358 3300035241 Bacteria 4928
301 Ga0373962_0015512 3300035242 Bacteria 1954
302 Ga0373931_0035737 3300035691 Bacteria 2585
303 Ga0373931_0264993 3300035691 Bacteria 1050
304 Ga0395899_0106634 3300037312 Bacteria 2017
305 Ga0395900_0009342 3300037418 Bacteria 10053
306 Ga0395900_0037666 3300037418 Bacteria 4985
307 Ga0395898_0018534 3300037466 Bacteria 7094
308 Ga0395898_0038747 3300037466 Bacteria 4721
309 Ga0395901_0063712 3300038443 Bacteria 3837
310 Ga0436362_0450303 3300039453 Bacteria 1749
311 Ga0439448_0001872 3300042005 Bacteria 5586
312 Ga0439448_0019399 3300042005 Bacteria 2093
313 Ga0439448_0021339 3300042005 Bacteria 2008
314 Ga0439458_0001889 3300042157 Bacteria 5187
315 Ga0439464_0007480 3300042439 Bacteria 2856
316 Ga0439460_0000701 3300042461 Bacteria 7454
317 Ga0451577_0020087 3300042876 Bacteria 6134
318 Ga0451577_0092204 3300042876 Bacteria 2705
319 Ga0451577_0166898 3300042876 Bacteria 1983
320 Ga0453683_0009775 3300044673 Bacteria 6395
321 Ga0453683_0013899 3300044673 Bacteria 5237
322 Ga0466963_0029381 3300044694 Bacteria 3538
323 Ga0453684_0061871 3300044712 Bacteria 4801
324 Ga0453684_0113113 3300044712 Bacteria 3293
325 Ga0453684_0168427 3300044712 Bacteria 2584
326 Ga0451576_0024347 3300045051 Bacteria 6539
327 Ga0451576_0056116 3300045051 Bacteria 4120
328 Ga0451576_0065270 3300045051 Bacteria 3790
329 Ga0451576_0072727 3300045051 Bacteria 3577
330 Ga0466967_0155980 3300045976 Bacteria 2138
331 Ga0495580_0000361 3300046472 Bacteria 37086
332 Ga0495584_0028623 3300046491 Bacteria 2824
333 Ga0495656_0161484 3300046615 Bacteria 1089
334 Ga0495669_0060303 3300046684 Bacteria 1715
335 Ga0495636_0040899 3300047318 Bacteria 1923
336 Ga0496102_0005383 3300048905 Bacteria 10866
337 Ga0496102_0032773 3300048905 Bacteria 4669
338 Ga0496103_0140935 3300048906 Bacteria 1542
339 Ga0496106_0030014 3300048909 Bacteria 4054
340 Ga0496106_0048482 3300048909 Bacteria 3199
341 Ga0496108_0298555 3300048911 Bacteria 1403
342 Ga0496112_0056779 3300048915 Bacteria 3854
343 Ga0501033_0070808 3300049570 Bacteria 2562
344 Ga0501036_0194218 3300049572 Bacteria 1708
345 Ga0501038_0015476 3300049574 Bacteria 6933
346 Ga0501038_0101381 3300049574 Bacteria 2397
347 Ga0501040_0075021 3300049576 Bacteria 2337
348 Ga0501042_0001517 3300049578 Bacteria 13739
349 Ga0501042_0089089 3300049578 Bacteria 2214
350 Ga0501046_0030188 3300049580 Bacteria 4401
351 Ga0501046_0202313 3300049580 Bacteria 1477
352 Ga0501047_0035987 3300049581 Bacteria 4784
353 Ga0501048_0025362 3300049582 Bacteria 4321
354 Ga0501048_0125593 3300049582 Bacteria 1814
355 Ga0501069_0153159 3300049585 Bacteria 1326
356 Ga0501072_0041603 3300049588 Bacteria 3610
357 Ga0501075_0022010 3300049591 Bacteria 4654
358 Ga0501075_0024071 3300049591 Bacteria 4459
359 Ga0501076_0006750 3300049592 Bacteria 8329
360 Ga0501076_0017726 3300049592 Bacteria 5415
361 Ga0501076_0145313 3300049592 Bacteria 1928
362 Ga0501077_0012001 3300049593 Bacteria 5422
363 Ga0501077_0037049 3300049593 Bacteria 3107
364 Ga0501079_0001548 3300049741 Bacteria 16293
365 Ga0501079_0023873 3300049741 Bacteria 4691
366 Ga0501080_0255890 3300049742 Bacteria 1596
367 Ga0501081_0011302 3300049743 Bacteria 5840
368 Ga0501083_0002379 3300049744 Bacteria 12878
369 Ga0501044_0083606 3300049823 Bacteria 3228
370 Ga0501044_0213818 3300049823 Bacteria 1881
371 Ga0501045_0181698 3300049824 Bacteria 1567
372 nmdc:mga0k408_3459_c1 3300050493 Bacteria 8354
373 nmdc:mga05p37_121928_c1 3300050507 Bacteria 3202
374 nmdc:mga05p37_15169_c1 3300050507 Bacteria 9252
375 nmdc:mga05p37_23681_c1 3300050507 Bacteria 7454
376 nmdc:mga05p37_26137_c1 3300050507 Bacteria 7099
377 nmdc:mga05p37_3506_c1 3300050507 Bacteria 18343
378 nmdc:mga05p37_43843_c1 3300050507 Bacteria 5504
379 nmdc:mga05p37_504592_c1 3300050507 Bacteria 1387
380 nmdc:mga05p37_53910_c1 3300050507 Bacteria 4947
381 nmdc:mga05p37_568321_c1 3300050507 Bacteria 1287
382 nmdc:mga05p37_70724_c1 3300050507 Bacteria 4292
383 nmdc:mga05p37_75222_c1 3300050507 Bacteria 4157
384 nmdc:mga05p37_76265_c1 3300050507 Bacteria 4128
385 nmdc:mga05p37_92760_c1 3300050507 Bacteria 3721
386 nmdc:mga09592_114_c1 3300050508 Bacteria 50692
387 nmdc:mga09592_11642_c1 3300050508 Bacteria 7156
388 nmdc:mga09592_14974_c1 3300050508 Bacteria 6335
389 nmdc:mga09592_19506_c1 3300050508 Bacteria 5569
390 nmdc:mga09592_31534_c1 3300050508 Bacteria 4417
391 nmdc:mga09592_59186_c1 3300050508 Bacteria 3239
392 nmdc:mga09592_61627_c1 3300050508 Bacteria 3173
393 nmdc:mga0qj67_10866_c1 3300050509 Bacteria 6809
394 nmdc:mga0qj67_14932_c1 3300050509 Bacteria 5874
395 nmdc:mga0qj67_2387_c1 3300050509 Bacteria 13380
396 nmdc:mga0qj67_26797_c1 3300050509 Bacteria 4463
397 nmdc:mga0qj67_39409_c1 3300050509 Bacteria 3710
398 nmdc:mga0qj67_522_c1 3300050509 Bacteria 26147
399 nmdc:mga06r32_126611_c1 3300050510 Bacteria 2524
400 nmdc:mga06r32_16256_c1 3300050510 Bacteria 6777
401 nmdc:mga06r32_17872_c1 3300050510 Bacteria 6482
402 nmdc:mga06r32_213834_c1 3300050510 Bacteria 1916
403 nmdc:mga06r32_33942_c1 3300050510 Bacteria 4809
404 nmdc:mga06r32_4047_c1 3300050510 Bacteria 13146
405 nmdc:mga06r32_66669_c1 3300050510 Bacteria 3474
406 nmdc:mga06r32_693_c1 3300050510 Bacteria 29366
407 nmdc:mga08y16_10042_c1 3300050511 Bacteria 9936
408 nmdc:mga08y16_14227_c1 3300050511 Bacteria 8375
409 nmdc:mga08y16_190_c1 3300050511 Bacteria 55016
410 nmdc:mga0n895_11795_c1 3300050512 Bacteria 7815
411 nmdc:mga0n895_14485_c1 3300050512 Bacteria 7164
412 nmdc:mga0n895_1512_c1 3300050512 Bacteria 17445
413 nmdc:mga0n895_156365_c1 3300050512 Bacteria 2311
414 nmdc:mga0n895_16764_c1 3300050512 Bacteria 6733
415 nmdc:mga0n895_2418_c1 3300050512 Bacteria 14556
416 nmdc:mga0n895_30170_c1 3300050512 Bacteria 5179
417 nmdc:mga0n895_307367_c1 3300050512 Bacteria 1607
418 nmdc:mga0n895_503000_c1 3300050512 Unclassified 1221
419 nmdc:mga0n895_53578_c1 3300050512 Bacteria 3964
420 nmdc:mga0rr50_139901_c1 3300050513 Bacteria 1946
421 nmdc:mga0rr50_22423_c1 3300050513 Bacteria 4334
422 nmdc:mga0rr50_295766_c1 3300050513 Bacteria 1354
423 nmdc:mga0rr50_4359_c1 3300050513 Bacteria 8310
424 nmdc:mga08x19_190863_c1 3300050514 Bacteria 1402
425 nmdc:mga08x19_7482_c1 3300050514 Bacteria 6488
426 nmdc:mga0a205_1354_c1 3300050515 Bacteria 7699
427 nmdc:mga0a205_36334_c1 3300050515 Bacteria 4733
428 nmdc:mga0a205_43388_c1 3300050515 Bacteria 4336
429 nmdc:mga0a205_55118_c1 3300050515 Bacteria 3840
430 nmdc:mga0a205_6495_c1 3300050515 Bacteria 10574
431 nmdc:mga0a205_89672_c1 3300050515 Bacteria 2972
432 nmdc:mga0sz30_1855_c2 3300050516 Bacteria 6700
433 Ga0500641_0000756 3300053096 Bacteria 11741
434 Ga0500552_001025 3300053733 Bacteria 2639
435 Ga0501084_0004982 3300054114 Bacteria 10865
436 Ga0501084_0026784 3300054114 Bacteria 4815
437 Ga0501084_0028822 3300054114 Bacteria 4642
438 Ga0501082_0001040 3300060353 Bacteria 24529
439 Ga0501082_0112031 3300060353 Bacteria 2362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0264993 Ga0373931_0264993_187_1035 268
2 3300005937 Ga0081455_10004333 Ga0081455_100043334 276
3 3300013296 Ga0157374_10117185 Ga0157374_101171852 276
4 3300049742 Ga0501080_0255890 Ga0501080_0255890_639_1520 276
5 3300006852 Ga0075433_10091296 Ga0075433_100912963 286
6 3300006871 Ga0075434_100020564 Ga0075434_1000205645 286
7 3300006880 Ga0075429_100017322 Ga0075429_1000173224 286
8 3300050507 nmdc:mga05p37_121928_c1 nmdc:mga05p37_121928_c1_1778_2920 286
9 3300050508 nmdc:mga09592_59186_c1 nmdc:mga09592_59186_c1_927_2069 286
10 3300050512 nmdc:mga0n895_14485_c1 nmdc:mga0n895_14485_c1_1236_2378 286
11 3300050515 nmdc:mga0a205_36334_c1 nmdc:mga0a205_36334_c1_1624_2766 286
12 3300006844 Ga0075428_100013632 Ga0075428_1000136323 291
13 3300006847 Ga0075431_100008769 Ga0075431_1000087694 291
14 3300006880 Ga0075429_100016643 Ga0075429_1000166434 291
15 3300009147 Ga0114129_10017939 Ga0114129_100179394 291
16 3300050507 nmdc:mga05p37_15169_c1 nmdc:mga05p37_15169_c1_7021_8112 291
17 3300050508 nmdc:mga09592_14974_c1 nmdc:mga09592_14974_c1_2553_3644 291
18 3300050510 nmdc:mga06r32_17872_c1 nmdc:mga06r32_17872_c1_2390_3481 291
19 3300046615 Ga0495656_0161484 Ga0495656_0161484_13_1041 293
20 3300050514 nmdc:mga08x19_190863_c1 nmdc:mga08x19_190863_c1_360_1388 293
21 3300048911 Ga0496108_0298555 Ga0496108_0298555_423_1388 297
22 3300050512 nmdc:mga0n895_307367_c1 nmdc:mga0n895_307367_c1_618_1583 297
23 3300009147 Ga0114129_10006597 Ga0114129_100065974 301
24 3300006852 Ga0075433_10007309 Ga0075433_100073096 302
25 3300006871 Ga0075434_100013252 Ga0075434_1000132526 302
26 3300006914 Ga0075436_100013005 Ga0075436_1000130053 302
27 3300009147 Ga0114129_10053306 Ga0114129_100533062 302
28 3300050507 nmdc:mga05p37_504592_c1 nmdc:mga05p37_504592_c1_105_1247 307
29 3300039453 Ga0436362_0450303 Ga0436362_0450303_135_1277 309
30 3300005445 Ga0070708_100019168 Ga0070708_1000191683 311
31 3300005518 Ga0070699_100101571 Ga0070699_1001015712 311
32 3300006846 Ga0075430_100001087 Ga0075430_1000010872 311
33 3300006847 Ga0075431_100001593 Ga0075431_1000015938 311
34 3300009147 Ga0114129_10008686 Ga0114129_100086865 311
35 3300050507 nmdc:mga05p37_23681_c1 nmdc:mga05p37_23681_c1_3803_4945 311
36 3300050509 nmdc:mga0qj67_2387_c1 nmdc:mga0qj67_2387_c1_10644_11786 311
37 3300050510 nmdc:mga06r32_33942_c1 nmdc:mga06r32_33942_c1_912_2054 311
38 3300053096 Ga0500641_0000756 Ga0500641_0000756_10403_11545 311
39 3300005336 Ga0070680_100071745 Ga0070680_1000717452 312
40 3300005438 Ga0070701_10101250 Ga0070701_101012502 312
41 3300005444 Ga0070694_100008968 Ga0070694_1000089687 312
42 3300005445 Ga0070708_100154823 Ga0070708_1001548232 312
43 3300005518 Ga0070699_100081308 Ga0070699_1000813083 312
44 3300005536 Ga0070697_100016929 Ga0070697_1000169293 312
45 3300005719 Ga0068861_100386622 Ga0068861_1003866221 312
46 3300006844 Ga0075428_100237908 Ga0075428_1002379082 312
47 3300025910 Ga0207684_10008946 Ga0207684_100089465 312
48 3300025917 Ga0207660_10044164 Ga0207660_100441642 312
49 3300025922 Ga0207646_10008854 Ga0207646_100088548 312
50 3300031548 Ga0307408_100024396 Ga0307408_1000243965 312
51 3300048905 Ga0496102_0005383 Ga0496102_0005383_4528_5670 312
52 3300048909 Ga0496106_0030014 Ga0496106_0030014_506_1648 312
53 3300005366 Ga0070659_100046194 Ga0070659_1000461942 313
54 3300013104 Ga0157370_10005430 Ga0157370_100054304 313
55 3300005985 Ga0081539_10000266 Ga0081539_1000026666 314
56 3300006847 Ga0075431_100105772 Ga0075431_1001057722 314
57 3300006852 Ga0075433_10303413 Ga0075433_103034132 314
58 3300006914 Ga0075436_100024006 Ga0075436_1000240063 314
59 3300009147 Ga0114129_10057129 Ga0114129_100571295 314
60 3300050507 nmdc:mga05p37_3506_c1 nmdc:mga05p37_3506_c1_11123_12214 314
61 3300050512 nmdc:mga0n895_1512_c1 nmdc:mga0n895_1512_c1_5823_6914 314
62 3300050512 nmdc:mga0n895_30170_c1 nmdc:mga0n895_30170_c1_2271_3413 314
63 3300050513 nmdc:mga0rr50_22423_c1 nmdc:mga0rr50_22423_c1_180_1322 314
64 3300050514 nmdc:mga08x19_7482_c1 nmdc:mga08x19_7482_c1_2914_4005 314
65 3300050515 nmdc:mga0a205_55118_c1 nmdc:mga0a205_55118_c1_411_1553 314
66 3300005577 Ga0068857_100021244 Ga0068857_1000212444 317
67 3300005937 Ga0081455_10216038 Ga0081455_102160382 317
68 3300006847 Ga0075431_100169824 Ga0075431_1001698242 317
69 3300006852 Ga0075433_10043601 Ga0075433_100436012 317
70 3300009147 Ga0114129_10055160 Ga0114129_100551604 317
71 3300013104 Ga0157370_10435787 Ga0157370_104357871 317
72 3300050507 nmdc:mga05p37_26137_c1 nmdc:mga05p37_26137_c1_3738_4880 317
73 3300050509 nmdc:mga0qj67_26797_c1 nmdc:mga0qj67_26797_c1_39_1181 317
74 3300050510 nmdc:mga06r32_213834_c1 nmdc:mga06r32_213834_c1_747_1889 317
75 3300050515 nmdc:mga0a205_43388_c1 nmdc:mga0a205_43388_c1_832_1974 317
76 3300026118 Ga0207675_100251665 Ga0207675_1002516652 318
77 3300005344 Ga0070661_100206474 Ga0070661_1002064742 319
78 3300005535 Ga0070684_100078544 Ga0070684_1000785442 319
79 3300005614 Ga0068856_100024423 Ga0068856_1000244231 319
80 3300009093 Ga0105240_10278492 Ga0105240_102784922 319
81 3300013105 Ga0157369_10135490 Ga0157369_101354904 319
82 3300025904 Ga0207647_10068461 Ga0207647_100684613 319
83 3300025914 Ga0207671_10133070 Ga0207671_101330702 319
84 3300025949 Ga0207667_10196621 Ga0207667_101966212 319
85 3300026078 Ga0207702_10093351 Ga0207702_100933512 319
86 3300026142 Ga0207698_10024733 Ga0207698_100247332 319
87 3300037418 Ga0395900_0009342 Ga0395900_0009342_7316_8458 319
88 3300038443 Ga0395901_0063712 Ga0395901_0063712_1541_2683 319
89 3300042005 Ga0439448_0021339 Ga0439448_0021339_682_1824 319
90 3300044694 Ga0466963_0029381 Ga0466963_0029381_708_1850 319
91 3300045976 Ga0466967_0155980 Ga0466967_0155980_835_1977 319
92 3300060353 Ga0501082_0001040 Ga0501082_0001040_19288_20430 320
93 3300031911 Ga0307412_10137952 Ga0307412_101379522 321
94 3300032002 Ga0307416_100439673 Ga0307416_1004396731 321
95 3300037312 Ga0395899_0106634 Ga0395899_0106634_815_1957 321
96 3300037418 Ga0395900_0037666 Ga0395900_0037666_3021_4163 321
97 3300049574 Ga0501038_0015476 Ga0501038_0015476_5196_6338 321
98 3300049578 Ga0501042_0001517 Ga0501042_0001517_4593_5735 321
99 3300049581 Ga0501047_0035987 Ga0501047_0035987_2068_3210 321
100 3300049582 Ga0501048_0025362 Ga0501048_0025362_20_1162 321
101 3300049741 Ga0501079_0001548 Ga0501079_0001548_7036_8178 321
102 3300049743 Ga0501081_0011302 Ga0501081_0011302_2261_3403 321
103 3300049744 Ga0501083_0002379 Ga0501083_0002379_8968_10110 321
104 3300049823 Ga0501044_0083606 Ga0501044_0083606_28_1170 321
105 3300054114 Ga0501084_0026784 Ga0501084_0026784_571_1713 321
106 3300049593 Ga0501077_0012001 Ga0501077_0012001_1280_2422 322
107 3300006186 Ga0075369_10012292 Ga0075369_100122922 323
108 3300037466 Ga0395898_0038747 Ga0395898_0038747_1156_2298 323
109 3300050516 nmdc:mga0sz30_1855_c2 nmdc:mga0sz30_1855_c2_1189_2331 323
110 3300009147 Ga0114129_10043638 Ga0114129_100436383 324
111 3300025915 Ga0207693_10094634 Ga0207693_100946343 324
112 3300050507 nmdc:mga05p37_568321_c1 nmdc:mga05p37_568321_c1_11_1153 324
113 3300049741 Ga0501079_0023873 Ga0501079_0023873_2651_3793 325
114 3300005445 Ga0070708_100032641 Ga0070708_1000326413 326
115 3300005467 Ga0070706_100080975 Ga0070706_1000809752 326
116 3300005471 Ga0070698_100058110 Ga0070698_1000581104 326
117 3300005981 Ga0081538_10056629 Ga0081538_100566293 326
118 3300025910 Ga0207684_10090431 Ga0207684_100904312 326
119 3300049580 Ga0501046_0030188 Ga0501046_0030188_2348_3490 326
120 3300049823 Ga0501044_0213818 Ga0501044_0213818_498_1640 326
121 3300006051 Ga0075364_10062718 Ga0075364_100627182 327
122 3300050493 nmdc:mga0k408_3459_c1 nmdc:mga0k408_3459_c1_1129_2271 327
123 3300005338 Ga0068868_100259477 Ga0068868_1002594772 328
124 3300028379 Ga0268266_10145934 Ga0268266_101459342 328
125 3300005341 Ga0070691_10002644 Ga0070691_100026445 329
126 3300005353 Ga0070669_100033343 Ga0070669_1000333433 329
127 3300005406 Ga0070703_10041382 Ga0070703_100413822 329
128 3300005545 Ga0070695_100000954 Ga0070695_1000009543 329
129 3300005719 Ga0068861_100064621 Ga0068861_1000646212 329
130 3300005981 Ga0081538_10022379 Ga0081538_100223792 329
131 3300006844 Ga0075428_100056744 Ga0075428_1000567442 329
132 3300006846 Ga0075430_100022035 Ga0075430_1000220353 329
133 3300006847 Ga0075431_100002162 Ga0075431_10000216218 329
134 3300006847 Ga0075431_100008892 Ga0075431_1000088928 329
135 3300006847 Ga0075431_100018519 Ga0075431_1000185192 329
136 3300006852 Ga0075433_10006931 Ga0075433_100069315 329
137 3300006880 Ga0075429_100035877 Ga0075429_1000358773 329
138 3300013105 Ga0157369_10062088 Ga0157369_100620884 329
139 3300025885 Ga0207653_10012894 Ga0207653_100128942 329
140 3300025910 Ga0207684_10008109 Ga0207684_100081093 329
141 3300025923 Ga0207681_10040187 Ga0207681_100401872 329
142 3300026095 Ga0207676_10102768 Ga0207676_101027682 329
143 3300035241 Ga0373961_0002358 Ga0373961_0002358_2394_3536 329
144 3300046491 Ga0495584_0028623 Ga0495584_0028623_26_1168 329
145 3300048909 Ga0496106_0048482 Ga0496106_0048482_1383_2525 329
146 3300049570 Ga0501033_0070808 Ga0501033_0070808_414_1556 329
147 3300049572 Ga0501036_0194218 Ga0501036_0194218_152_1294 329
148 3300049574 Ga0501038_0101381 Ga0501038_0101381_192_1334 329
149 3300049582 Ga0501048_0125593 Ga0501048_0125593_58_1200 329
150 3300049591 Ga0501075_0024071 Ga0501075_0024071_318_1460 329
151 3300049592 Ga0501076_0017726 Ga0501076_0017726_32_1174 329
152 3300049592 Ga0501076_0145313 Ga0501076_0145313_170_1312 329
153 3300049824 Ga0501045_0181698 Ga0501045_0181698_176_1318 329
154 3300050507 nmdc:mga05p37_53910_c1 nmdc:mga05p37_53910_c1_2684_3826 329
155 3300050508 nmdc:mga09592_61627_c1 nmdc:mga09592_61627_c1_323_1465 329
156 3300050509 nmdc:mga0qj67_39409_c1 nmdc:mga0qj67_39409_c1_2135_3277 329
157 3300050510 nmdc:mga06r32_126611_c1 nmdc:mga06r32_126611_c1_864_2006 329
158 3300050510 nmdc:mga06r32_693_c1 nmdc:mga06r32_693_c1_18821_19963 329
159 3300050512 nmdc:mga0n895_503000_c1 nmdc:mga0n895_503000_c1_18_1160 329
160 3300054114 Ga0501084_0004982 Ga0501084_0004982_932_2074 329
161 3300005334 Ga0068869_100021072 Ga0068869_1000210723 330
162 3300005336 Ga0070680_100169847 Ga0070680_1001698472 330
163 3300005340 Ga0070689_100088839 Ga0070689_1000888392 330
164 3300005406 Ga0070703_10016316 Ga0070703_100163162 330
165 3300005438 Ga0070701_10027409 Ga0070701_100274093 330
166 3300005444 Ga0070694_100176495 Ga0070694_1001764952 330
167 3300005445 Ga0070708_100265920 Ga0070708_1002659202 330
168 3300005468 Ga0070707_100041886 Ga0070707_1000418863 330
169 3300005518 Ga0070699_100055179 Ga0070699_1000551794 330
170 3300005536 Ga0070697_100100287 Ga0070697_1001002872 330
171 3300005546 Ga0070696_100201111 Ga0070696_1002011111 330
172 3300005577 Ga0068857_100058694 Ga0068857_1000586943 330
173 3300005617 Ga0068859_100102443 Ga0068859_1001024432 330
174 3300005719 Ga0068861_100077458 Ga0068861_1000774582 330
175 3300005842 Ga0068858_100333585 Ga0068858_1003335852 330
176 3300005843 Ga0068860_100081094 Ga0068860_1000810942 330
177 3300005844 Ga0068862_100268009 Ga0068862_1002680092 330
178 3300005937 Ga0081455_10000034 Ga0081455_1000003422 330
179 3300006844 Ga0075428_100026860 Ga0075428_1000268602 330
180 3300006852 Ga0075433_10014523 Ga0075433_100145235 330
181 3300006852 Ga0075433_10015525 Ga0075433_100155254 330
182 3300006871 Ga0075434_100016899 Ga0075434_1000168993 330
183 3300006931 Ga0097620_100102445 Ga0097620_1001024452 330
184 3300007076 Ga0075435_100075108 Ga0075435_1000751082 330
185 3300007076 Ga0075435_100095919 Ga0075435_1000959192 330
186 3300007265 Ga0099794_10001445 Ga0099794_100014454 330
187 3300009094 Ga0111539_10008035 Ga0111539_100080352 330
188 3300009098 Ga0105245_10052690 Ga0105245_100526904 330
189 3300009101 Ga0105247_10086526 Ga0105247_100865262 330
190 3300009147 Ga0114129_10283680 Ga0114129_102836803 330
191 3300009553 Ga0105249_10116555 Ga0105249_101165552 330
192 3300013306 Ga0163162_10245060 Ga0163162_102450602 330
193 3300013308 Ga0157375_10106549 Ga0157375_101065493 330
194 3300025911 Ga0207654_10092866 Ga0207654_100928662 330
195 3300025917 Ga0207660_10026261 Ga0207660_100262613 330
196 3300025917 Ga0207660_10141584 Ga0207660_101415842 330
197 3300025922 Ga0207646_10069904 Ga0207646_100699043 330
198 3300025941 Ga0207711_10063872 Ga0207711_100638723 330
199 3300025942 Ga0207689_10033196 Ga0207689_100331962 330
200 3300026035 Ga0207703_10221694 Ga0207703_102216942 330
201 3300026075 Ga0207708_10228421 Ga0207708_102284212 330
202 3300026075 Ga0207708_10248039 Ga0207708_102480392 330
203 3300026116 Ga0207674_10102814 Ga0207674_101028142 330
204 3300027671 Ga0209588_1000952 Ga0209588_10009526 330
205 3300027695 Ga0209966_1008699 Ga0209966_10086992 330
206 3300027907 Ga0207428_10000392 Ga0207428_100003922 330
207 3300028380 Ga0268265_10012016 Ga0268265_100120162 330
208 3300028380 Ga0268265_10229803 Ga0268265_102298031 330
209 3300028381 Ga0268264_10238533 Ga0268264_102385332 330
210 3300031548 Ga0307408_100032995 Ga0307408_1000329952 330
211 3300031901 Ga0307406_10128053 Ga0307406_101280532 330
212 3300042005 Ga0439448_0019399 Ga0439448_0019399_824_1966 330
213 3300042439 Ga0439464_0007480 Ga0439464_0007480_568_1710 330
214 3300042461 Ga0439460_0000701 Ga0439460_0000701_1759_2901 330
215 3300042876 Ga0451577_0020087 Ga0451577_0020087_1269_2411 330
216 3300044673 Ga0453683_0009775 Ga0453683_0009775_2726_3868 330
217 3300044712 Ga0453684_0113113 Ga0453684_0113113_1863_3005 330
218 3300045051 Ga0451576_0056116 Ga0451576_0056116_148_1290 330
219 3300045051 Ga0451576_0065270 Ga0451576_0065270_1611_2753 330
220 3300050511 nmdc:mga08y16_14227_c1 nmdc:mga08y16_14227_c1_6538_7686 330
221 3300050512 nmdc:mga0n895_156365_c1 nmdc:mga0n895_156365_c1_776_1918 330
222 3300050512 nmdc:mga0n895_2418_c1 nmdc:mga0n895_2418_c1_5635_6783 330
223 3300050513 nmdc:mga0rr50_139901_c1 nmdc:mga0rr50_139901_c1_206_1348 330
224 3300050515 nmdc:mga0a205_1354_c1 nmdc:mga0a205_1354_c1_5811_6959 330
225 3300050515 nmdc:mga0a205_6495_c1 nmdc:mga0a205_6495_c1_9044_10186 330
226 3300005328 Ga0070676_10000918 Ga0070676_100009185 331
227 3300005329 Ga0070683_100263926 Ga0070683_1002639262 331
228 3300005331 Ga0070670_100002798 Ga0070670_10000279812 331
229 3300005334 Ga0068869_100001909 Ga0068869_1000019099 331
230 3300005335 Ga0070666_10052674 Ga0070666_100526742 331
231 3300005336 Ga0070680_100000266 Ga0070680_10000026632 331
232 3300005336 Ga0070680_100212043 Ga0070680_1002120432 331
233 3300005336 Ga0070680_100263101 Ga0070680_1002631012 331
234 3300005337 Ga0070682_100000518 Ga0070682_10000051822 331
235 3300005338 Ga0068868_100136048 Ga0068868_1001360482 331
236 3300005339 Ga0070660_100001036 Ga0070660_10000103618 331
237 3300005340 Ga0070689_100257536 Ga0070689_1002575361 331
238 3300005341 Ga0070691_10016126 Ga0070691_100161263 331
239 3300005344 Ga0070661_100000703 Ga0070661_10000070317 331
240 3300005345 Ga0070692_10000029 Ga0070692_1000002910 331
241 3300005353 Ga0070669_100127946 Ga0070669_1001279462 331
242 3300005366 Ga0070659_100003576 Ga0070659_1000035763 331
243 3300005436 Ga0070713_100074043 Ga0070713_1000740432 331
244 3300005440 Ga0070705_100000602 Ga0070705_1000006023 331
245 3300005444 Ga0070694_100000833 Ga0070694_10000083317 331
246 3300005444 Ga0070694_100025142 Ga0070694_1000251423 331
247 3300005444 Ga0070694_100076685 Ga0070694_1000766852 331
248 3300005445 Ga0070708_100029231 Ga0070708_1000292313 331
249 3300005445 Ga0070708_100252804 Ga0070708_1002528041 331
250 3300005457 Ga0070662_100051947 Ga0070662_1000519472 331
251 3300005458 Ga0070681_10023799 Ga0070681_100237996 331
252 3300005459 Ga0068867_100001309 Ga0068867_1000013093 331
253 3300005467 Ga0070706_100012087 Ga0070706_1000120872 331
254 3300005467 Ga0070706_100020153 Ga0070706_1000201533 331
255 3300005468 Ga0070707_100034142 Ga0070707_1000341424 331
256 3300005468 Ga0070707_100104761 Ga0070707_1001047611 331
257 3300005471 Ga0070698_100001806 Ga0070698_10000180620 331
258 3300005471 Ga0070698_100002225 Ga0070698_1000022257 331
259 3300005471 Ga0070698_100013190 Ga0070698_1000131904 331
260 3300005471 Ga0070698_100023546 Ga0070698_1000235463 331
261 3300005518 Ga0070699_100001487 Ga0070699_1000014875 331
262 3300005518 Ga0070699_100046288 Ga0070699_1000462882 331
263 3300005530 Ga0070679_100002143 Ga0070679_1000021433 331
264 3300005535 Ga0070684_100262126 Ga0070684_1002621262 331
265 3300005536 Ga0070697_100009892 Ga0070697_1000098921 331
266 3300005536 Ga0070697_100114164 Ga0070697_1001141642 331
267 3300005536 Ga0070697_100124162 Ga0070697_1001241622 331
268 3300005536 Ga0070697_100178451 Ga0070697_1001784512 331
269 3300005539 Ga0068853_100000808 Ga0068853_10000080817 331
270 3300005545 Ga0070695_100000221 Ga0070695_10000022123 331
271 3300005545 Ga0070695_100006415 Ga0070695_1000064154 331
272 3300005545 Ga0070695_100012294 Ga0070695_1000122941 331
273 3300005545 Ga0070695_100215401 Ga0070695_1002154011 331
274 3300005546 Ga0070696_100001094 Ga0070696_1000010943 331
275 3300005547 Ga0070693_100000045 Ga0070693_10000004540 331
276 3300005549 Ga0070704_100000240 Ga0070704_10000024013 331
277 3300005549 Ga0070704_100038744 Ga0070704_1000387444 331
278 3300005563 Ga0068855_100000462 Ga0068855_10000046231 331
279 3300005564 Ga0070664_100002902 Ga0070664_1000029026 331
280 3300005577 Ga0068857_100008050 Ga0068857_1000080507 331
281 3300005578 Ga0068854_100007822 Ga0068854_1000078223 331
282 3300005614 Ga0068856_100002716 Ga0068856_1000027165 331
283 3300005615 Ga0070702_100056816 Ga0070702_1000568161 331
284 3300005616 Ga0068852_100112040 Ga0068852_1001120402 331
285 3300005617 Ga0068859_100002495 Ga0068859_1000024953 331
286 3300005618 Ga0068864_100001334 Ga0068864_1000013343 331
287 3300005719 Ga0068861_100009309 Ga0068861_1000093094 331
288 3300005840 Ga0068870_10000934 Ga0068870_100009349 331
289 3300005841 Ga0068863_100122956 Ga0068863_1001229562 331
290 3300005842 Ga0068858_100020465 Ga0068858_1000204653 331
291 3300005843 Ga0068860_100051698 Ga0068860_1000516982 331
292 3300005843 Ga0068860_100194423 Ga0068860_1001944232 331
293 3300005844 Ga0068862_100002748 Ga0068862_1000027483 331
294 3300005937 Ga0081455_10000074 Ga0081455_1000007467 331
295 3300005983 Ga0081540_1005226 Ga0081540_10052265 331
296 3300006844 Ga0075428_100000331 Ga0075428_10000033110 331
297 3300006844 Ga0075428_100000400 Ga0075428_10000040024 331
298 3300006846 Ga0075430_100000096 Ga0075430_10000009610 331
299 3300006846 Ga0075430_100007365 Ga0075430_1000073655 331
300 3300006846 Ga0075430_100011494 Ga0075430_1000114942 331
301 3300006846 Ga0075430_100255753 Ga0075430_1002557531 331
302 3300006847 Ga0075431_100000833 Ga0075431_10000083320 331
303 3300006847 Ga0075431_100006591 Ga0075431_1000065914 331
304 3300006847 Ga0075431_100036755 Ga0075431_1000367554 331
305 3300006847 Ga0075431_100057958 Ga0075431_1000579584 331
306 3300006852 Ga0075433_10009404 Ga0075433_100094042 331
307 3300006852 Ga0075433_10024429 Ga0075433_100244292 331
308 3300006871 Ga0075434_100056781 Ga0075434_1000567813 331
309 3300006871 Ga0075434_100085431 Ga0075434_1000854314 331
310 3300006871 Ga0075434_100187933 Ga0075434_1001879332 331
311 3300006880 Ga0075429_100000001 Ga0075429_1000000012 331
312 3300006880 Ga0075429_100032538 Ga0075429_1000325384 331
313 3300006931 Ga0097620_100002495 Ga0097620_10000249515 331
314 3300007076 Ga0075435_100001922 Ga0075435_10000192211 331
315 3300007076 Ga0075435_100012226 Ga0075435_1000122263 331
316 3300007076 Ga0075435_100030135 Ga0075435_1000301354 331
317 3300009093 Ga0105240_10242374 Ga0105240_102423743 331
318 3300009094 Ga0111539_10001187 Ga0111539_1000118733 331
319 3300009094 Ga0111539_10007289 Ga0111539_100072896 331
320 3300009094 Ga0111539_10358009 Ga0111539_103580092 331
321 3300009147 Ga0114129_10036423 Ga0114129_100364234 331
322 3300009147 Ga0114129_10058741 Ga0114129_100587414 331
323 3300009147 Ga0114129_10094036 Ga0114129_100940364 331
324 3300009147 Ga0114129_10096583 Ga0114129_100965833 331
325 3300009174 Ga0105241_10000334 Ga0105241_100003342 331
326 3300009176 Ga0105242_10352237 Ga0105242_103522371 331
327 3300009176 Ga0105242_10415100 Ga0105242_104151001 331
328 3300009177 Ga0105248_10082402 Ga0105248_100824023 331
329 3300013100 Ga0157373_10000379 Ga0157373_1000037917 331
330 3300013297 Ga0157378_10058820 Ga0157378_100588202 331
331 3300013297 Ga0157378_10290461 Ga0157378_102904612 331
332 3300013307 Ga0157372_10000135 Ga0157372_1000013522 331
333 3300020070 Ga0206356_10485432 Ga0206356_104854322 331
334 3300025885 Ga0207653_10020446 Ga0207653_100204462 331
335 3300025901 Ga0207688_10033434 Ga0207688_100334342 331
336 3300025903 Ga0207680_10072056 Ga0207680_100720562 331
337 3300025904 Ga0207647_10046585 Ga0207647_100465852 331
338 3300025907 Ga0207645_10000075 Ga0207645_100000754 331
339 3300025908 Ga0207643_10000146 Ga0207643_100001463 331
340 3300025910 Ga0207684_10001638 Ga0207684_1000163811 331
341 3300025910 Ga0207684_10005533 Ga0207684_100055337 331
342 3300025911 Ga0207654_10053970 Ga0207654_100539702 331
343 3300025912 Ga0207707_10000135 Ga0207707_1000013518 331
344 3300025915 Ga0207693_10014327 Ga0207693_100143273 331
345 3300025917 Ga0207660_10002799 Ga0207660_100027993 331
346 3300025919 Ga0207657_10000037 Ga0207657_1000003774 331
347 3300025920 Ga0207649_10029197 Ga0207649_100291973 331
348 3300025921 Ga0207652_10001525 Ga0207652_100015256 331
349 3300025922 Ga0207646_10001729 Ga0207646_1000172919 331
350 3300025923 Ga0207681_10091109 Ga0207681_100911092 331
351 3300025925 Ga0207650_10035645 Ga0207650_100356452 331
352 3300025932 Ga0207690_10021908 Ga0207690_100219083 331
353 3300025933 Ga0207706_10053726 Ga0207706_100537262 331
354 3300025936 Ga0207670_10015743 Ga0207670_100157432 331
355 3300025939 Ga0207665_10000576 Ga0207665_100005765 331
356 3300025942 Ga0207689_10000029 Ga0207689_1000002948 331
357 3300025944 Ga0207661_10101332 Ga0207661_101013323 331
358 3300025945 Ga0207679_10002294 Ga0207679_100022943 331
359 3300025949 Ga0207667_10000652 Ga0207667_1000065216 331
360 3300025981 Ga0207640_10014544 Ga0207640_100145441 331
361 3300026023 Ga0207677_10123553 Ga0207677_101235532 331
362 3300026041 Ga0207639_10004221 Ga0207639_100042215 331
363 3300026067 Ga0207678_10005618 Ga0207678_100056183 331
364 3300026078 Ga0207702_10007290 Ga0207702_100072903 331
365 3300026088 Ga0207641_10017579 Ga0207641_100175794 331
366 3300026088 Ga0207641_10117997 Ga0207641_101179973 331
367 3300026089 Ga0207648_10000552 Ga0207648_1000055211 331
368 3300026116 Ga0207674_10000306 Ga0207674_1000030633 331
369 3300026118 Ga0207675_100010607 Ga0207675_1000106075 331
370 3300026142 Ga0207698_10133142 Ga0207698_101331422 331
371 3300027462 Ga0210000_1001013 Ga0210000_10010133 331
372 3300027471 Ga0209995_1000576 Ga0209995_10005764 331
373 3300027526 Ga0209968_1000254 Ga0209968_10002543 331
374 3300027543 Ga0209999_1000422 Ga0209999_10004224 331
375 3300027552 Ga0209982_1001324 Ga0209982_10013243 331
376 3300027665 Ga0209983_1000146 Ga0209983_100014610 331
377 3300027682 Ga0209971_1000008 Ga0209971_100000880 331
378 3300027695 Ga0209966_1000187 Ga0209966_10001875 331
379 3300027717 Ga0209998_10000016 Ga0209998_1000001622 331
380 3300027876 Ga0209974_10000710 Ga0209974_100007104 331
381 3300027907 Ga0207428_10000227 Ga0207428_100002276 331
382 3300027907 Ga0207428_10026546 Ga0207428_100265464 331
383 3300028380 Ga0268265_10003670 Ga0268265_1000367010 331
384 3300028381 Ga0268264_10038337 Ga0268264_100383373 331
385 3300028381 Ga0268264_10162373 Ga0268264_101623732 331
386 3300035091 Ga0373951_0008323 Ga0373951_0008323_1176_2318 331
387 3300035115 Ga0373941_0004881 Ga0373941_0004881_1171_2313 331
388 3300035242 Ga0373962_0015512 Ga0373962_0015512_155_1297 331
389 3300035691 Ga0373931_0035737 Ga0373931_0035737_196_1338 331
390 3300037466 Ga0395898_0018534 Ga0395898_0018534_4328_5470 331
391 3300042005 Ga0439448_0001872 Ga0439448_0001872_715_1857 331
392 3300042157 Ga0439458_0001889 Ga0439458_0001889_3293_4435 331
393 3300042876 Ga0451577_0092204 Ga0451577_0092204_781_1923 331
394 3300042876 Ga0451577_0166898 Ga0451577_0166898_259_1401 331
395 3300044673 Ga0453683_0013899 Ga0453683_0013899_2757_3899 331
396 3300044712 Ga0453684_0061871 Ga0453684_0061871_2016_3158 331
397 3300044712 Ga0453684_0168427 Ga0453684_0168427_281_1423 331
398 3300045051 Ga0451576_0024347 Ga0451576_0024347_2965_4107 331
399 3300045051 Ga0451576_0072727 Ga0451576_0072727_823_1965 331
400 3300046472 Ga0495580_0000361 Ga0495580_0000361_5180_6322 331
401 3300046684 Ga0495669_0060303 Ga0495669_0060303_490_1632 331
402 3300047318 Ga0495636_0040899 Ga0495636_0040899_408_1550 331
403 3300048905 Ga0496102_0032773 Ga0496102_0032773_2545_3687 331
404 3300048906 Ga0496103_0140935 Ga0496103_0140935_103_1245 331
405 3300048915 Ga0496112_0056779 Ga0496112_0056779_1348_2490 331
406 3300049576 Ga0501040_0075021 Ga0501040_0075021_1057_2199 331
407 3300049578 Ga0501042_0089089 Ga0501042_0089089_428_1570 331
408 3300049580 Ga0501046_0202313 Ga0501046_0202313_78_1220 331
409 3300049585 Ga0501069_0153159 Ga0501069_0153159_54_1196 331
410 3300049588 Ga0501072_0041603 Ga0501072_0041603_1928_3070 331
411 3300049591 Ga0501075_0022010 Ga0501075_0022010_3084_4226 331
412 3300049592 Ga0501076_0006750 Ga0501076_0006750_5544_6686 331
413 3300049593 Ga0501077_0037049 Ga0501077_0037049_859_2001 331
414 3300050507 nmdc:mga05p37_43843_c1 nmdc:mga05p37_43843_c1_4062_5204 331
415 3300050507 nmdc:mga05p37_70724_c1 nmdc:mga05p37_70724_c1_1356_2498 331
416 3300050507 nmdc:mga05p37_75222_c1 nmdc:mga05p37_75222_c1_1127_2269 331
417 3300050507 nmdc:mga05p37_76265_c1 nmdc:mga05p37_76265_c1_21_1163 331
418 3300050507 nmdc:mga05p37_92760_c1 nmdc:mga05p37_92760_c1_99_1241 331
419 3300050508 nmdc:mga09592_114_c1 nmdc:mga09592_114_c1_34313_35455 331
420 3300050508 nmdc:mga09592_11642_c1 nmdc:mga09592_11642_c1_2275_3417 331
421 3300050508 nmdc:mga09592_19506_c1 nmdc:mga09592_19506_c1_676_1818 331
422 3300050508 nmdc:mga09592_31534_c1 nmdc:mga09592_31534_c1_956_2098 331
423 3300050509 nmdc:mga0qj67_10866_c1 nmdc:mga0qj67_10866_c1_5473_6615 331
424 3300050509 nmdc:mga0qj67_14932_c1 nmdc:mga0qj67_14932_c1_1060_2202 331
425 3300050509 nmdc:mga0qj67_522_c1 nmdc:mga0qj67_522_c1_15390_16532 331
426 3300050510 nmdc:mga06r32_16256_c1 nmdc:mga06r32_16256_c1_1655_2797 331
427 3300050510 nmdc:mga06r32_4047_c1 nmdc:mga06r32_4047_c1_2218_3360 331
428 3300050510 nmdc:mga06r32_66669_c1 nmdc:mga06r32_66669_c1_1063_2205 331
429 3300050511 nmdc:mga08y16_10042_c1 nmdc:mga08y16_10042_c1_3727_4869 331
430 3300050511 nmdc:mga08y16_190_c1 nmdc:mga08y16_190_c1_3940_5082 331
431 3300050512 nmdc:mga0n895_11795_c1 nmdc:mga0n895_11795_c1_2095_3237 331
432 3300050512 nmdc:mga0n895_16764_c1 nmdc:mga0n895_16764_c1_5118_6260 331
433 3300050512 nmdc:mga0n895_53578_c1 nmdc:mga0n895_53578_c1_1752_2894 331
434 3300050513 nmdc:mga0rr50_295766_c1 nmdc:mga0rr50_295766_c1_151_1293 331
435 3300050513 nmdc:mga0rr50_4359_c1 nmdc:mga0rr50_4359_c1_716_1858 331
436 3300050515 nmdc:mga0a205_89672_c1 nmdc:mga0a205_89672_c1_27_1169 331
437 3300053733 Ga0500552_001025 Ga0500552_001025_1098_2240 331
438 3300054114 Ga0501084_0028822 Ga0501084_0028822_1472_2614 331
439 3300060353 Ga0501082_0112031 Ga0501082_0112031_945_2087 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

44

323

0.87

Feature Viewer

pLDDT pTM Quality
52.82 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map