F444399

General Info

Members Datasets Scaffolds Average Seq Length
440 271 430 142

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100022533|Ga0075429_1000225332
Length 140
Sequence MKPLDINEVARRSGVPASTLRFYEEKGLIGSIGRRGLRRLFDARVLERLAFIALGRASGFSLDELAHMFADGRPRLDRQVLAAKADELDRTIRELSAMRDGLRHAVACRAPSHMECPTFQRLLRAAASGAIGARKKKALA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221586 Lysobacter sp. Root667 Isolate Unclassified
5 2643221612 Lysobacter sp. Root76 Isolate Unclassified
6 2643221727 Lysobacter sp. Root96 Isolate Unclassified
7 2842677519 Variovorax sp. R-72495 Isolate Unclassified
8 2904456579 Variovorax sp. 2002 Isolate Unclassified
9 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
10 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
11 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
162 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
163 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
248 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
249 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.32
Nodule 0
Rhizoplane 4.32
Rhizosphere 85.91
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4165929 2162886012 Unclassified 1301
2 JGI25151J46595_10038945 3300003187 Bacteria 1762
3 JGI25406J46586_10011070 3300003203 Bacteria 3966
4 rootH1_10149938 3300003323 Unclassified 2527
5 Ga0070676_10078088 3300005328 Bacteria 2002
6 Ga0070683_100094303 3300005329 Bacteria 2813
7 Ga0070683_100110816 3300005329 Bacteria 2589
8 Ga0070690_100009204 3300005330 Bacteria 5716
9 Ga0070690_100898323 3300005330 Bacteria 693
10 Ga0070670_100007385 3300005331 Bacteria 9332
11 Ga0070670_100071403 3300005331 Bacteria 2981
12 Ga0068869_100017355 3300005334 Bacteria 4876
13 Ga0068869_100062199 3300005334 Bacteria 2739
14 Ga0068869_102133623 3300005334 Bacteria 504
15 Ga0070666_10015340 3300005335 Bacteria 4886
16 Ga0070666_10058194 3300005335 Bacteria 2613
17 Ga0070666_10100845 3300005335 Unclassified 1989
18 Ga0070666_10256665 3300005335 Bacteria 1238
19 Ga0070680_100140199 3300005336 Bacteria 2027
20 Ga0070682_100775830 3300005337 Bacteria 776
21 Ga0068868_100003229 3300005338 Bacteria 11339
22 Ga0068868_100037144 3300005338 Bacteria 3775
23 Ga0070689_100001347 3300005340 Bacteria 15599
24 Ga0070689_100062628 3300005340 Bacteria 2895
25 Ga0070691_10421896 3300005341 Bacteria 756
26 Ga0070687_100597299 3300005343 Bacteria 758
27 Ga0070661_100011575 3300005344 Bacteria 6149
28 Ga0070692_10033727 3300005345 Bacteria 2581
29 Ga0070668_100002793 3300005347 Bacteria 12840
30 Ga0070669_100005122 3300005353 Bacteria 9479
31 Ga0070671_100010153 3300005355 Bacteria 7561
32 Ga0070673_100022421 3300005364 Bacteria 4596
33 Ga0070688_100095531 3300005365 Bacteria 1951
34 Ga0070667_100011951 3300005367 Bacteria 7184
35 Ga0070667_100135194 3300005367 Bacteria 2155
36 Ga0070667_100613309 3300005367 Bacteria 1003
37 Ga0070667_101496101 3300005367 Bacteria 634
38 Ga0070709_10329299 3300005434 Bacteria 1123
39 Ga0070713_100020430 3300005436 Bacteria 5077
40 Ga0070710_10000331 3300005437 Bacteria 22606
41 Ga0070701_10553884 3300005438 Unclassified 755
42 Ga0070711_100078004 3300005439 Bacteria 2353
43 Ga0070700_100032048 3300005441 Bacteria 3156
44 Ga0070700_100042296 3300005441 Bacteria 2797
45 Ga0070694_100041557 3300005444 Bacteria 3068
46 Ga0070694_100298764 3300005444 Bacteria 1233
47 Ga0070663_100846171 3300005455 Bacteria 787
48 Ga0070678_100028252 3300005456 Bacteria 3823
49 Ga0070678_100161630 3300005456 Bacteria 1815
50 Ga0070662_100007879 3300005457 Bacteria 6922
51 Ga0070662_100197894 3300005457 Bacteria 1593
52 Ga0070681_10077599 3300005458 Bacteria 3279
53 Ga0070685_10028906 3300005466 Bacteria 3076
54 Ga0070685_10033815 3300005466 Bacteria 2876
55 Ga0070679_100327146 3300005530 Bacteria 1481
56 Ga0070684_100011636 3300005535 Bacteria 7012
57 Ga0070684_100054564 3300005535 Bacteria 3482
58 Ga0068853_100025427 3300005539 Bacteria 4967
59 Ga0070686_100122607 3300005544 Bacteria 1787
60 Ga0070696_101411466 3300005546 Bacteria 594
61 Ga0070693_100059607 3300005547 Bacteria 2213
62 Ga0070665_100065402 3300005548 Bacteria 3648
63 Ga0070665_100181215 3300005548 Bacteria 2107
64 Ga0070665_100202037 3300005548 Bacteria 1988
65 Ga0070665_100396004 3300005548 Bacteria 1389
66 Ga0070704_101261825 3300005549 Unclassified 675
67 Ga0068855_100036726 3300005563 Bacteria 5829
68 Ga0068855_100129871 3300005563 Bacteria 2878
69 Ga0070664_100000193 3300005564 Bacteria 43118
70 Ga0070664_100011540 3300005564 Bacteria 7169
71 Ga0068857_100010361 3300005577 Bacteria 8100
72 Ga0068857_100041487 3300005577 Bacteria 4081
73 Ga0068857_100160226 3300005577 Bacteria 2041
74 Ga0068857_100433773 3300005577 Unclassified 1227
75 Ga0068857_101389337 3300005577 Bacteria 683
76 Ga0070702_100055313 3300005615 Bacteria 2288
77 Ga0068852_100399816 3300005616 Bacteria 1351
78 Ga0068852_100439753 3300005616 Bacteria 1289
79 Ga0068852_100821932 3300005616 Bacteria 944
80 Ga0068859_100001710 3300005617 Bacteria 22383
81 Ga0068859_100020060 3300005617 Bacteria 6712
82 Ga0068864_100003690 3300005618 Bacteria 12646
83 Ga0068864_100009960 3300005618 Bacteria 7843
84 Ga0068866_11425771 3300005718 Unclassified 507
85 Ga0068861_100000862 3300005719 Bacteria 18349
86 Ga0068861_100005894 3300005719 Bacteria 8328
87 Ga0068851_10120378 3300005834 Bacteria 1410
88 Ga0068870_10025694 3300005840 Bacteria 2926
89 Ga0068863_100014170 3300005841 Bacteria 7682
90 Ga0068863_100022317 3300005841 Bacteria 6043
91 Ga0068863_100164879 3300005841 Bacteria 2124
92 Ga0068858_100014021 3300005842 Bacteria 7562
93 Ga0068858_100067857 3300005842 Bacteria 3304
94 Ga0068858_100083345 3300005842 Bacteria 2973
95 Ga0068862_100002159 3300005844 Bacteria 17696
96 Ga0068862_100008631 3300005844 Bacteria 8428
97 Ga0068862_100233893 3300005844 Bacteria 1668
98 Ga0081539_10000007 3300005985 Bacteria 532790
99 Ga0068871_100188706 3300006358 Bacteria 1775
100 Ga0068871_100284173 3300006358 Bacteria 1448
101 Ga0075428_100001139 3300006844 Bacteria 28405
102 Ga0075428_100061079 3300006844 Bacteria 4126
103 Ga0075428_100236326 3300006844 Bacteria 1972
104 Ga0075430_100063225 3300006846 Bacteria 3109
105 Ga0075430_100074150 3300006846 Bacteria 2853
106 Ga0075430_100364103 3300006846 Bacteria 1194
107 Ga0075431_100001964 3300006847 Bacteria 19611
108 Ga0075431_100007176 3300006847 Bacteria 11081
109 Ga0075431_100332578 3300006847 Bacteria 1530
110 Ga0075431_101212702 3300006847 Bacteria 717
111 Ga0075431_101522659 3300006847 Bacteria 627
112 Ga0075433_10366142 3300006852 Bacteria 1273
113 Ga0075429_100005267 3300006880 Bacteria 11126
114 Ga0075429_100022533 3300006880 Bacteria 5461
115 Ga0075429_100482786 3300006880 Bacteria 1086
116 Ga0068865_100245335 3300006881 Bacteria 1411
117 Ga0068865_100507195 3300006881 Bacteria 1007
118 Ga0068865_100553007 3300006881 Bacteria 967
119 Ga0097620_100001710 3300006931 Bacteria 22383
120 Ga0097620_100020060 3300006931 Bacteria 6712
121 Ga0105251_10515101 3300009011 Bacteria 560
122 Ga0105244_10067307 3300009036 Bacteria 1792
123 Ga0105250_10063990 3300009092 Bacteria 1481
124 Ga0105240_10001834 3300009093 Bacteria 35579
125 Ga0105240_11125028 3300009093 Bacteria 834
126 Ga0105240_11297522 3300009093 Bacteria 768
127 Ga0105240_11842842 3300009093 Bacteria 630
128 Ga0111539_10002035 3300009094 Bacteria 27020
129 Ga0111539_10042360 3300009094 Bacteria 5468
130 Ga0111539_10046542 3300009094 Bacteria 5188
131 Ga0105245_10022410 3300009098 Bacteria 5545
132 Ga0105247_10005723 3300009101 Bacteria 7779
133 Ga0105247_11029629 3300009101 Unclassified 645
134 Ga0114129_10018203 3300009147 Bacteria 10001
135 Ga0114129_10143504 3300009147 Bacteria 3272
136 Ga0114129_10704258 3300009147 Bacteria 1298
137 Ga0105243_10034521 3300009148 Bacteria 3916
138 Ga0105241_10182956 3300009174 Bacteria 1740
139 Ga0105241_10222977 3300009174 Bacteria 1586
140 Ga0105242_10620194 3300009176 Bacteria 1047
141 Ga0105248_10057160 3300009177 Bacteria 4378
142 Ga0105248_10136812 3300009177 Bacteria 2764
143 Ga0105248_10399644 3300009177 Bacteria 1547
144 Ga0105237_10029009 3300009545 Bacteria 5628
145 Ga0105237_10032086 3300009545 Bacteria 5319
146 Ga0105237_10130343 3300009545 Bacteria 2509
147 Ga0105237_10482504 3300009545 Bacteria 1246
148 Ga0105237_10545420 3300009545 Bacteria 1166
149 Ga0105238_10237068 3300009551 Bacteria 1802
150 Ga0105249_10003388 3300009553 Bacteria 13805
151 Ga0105249_10173487 3300009553 Bacteria 2092
152 Ga0105249_10502929 3300009553 Bacteria 1257
153 Ga0105239_10032716 3300010375 Bacteria 5714
154 Ga0105239_10065992 3300010375 Bacteria 3976
155 Ga0105246_10001896 3300011119 Bacteria 12593
156 Ga0105246_10039566 3300011119 Bacteria 3177
157 Ga0157370_10729022 3300013104 Bacteria 904
158 Ga0157374_10001952 3300013296 Bacteria 17299
159 Ga0157374_10308107 3300013296 Bacteria 1567
160 Ga0157378_10129254 3300013297 Bacteria 2336
161 Ga0163162_10019919 3300013306 Bacteria 6589
162 Ga0163162_10290246 3300013306 Bacteria 1768
163 Ga0157375_10223804 3300013308 Bacteria 2040
164 Ga0157375_10878370 3300013308 Bacteria 1042
165 Ga0163163_10006196 3300014325 Bacteria 10432
166 Ga0163163_10032015 3300014325 Bacteria 5078
167 Ga0163163_10341638 3300014325 Bacteria 1552
168 Ga0163163_12071318 3300014325 Bacteria 629
169 Ga0157380_10126328 3300014326 Bacteria 2174
170 Ga0157380_11900277 3300014326 Bacteria 656
171 Ga0157377_10013298 3300014745 Bacteria 4164
172 Ga0157379_10133088 3300014968 Bacteria 2239
173 Ga0157379_11040523 3300014968 Bacteria 782
174 Ga0157376_10025233 3300014969 Bacteria 4679
175 Ga0157376_10081169 3300014969 Bacteria 2784
176 Ga0157376_10436083 3300014969 Bacteria 1274
177 Ga0157376_12802226 3300014969 Bacteria 527
178 Ga0163161_10071793 3300017792 Bacteria 2534
179 Ga0209565_1002022 3300025263 Bacteria 7821
180 Ga0209675_1002383 3300025291 Bacteria 9689
181 Ga0209025_1000110 3300025294 Bacteria 220002
182 Ga0209025_1001020 3300025294 Bacteria 41211
183 Ga0209256_1000909 3300025299 Bacteria 36279
184 Ga0209051_1001616 3300025303 Bacteria 18379
185 Ga0207656_10095971 3300025321 Bacteria 1353
186 Ga0207692_10025259 3300025898 Bacteria 2772
187 Ga0207710_10376327 3300025900 Bacteria 726
188 Ga0207680_10005072 3300025903 Bacteria 6273
189 Ga0207680_10555994 3300025903 Bacteria 819
190 Ga0207680_10995568 3300025903 Unclassified 600
191 Ga0207645_10061775 3300025907 Bacteria 2393
192 Ga0207643_10027582 3300025908 Bacteria 3149
193 Ga0207654_10139490 3300025911 Bacteria 1544
194 Ga0207654_10294062 3300025911 Bacteria 1102
195 Ga0207695_10002780 3300025913 Bacteria 25475
196 Ga0207695_10324661 3300025913 Bacteria 1428
197 Ga0207671_10048427 3300025914 Bacteria 3146
198 Ga0207671_10137167 3300025914 Bacteria 1882
199 Ga0207671_10841060 3300025914 Bacteria 727
200 Ga0207660_10151661 3300025917 Bacteria 1781
201 Ga0207662_10091623 3300025918 Bacteria 1871
202 Ga0207649_10046994 3300025920 Bacteria 2654
203 Ga0207652_10180206 3300025921 Bacteria 1898
204 Ga0207681_10002425 3300025923 Bacteria 11819
205 Ga0207681_10597191 3300025923 Unclassified 912
206 Ga0207694_10195504 3300025924 Bacteria 1644
207 Ga0207650_10170705 3300025925 Bacteria 1728
208 Ga0207650_10243756 3300025925 Bacteria 1453
209 Ga0207659_11497677 3300025926 Unclassified 577
210 Ga0207687_10028134 3300025927 Bacteria 3776
211 Ga0207700_10072437 3300025928 Bacteria 2657
212 Ga0207644_10073792 3300025931 Bacteria 2502
213 Ga0207644_10339721 3300025931 Bacteria 1218
214 Ga0207644_11526055 3300025931 Bacteria 561
215 Ga0207706_10001664 3300025933 Bacteria 21964
216 Ga0207706_10009683 3300025933 Bacteria 8843
217 Ga0207706_10148934 3300025933 Bacteria 2059
218 Ga0207706_10162238 3300025933 Bacteria 1965
219 Ga0207686_10152470 3300025934 Bacteria 1610
220 Ga0207670_10053489 3300025936 Bacteria 2720
221 Ga0207704_10208235 3300025938 Bacteria 1437
222 Ga0207704_10248380 3300025938 Bacteria 1334
223 Ga0207711_10007346 3300025941 Bacteria 9223
224 Ga0207711_10217146 3300025941 Bacteria 1748
225 Ga0207689_10070297 3300025942 Bacteria 2876
226 Ga0207679_10002815 3300025945 Bacteria 10793
227 Ga0207667_10903564 3300025949 Bacteria 875
228 Ga0207651_10181701 3300025960 Bacteria 1669
229 Ga0207712_10001873 3300025961 Bacteria 13814
230 Ga0207712_10271365 3300025961 Bacteria 1380
231 Ga0207712_10403901 3300025961 Bacteria 1149
232 Ga0207668_10002152 3300025972 Bacteria 11490
233 Ga0207640_10155150 3300025981 Bacteria 1687
234 Ga0207640_11262516 3300025981 Bacteria 658
235 Ga0207658_10171391 3300025986 Bacteria 1788
236 Ga0207658_10268710 3300025986 Bacteria 1456
237 Ga0207658_10445406 3300025986 Bacteria 1146
238 Ga0207658_11563887 3300025986 Bacteria 603
239 Ga0207677_10128264 3300026023 Bacteria 1921
240 Ga0207703_10002934 3300026035 Bacteria 14507
241 Ga0207703_10034422 3300026035 Bacteria 4019
242 Ga0207703_10161946 3300026035 Bacteria 1960
243 Ga0207703_10377795 3300026035 Bacteria 1310
244 Ga0207639_10050301 3300026041 Bacteria 3165
245 Ga0207678_10169621 3300026067 Bacteria 1863
246 Ga0207678_10444548 3300026067 Bacteria 1126
247 Ga0207708_10047607 3300026075 Bacteria 3264
248 Ga0207708_10069217 3300026075 Bacteria 2702
249 Ga0207702_10542847 3300026078 Bacteria 1136
250 Ga0207641_10065180 3300026088 Bacteria 3115
251 Ga0207641_10070494 3300026088 Bacteria 3003
252 Ga0207641_10212584 3300026088 Bacteria 1789
253 Ga0207641_10579834 3300026088 Bacteria 1096
254 Ga0207676_10052037 3300026095 Bacteria 3199
255 Ga0207676_10136792 3300026095 Bacteria 2091
256 Ga0207674_10097980 3300026116 Bacteria 2916
257 Ga0207674_10130008 3300026116 Bacteria 2482
258 Ga0207674_10170168 3300026116 Bacteria 2132
259 Ga0207674_10528265 3300026116 Bacteria 1140
260 Ga0207674_10702025 3300026116 Unclassified 977
261 Ga0207675_100001285 3300026118 Bacteria 25139
262 Ga0207675_102483948 3300026118 Bacteria 529
263 Ga0207683_10019313 3300026121 Bacteria 5818
264 Ga0207698_10340921 3300026142 Bacteria 1412
265 Ga0207428_10015253 3300027907 Bacteria 6650
266 Ga0207428_10037880 3300027907 Bacteria 3923
267 Ga0207428_10183615 3300027907 Bacteria 1579
268 Ga0207428_10349269 3300027907 Bacteria 1088
269 Ga0268266_10033355 3300028379 Bacteria 4376
270 Ga0268266_10131132 3300028379 Bacteria 2242
271 Ga0268266_10169093 3300028379 Bacteria 1983
272 Ga0268266_11111798 3300028379 Bacteria 764
273 Ga0268265_10000947 3300028380 Bacteria 26684
274 Ga0268265_10081171 3300028380 Bacteria 2560
275 Ga0268265_10255278 3300028380 Bacteria 1555
276 Ga0268265_10297676 3300028380 Bacteria 1451
277 Ga0268264_11208437 3300028381 Bacteria 765
278 Ga0307515_10809224 3300028794 Bacteria 560
279 Ga0316177_1005466 3300030731 Bacteria 1192
280 Ga0314311_1069236 3300030733 Bacteria 6302
281 Ga0316180_1029427 3300030736 Bacteria 3199
282 Ga0316182_1070210 3300030745 Bacteria 3396
283 Ga0307513_10051342 3300031456 Bacteria 4450
284 Ga0307509_10275371 3300031507 Bacteria 1448
285 Ga0307408_100197539 3300031548 Bacteria 1625
286 Ga0307408_100331520 3300031548 Bacteria 1285
287 Ga0307508_10417642 3300031616 Bacteria 933
288 Ga0307405_10215764 3300031731 Bacteria 1404
289 Ga0307405_10221684 3300031731 Bacteria 1388
290 Ga0307405_10341617 3300031731 Bacteria 1151
291 Ga0307413_10287637 3300031824 Bacteria 1240
292 Ga0307413_10858784 3300031824 Bacteria 767
293 Ga0307406_10619092 3300031901 Bacteria 895
294 Ga0307407_10863801 3300031903 Bacteria 692
295 Ga0307412_10089607 3300031911 Bacteria 2148
296 Ga0307412_10238839 3300031911 Bacteria 1404
297 Ga0307412_10416912 3300031911 Bacteria 1097
298 Ga0307416_100101563 3300032002 Bacteria 2505
299 Ga0307416_100155770 3300032002 Bacteria 2103
300 Ga0307416_100338008 3300032002 Bacteria 1517
301 Ga0307411_10038814 3300032005 Bacteria 3008
302 Ga0307411_10632409 3300032005 Bacteria 924
303 Ga0307415_101637606 3300032126 Bacteria 619
304 Ga0307415_102006430 3300032126 Bacteria 563
305 Ga0373934_0132916 3300035086 Bacteria 1015
306 Ga0373932_0206023 3300035112 Bacteria 701
307 Ga0373932_0286512 3300035112 Unclassified 611
308 Ga0373954_0150382 3300035118 Bacteria 1137
309 Ga0373956_0082234 3300035119 Bacteria 1479
310 Ga0373946_0704071 3300035171 Bacteria 528
311 Ga0373931_0120414 3300035691 Bacteria 1499
312 Ga0373933_0265846 3300035724 Bacteria 1106
313 Ga0373937_0059126 3300036401 Bacteria 3522
314 Ga0373937_0439673 3300036401 Bacteria 1238
315 Ga0439439_0000342 3300041406 Bacteria 7562
316 Ga0439466_0238771 3300041411 Bacteria 551
317 Ga0439465_0024562 3300041413 Bacteria 1900
318 Ga0451798_0491011 3300041458 Bacteria 911
319 Ga0451853_2314401 3300041512 Bacteria 548
320 Ga0439445_0006847 3300042004 Bacteria 2631
321 Ga0439448_0082446 3300042005 Bacteria 1081
322 Ga0439432_053968 3300042006 Bacteria 1249
323 Ga0439455_0057078 3300042012 Bacteria 1029
324 Ga0439462_0005948 3300042015 Bacteria 3022
325 Ga0450892_007622 3300042130 Bacteria 916
326 Ga0439464_0066304 3300042439 Bacteria 1063
327 Ga0439440_0280866 3300042993 Bacteria 514
328 Ga0466972_0001299 3300044658 Bacteria 12074
329 Ga0466972_0001757 3300044658 Bacteria 10627
330 Ga0466972_0020221 3300044658 Bacteria 3327
331 Ga0466972_0207067 3300044658 Bacteria 918
332 Ga0466965_0002672 3300044683 Bacteria 7625
333 Ga0466965_0016633 3300044683 Bacteria 3504
334 Ga0466965_0017044 3300044683 Bacteria 3467
335 Ga0466963_0478940 3300044694 Bacteria 879
336 Ga0466968_0240512 3300044735 Bacteria 857
337 Ga0466960_0028452 3300044901 Bacteria 2557
338 Ga0466960_0471291 3300044901 Bacteria 732
339 Ga0466960_0863222 3300044901 Bacteria 550
340 Ga0451576_0040889 3300045051 Bacteria 4902
341 Ga0451576_0098299 3300045051 Bacteria 3044
342 Ga0495603_0504128 3300046455 Bacteria 693
343 Ga0495638_0081818 3300046460 Bacteria 1959
344 Ga0495580_0625187 3300046472 Bacteria 710
345 Ga0495594_0345900 3300046499 Bacteria 847
346 Ga0495610_0031387 3300046512 Bacteria 2772
347 Ga0495616_0002046 3300046513 Bacteria 13550
348 Ga0495620_0078814 3300046515 Bacteria 1335
349 Ga0495631_0000427 3300046518 Bacteria 29158
350 Ga0495654_0012551 3300046530 Bacteria 4547
351 Ga0495656_0136891 3300046615 Bacteria 1171
352 Ga0495668_0125128 3300046616 Bacteria 1407
353 Ga0495668_0693128 3300046616 Bacteria 563
354 Ga0495611_0260337 3300046648 Unclassified 803
355 Ga0495625_0143943 3300046660 Bacteria 1606
356 Ga0495647_0324533 3300046681 Bacteria 697
357 Ga0496101_0075829 3300048904 Bacteria 2476
358 Ga0496104_0199072 3300048907 Bacteria 1915
359 Ga0496104_0362008 3300048907 Bacteria 1363
360 Ga0496105_1276202 3300048908 Bacteria 537
361 Ga0496106_0080618 3300048909 Bacteria 2500
362 Ga0496106_1334540 3300048909 Bacteria 556
363 Ga0496108_0094831 3300048911 Bacteria 2540
364 Ga0496108_0316911 3300048911 Bacteria 1359
365 Ga0496109_0080490 3300048912 Bacteria 3001
366 Ga0496109_0549071 3300048912 Bacteria 1090
367 Ga0496110_0516121 3300048913 Bacteria 1087
368 Ga0496110_1047006 3300048913 Bacteria 724
369 Ga0496111_0420803 3300048914 Bacteria 987
370 Ga0496112_0025010 3300048915 Bacteria 5729
371 Ga0496113_0213202 3300048916 Bacteria 1538
372 Ga0496114_0003704 3300048917 Bacteria 11766
373 Ga0496115_1342556 3300048918 Bacteria 531
374 Ga0496119_0120221 3300048922 Bacteria 1445
375 Ga0496121_0128442 3300048924 Bacteria 1902
376 Ga0496121_0476080 3300048924 Bacteria 798
377 Ga0496122_0198427 3300048925 Bacteria 1176
378 Ga0496123_0041475 3300048926 Bacteria 3190
379 Ga0496124_0081846 3300048927 Bacteria 2652
380 Ga0496124_0320455 3300048927 Bacteria 1110
381 Ga0496125_0005216 3300048928 Bacteria 14579
382 Ga0496125_0115423 3300048928 Bacteria 1931
383 Ga0496125_0194580 3300048928 Bacteria 1335
384 Ga0496126_0082673 3300048929 Bacteria 2837
385 Ga0495678_078360 3300049459 Bacteria 1193
386 Ga0501037_0509542 3300049573 Unclassified 816
387 Ga0501038_0480955 3300049574 Bacteria 952
388 Ga0501039_0561110 3300049575 Bacteria 896
389 Ga0501040_0346634 3300049576 Bacteria 1064
390 Ga0501047_0034846 3300049581 Bacteria 4860
391 Ga0501048_0890746 3300049582 Unclassified 640
392 Ga0501069_0642472 3300049585 Bacteria 638
393 Ga0501070_0155046 3300049586 Bacteria 1889
394 Ga0501071_0452384 3300049587 Bacteria 983
395 Ga0501071_1066840 3300049587 Bacteria 624
396 Ga0501249_068813 3300049679 Bacteria 826
397 Ga0501257_050019 3300049686 Bacteria 1041
398 Ga0501262_000154 3300049759 Bacteria 8380
399 nmdc:mga03n38_658765_c1 3300050490 Bacteria 600
400 nmdc:mga00v17_234491_c1 3300050491 Bacteria 1189
401 nmdc:mga00v17_680635_c1 3300050491 Bacteria 660
402 nmdc:mga0yw44_199089_c1 3300050492 Bacteria 1322
403 nmdc:mga04h51_346807_c1 3300050495 Bacteria 613
404 nmdc:mga05p37_31626_c1 3300050507 Bacteria 6466
405 nmdc:mga05p37_3192_c1 3300050507 Bacteria 19075
406 nmdc:mga05p37_470892_c1 3300050507 Bacteria 1449
407 nmdc:mga09592_10636_c1 3300050508 Bacteria 7495
408 nmdc:mga09592_5838_c1 3300050508 Bacteria 10039
409 nmdc:mga0qj67_69199_c1 3300050509 Bacteria 2815
410 nmdc:mga06r32_1002067_c1 3300050510 Bacteria 788
411 nmdc:mga06r32_15987_c1 3300050510 Bacteria 6829
412 nmdc:mga06r32_313368_c1 3300050510 Bacteria 1555
413 nmdc:mga08y16_326219_c1 3300050511 Bacteria 1580
414 nmdc:mga08y16_3886_c1 3300050511 Bacteria 15549
415 nmdc:mga08y16_4393_c1 3300050511 Bacteria 14735
416 nmdc:mga08y16_970543_c1 3300050511 Bacteria 832
417 nmdc:mga0n895_1714847_c1 3300050512 Bacteria 590
418 nmdc:mga0rr50_1684979_c1 3300050513 Unclassified 534
419 nmdc:mga08x19_1002101_c1 3300050514 Bacteria 593
420 nmdc:mga0a205_473997_c1 3300050515 Bacteria 1110
421 Ga0495601_0006023 3300053077 Bacteria 7075
422 Ga0495601_0789967 3300053077 Bacteria 603
423 Ga0500651_0724558 3300053093 Bacteria 530
424 Ga0500594_0000622 3300053118 Bacteria 7582
425 Ga0500595_070000 3300053119 Bacteria 1043
426 Ga0500658_0000674 3300053134 Bacteria 14085
427 Ga0500568_0005363 3300053139 Bacteria 6641
428 Ga0500616_0002196 3300053153 Bacteria 16795
429 Ga0500637_0116388 3300053178 Bacteria 1551
430 Ga0501082_0259451 3300060353 Bacteria 1512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0016633 Ga0466965_0016633_1592_1981 128
2 3300044658 Ga0466972_0207067 Ga0466972_0207067_488_877 129
3 3300005437 Ga0070710_10000331 Ga0070710_100003317 130
4 3300005439 Ga0070711_100078004 Ga0070711_1000780043 130
5 3300025898 Ga0207692_10025259 Ga0207692_100252592 130
6 3300044658 Ga0466972_0001757 Ga0466972_0001757_8225_8617 130
7 3300044683 Ga0466965_0002672 Ga0466965_0002672_3740_4132 130
8 3300044735 Ga0466968_0240512 Ga0466968_0240512_16_408 130
9 3300044901 Ga0466960_0028452 Ga0466960_0028452_1597_1989 130
10 3300005334 Ga0068869_100062199 Ga0068869_1000621993 131
11 3300005335 Ga0070666_10100845 Ga0070666_101008453 131
12 3300005577 Ga0068857_100433773 Ga0068857_1004337732 131
13 3300009092 Ga0105250_10063990 Ga0105250_100639903 131
14 3300009093 Ga0105240_11297522 Ga0105240_112975222 131
15 3300009101 Ga0105247_11029629 Ga0105247_110296291 131
16 3300009177 Ga0105248_10136812 Ga0105248_101368123 131
17 3300009545 Ga0105237_10482504 Ga0105237_104825042 131
18 3300009551 Ga0105238_10237068 Ga0105238_102370682 131
19 3300009553 Ga0105249_10173487 Ga0105249_101734873 131
20 3300010375 Ga0105239_10065992 Ga0105239_100659924 131
21 3300014325 Ga0163163_12071318 Ga0163163_120713181 131
22 3300014968 Ga0157379_11040523 Ga0157379_110405232 131
23 3300025903 Ga0207680_10995568 Ga0207680_109955681 131
24 3300025914 Ga0207671_10841060 Ga0207671_108410602 131
25 3300025941 Ga0207711_10217146 Ga0207711_102171462 131
26 3300025961 Ga0207712_10271365 Ga0207712_102713653 131
27 3300025986 Ga0207658_10445406 Ga0207658_104454063 131
28 3300026035 Ga0207703_10161946 Ga0207703_101619463 131
29 3300026088 Ga0207641_10579834 Ga0207641_105798341 131
30 3300026116 Ga0207674_10702025 Ga0207674_107020252 131
31 3300030731 Ga0316177_1005466 Ga0316177_10054663 131
32 3300030733 Ga0314311_1069236 Ga0314311_10692364 131
33 3300030736 Ga0316180_1029427 Ga0316180_10294271 131
34 3300030745 Ga0316182_1070210 Ga0316182_10702105 133
35 iso_pu_bacteria 2904456579 2904457375 133
36 3300028794 Ga0307515_10809224 Ga0307515_108092241 134
37 3300031824 Ga0307413_10287637 Ga0307413_102876372 134
38 3300031903 Ga0307407_10863801 Ga0307407_108638012 134
39 3300014326 Ga0157380_11900277 Ga0157380_119002771 136
40 3300046648 Ga0495611_0260337 Ga0495611_0260337_334_759 136
41 3300049574 Ga0501038_0480955 Ga0501038_0480955_392_808 136
42 3300049575 Ga0501039_0561110 Ga0501039_0561110_376_792 136
43 3300049585 Ga0501069_0642472 Ga0501069_0642472_152_568 136
44 3300049587 Ga0501071_0452384 Ga0501071_0452384_201_617 136
45 3300049686 Ga0501257_050019 Ga0501257_050019_501_932 136
46 3300049759 Ga0501262_000154 Ga0501262_000154_543_974 136
47 iso_pu_bacteria 2643221559 2643817417 136
48 iso_pu_bacteria 2643221586 2643938128 136
49 iso_pu_bacteria 2643221612 2644079200 136
50 iso_pu_bacteria 2643221727 2644694644 136
51 3300049573 Ga0501037_0509542 Ga0501037_0509542_87_521 137
52 3300049581 Ga0501047_0034846 Ga0501047_0034846_3902_4336 137
53 3300049582 Ga0501048_0890746 Ga0501048_0890746_106_540 137
54 3300049679 Ga0501249_068813 Ga0501249_068813_324_755 137
55 3300050492 nmdc:mga0yw44_199089_c1 nmdc:mga0yw44_199089_c1_351_776 137
56 iso_pu_bacteria 2606217733 2608380537 137
57 iso_pu_bacteria 2842677519 2842678432 137
58 iso_pu_bacteria 2919462493 2919465156 137
59 iso_pu_bacteria 2928084124 2928086825 137
60 iso_pu_bacteria 2945984333 2945987469 137
61 3300031456 Ga0307513_10051342 Ga0307513_100513424 138
62 3300035086 Ga0373934_0132916 Ga0373934_0132916_201_695 138
63 3300036401 Ga0373937_0059126 Ga0373937_0059126_2510_3004 138
64 3300044658 Ga0466972_0001299 Ga0466972_0001299_2912_3343 138
65 3300044683 Ga0466965_0017044 Ga0466965_0017044_688_1119 138
66 3300044694 Ga0466963_0478940 Ga0466963_0478940_194_631 138
67 3300044901 Ga0466960_0863222 Ga0466960_0863222_104_523 138
68 3300049587 Ga0501071_1066840 Ga0501071_1066840_40_462 138
69 3300050490 nmdc:mga03n38_658765_c1 nmdc:mga03n38_658765_c1_37_465 138
70 3300050491 nmdc:mga00v17_234491_c1 nmdc:mga00v17_234491_c1_213_641 138
71 3300050495 nmdc:mga04h51_346807_c1 nmdc:mga04h51_346807_c1_148_567 138
72 3300053153 Ga0500616_0002196 Ga0500616_0002196_7108_7557 138
73 3300003323 rootH1_10149938 rootH1_101499383 139
74 3300005335 Ga0070666_10256665 Ga0070666_102566653 139
75 3300005367 Ga0070667_100135194 Ga0070667_1001351943 139
76 3300005548 Ga0070665_100202037 Ga0070665_1002020372 139
77 3300005841 Ga0068863_100164879 Ga0068863_1001648793 139
78 3300005842 Ga0068858_100014021 Ga0068858_1000140217 139
79 3300009177 Ga0105248_10399644 Ga0105248_103996442 139
80 3300009545 Ga0105237_10029009 Ga0105237_100290097 139
81 3300013296 Ga0157374_10308107 Ga0157374_103081072 139
82 3300014325 Ga0163163_10341638 Ga0163163_103416382 139
83 3300014969 Ga0157376_10436083 Ga0157376_104360832 139
84 3300025900 Ga0207710_10376327 Ga0207710_103763271 139
85 3300025903 Ga0207680_10555994 Ga0207680_105559942 139
86 3300025914 Ga0207671_10048427 Ga0207671_100484274 139
87 3300025931 Ga0207644_10339721 Ga0207644_103397213 139
88 3300025981 Ga0207640_11262516 Ga0207640_112625162 139
89 3300025986 Ga0207658_10171391 Ga0207658_101713912 139
90 3300026035 Ga0207703_10002934 Ga0207703_1000293410 139
91 3300026088 Ga0207641_10212584 Ga0207641_102125843 139
92 3300026118 Ga0207675_102483948 Ga0207675_1024839481 139
93 3300028379 Ga0268266_10169093 Ga0268266_101690933 139
94 3300031616 Ga0307508_10417642 Ga0307508_104176421 139
95 3300041458 Ga0451798_0491011 Ga0451798_0491011_268_687 139
96 3300046515 Ga0495620_0078814 Ga0495620_0078814_875_1306 139
97 3300046518 Ga0495631_0000427 Ga0495631_0000427_24868_25299 139
98 3300048916 Ga0496113_0213202 Ga0496113_0213202_355_774 139
99 3300048924 Ga0496121_0128442 Ga0496121_0128442_1403_1822 139
100 3300048928 Ga0496125_0005216 Ga0496125_0005216_9194_9613 139
101 3300053118 Ga0500594_0000622 Ga0500594_0000622_4554_4985 139
102 3300060353 Ga0501082_0259451 Ga0501082_0259451_924_1427 139
103 3300005367 Ga0070667_100613309 Ga0070667_1006133092 140
104 3300005548 Ga0070665_100181215 Ga0070665_1001812153 140
105 3300006844 Ga0075428_100001139 Ga0075428_10000113910 140
106 3300006847 Ga0075431_100001964 Ga0075431_1000019648 140
107 3300006847 Ga0075431_101212702 Ga0075431_1012127022 140
108 3300006852 Ga0075433_10366142 Ga0075433_103661422 140
109 3300006880 Ga0075429_100005267 Ga0075429_10000526710 140
110 3300006880 Ga0075429_100022533 Ga0075429_1000225332 140
111 3300009094 Ga0111539_10002035 Ga0111539_100020357 140
112 3300009147 Ga0114129_10018203 Ga0114129_100182033 140
113 3300009147 Ga0114129_10143504 Ga0114129_101435045 140
114 3300009174 Ga0105241_10222977 Ga0105241_102229772 140
115 3300025263 Ga0209565_1002022 Ga0209565_10020225 140
116 3300025291 Ga0209675_1002383 Ga0209675_10023834 140
117 3300025294 Ga0209025_1001020 Ga0209025_10010208 140
118 3300025299 Ga0209256_1000909 Ga0209256_100090931 140
119 3300025303 Ga0209051_1001616 Ga0209051_10016163 140
120 3300025911 Ga0207654_10139490 Ga0207654_101394903 140
121 3300027907 Ga0207428_10015253 Ga0207428_100152534 140
122 3300027907 Ga0207428_10349269 Ga0207428_103492692 140
123 3300028379 Ga0268266_10033355 Ga0268266_100333553 140
124 3300031548 Ga0307408_100197539 Ga0307408_1001975392 140
125 3300031731 Ga0307405_10221684 Ga0307405_102216841 140
126 3300031911 Ga0307412_10238839 Ga0307412_102388392 140
127 3300032126 Ga0307415_101637606 Ga0307415_1016376061 140
128 3300041512 Ga0451853_2314401 Ga0451853_2314401_18_458 140
129 3300042005 Ga0439448_0082446 Ga0439448_0082446_48_470 140
130 3300042012 Ga0439455_0057078 Ga0439455_0057078_131_553 140
131 3300042130 Ga0450892_007622 Ga0450892_007622_140_562 140
132 3300042993 Ga0439440_0280866 Ga0439440_0280866_42_464 140
133 3300046616 Ga0495668_0693128 Ga0495668_0693128_121_543 140
134 3300048927 Ga0496124_0081846 Ga0496124_0081846_1022_1471 140
135 3300048928 Ga0496125_0194580 Ga0496125_0194580_499_948 140
136 3300049459 Ga0495678_078360 Ga0495678_078360_206_655 140
137 3300050507 nmdc:mga05p37_31626_c1 nmdc:mga05p37_31626_c1_4145_4567 140
138 3300050507 nmdc:mga05p37_3192_c1 nmdc:mga05p37_3192_c1_10458_10880 140
139 3300050508 nmdc:mga09592_10636_c1 nmdc:mga09592_10636_c1_5748_6170 140
140 3300050508 nmdc:mga09592_5838_c1 nmdc:mga09592_5838_c1_1062_1484 140
141 3300050509 nmdc:mga0qj67_69199_c1 nmdc:mga0qj67_69199_c1_443_865 140
142 3300050510 nmdc:mga06r32_1002067_c1 nmdc:mga06r32_1002067_c1_26_448 140
143 3300050510 nmdc:mga06r32_15987_c1 nmdc:mga06r32_15987_c1_3576_3998 140
144 3300050510 nmdc:mga06r32_313368_c1 nmdc:mga06r32_313368_c1_785_1207 140
145 3300050511 nmdc:mga08y16_3886_c1 nmdc:mga08y16_3886_c1_10097_10519 140
146 3300050511 nmdc:mga08y16_4393_c1 nmdc:mga08y16_4393_c1_2947_3369 140
147 3300050515 nmdc:mga0a205_473997_c1 nmdc:mga0a205_473997_c1_386_808 140
148 2162886012 MBSR1b_contig_4165929 MBSR1b_0280.00005190 141
149 3300003187 JGI25151J46595_10038945 JGI25151J46595_100389452 141
150 3300003203 JGI25406J46586_10011070 JGI25406J46586_100110702 141
151 3300005328 Ga0070676_10078088 Ga0070676_100780882 141
152 3300005329 Ga0070683_100094303 Ga0070683_1000943033 141
153 3300005329 Ga0070683_100110816 Ga0070683_1001108163 141
154 3300005330 Ga0070690_100009204 Ga0070690_1000092045 141
155 3300005330 Ga0070690_100898323 Ga0070690_1008983231 141
156 3300005331 Ga0070670_100007385 Ga0070670_1000073855 141
157 3300005331 Ga0070670_100071403 Ga0070670_1000714033 141
158 3300005334 Ga0068869_100017355 Ga0068869_1000173553 141
159 3300005334 Ga0068869_102133623 Ga0068869_1021336231 141
160 3300005335 Ga0070666_10015340 Ga0070666_100153405 141
161 3300005335 Ga0070666_10058194 Ga0070666_100581943 141
162 3300005336 Ga0070680_100140199 Ga0070680_1001401992 141
163 3300005337 Ga0070682_100775830 Ga0070682_1007758302 141
164 3300005338 Ga0068868_100003229 Ga0068868_1000032294 141
165 3300005338 Ga0068868_100037144 Ga0068868_1000371446 141
166 3300005340 Ga0070689_100001347 Ga0070689_1000013475 141
167 3300005340 Ga0070689_100062628 Ga0070689_1000626283 141
168 3300005341 Ga0070691_10421896 Ga0070691_104218962 141
169 3300005343 Ga0070687_100597299 Ga0070687_1005972992 141
170 3300005344 Ga0070661_100011575 Ga0070661_1000115752 141
171 3300005345 Ga0070692_10033727 Ga0070692_100337273 141
172 3300005347 Ga0070668_100002793 Ga0070668_10000279311 141
173 3300005353 Ga0070669_100005122 Ga0070669_10000512212 141
174 3300005355 Ga0070671_100010153 Ga0070671_1000101534 141
175 3300005364 Ga0070673_100022421 Ga0070673_1000224213 141
176 3300005365 Ga0070688_100095531 Ga0070688_1000955313 141
177 3300005367 Ga0070667_100011951 Ga0070667_1000119517 141
178 3300005367 Ga0070667_101496101 Ga0070667_1014961012 141
179 3300005434 Ga0070709_10329299 Ga0070709_103292991 141
180 3300005436 Ga0070713_100020430 Ga0070713_1000204302 141
181 3300005438 Ga0070701_10553884 Ga0070701_105538842 141
182 3300005441 Ga0070700_100032048 Ga0070700_1000320483 141
183 3300005441 Ga0070700_100042296 Ga0070700_1000422962 141
184 3300005444 Ga0070694_100041557 Ga0070694_1000415573 141
185 3300005444 Ga0070694_100298764 Ga0070694_1002987642 141
186 3300005455 Ga0070663_100846171 Ga0070663_1008461711 141
187 3300005456 Ga0070678_100028252 Ga0070678_1000282525 141
188 3300005456 Ga0070678_100161630 Ga0070678_1001616302 141
189 3300005457 Ga0070662_100007879 Ga0070662_1000078793 141
190 3300005457 Ga0070662_100197894 Ga0070662_1001978942 141
191 3300005458 Ga0070681_10077599 Ga0070681_100775995 141
192 3300005466 Ga0070685_10028906 Ga0070685_100289063 141
193 3300005466 Ga0070685_10033815 Ga0070685_100338155 141
194 3300005530 Ga0070679_100327146 Ga0070679_1003271462 141
195 3300005535 Ga0070684_100011636 Ga0070684_1000116362 141
196 3300005535 Ga0070684_100054564 Ga0070684_1000545643 141
197 3300005539 Ga0068853_100025427 Ga0068853_1000254275 141
198 3300005544 Ga0070686_100122607 Ga0070686_1001226072 141
199 3300005546 Ga0070696_101411466 Ga0070696_1014114662 141
200 3300005547 Ga0070693_100059607 Ga0070693_1000596072 141
201 3300005548 Ga0070665_100065402 Ga0070665_1000654022 141
202 3300005548 Ga0070665_100396004 Ga0070665_1003960042 141
203 3300005549 Ga0070704_101261825 Ga0070704_1012618251 141
204 3300005563 Ga0068855_100036726 Ga0068855_1000367265 141
205 3300005563 Ga0068855_100129871 Ga0068855_1001298713 141
206 3300005564 Ga0070664_100000193 Ga0070664_1000001932 141
207 3300005564 Ga0070664_100011540 Ga0070664_1000115404 141
208 3300005577 Ga0068857_100010361 Ga0068857_1000103616 141
209 3300005577 Ga0068857_100041487 Ga0068857_1000414874 141
210 3300005577 Ga0068857_100160226 Ga0068857_1001602262 141
211 3300005577 Ga0068857_101389337 Ga0068857_1013893372 141
212 3300005615 Ga0070702_100055313 Ga0070702_1000553131 141
213 3300005616 Ga0068852_100399816 Ga0068852_1003998162 141
214 3300005616 Ga0068852_100439753 Ga0068852_1004397532 141
215 3300005616 Ga0068852_100821932 Ga0068852_1008219322 141
216 3300005617 Ga0068859_100001710 Ga0068859_10000171024 141
217 3300005617 Ga0068859_100020060 Ga0068859_1000200604 141
218 3300005618 Ga0068864_100003690 Ga0068864_1000036906 141
219 3300005618 Ga0068864_100009960 Ga0068864_1000099604 141
220 3300005718 Ga0068866_11425771 Ga0068866_114257711 141
221 3300005719 Ga0068861_100000862 Ga0068861_1000008628 141
222 3300005719 Ga0068861_100005894 Ga0068861_1000058942 141
223 3300005834 Ga0068851_10120378 Ga0068851_101203782 141
224 3300005840 Ga0068870_10025694 Ga0068870_100256945 141
225 3300005841 Ga0068863_100014170 Ga0068863_1000141703 141
226 3300005841 Ga0068863_100022317 Ga0068863_1000223172 141
227 3300005842 Ga0068858_100067857 Ga0068858_1000678576 141
228 3300005842 Ga0068858_100083345 Ga0068858_1000833453 141
229 3300005844 Ga0068862_100002159 Ga0068862_1000021597 141
230 3300005844 Ga0068862_100008631 Ga0068862_10000863111 141
231 3300005844 Ga0068862_100233893 Ga0068862_1002338933 141
232 3300005985 Ga0081539_10000007 Ga0081539_1000000714 141
233 3300006358 Ga0068871_100188706 Ga0068871_1001887063 141
234 3300006358 Ga0068871_100284173 Ga0068871_1002841732 141
235 3300006844 Ga0075428_100061079 Ga0075428_1000610793 141
236 3300006844 Ga0075428_100236326 Ga0075428_1002363262 141
237 3300006846 Ga0075430_100063225 Ga0075430_1000632254 141
238 3300006846 Ga0075430_100074150 Ga0075430_1000741504 141
239 3300006846 Ga0075430_100364103 Ga0075430_1003641032 141
240 3300006847 Ga0075431_100007176 Ga0075431_1000071763 141
241 3300006847 Ga0075431_100332578 Ga0075431_1003325781 141
242 3300006847 Ga0075431_101522659 Ga0075431_1015226592 141
243 3300006880 Ga0075429_100482786 Ga0075429_1004827863 141
244 3300006881 Ga0068865_100245335 Ga0068865_1002453353 141
245 3300006881 Ga0068865_100507195 Ga0068865_1005071952 141
246 3300006881 Ga0068865_100553007 Ga0068865_1005530072 141
247 3300006931 Ga0097620_100001710 Ga0097620_10000171024 141
248 3300006931 Ga0097620_100020060 Ga0097620_1000200604 141
249 3300009011 Ga0105251_10515101 Ga0105251_105151012 141
250 3300009036 Ga0105244_10067307 Ga0105244_100673073 141
251 3300009093 Ga0105240_10001834 Ga0105240_1000183423 141
252 3300009093 Ga0105240_11125028 Ga0105240_111250282 141
253 3300009093 Ga0105240_11842842 Ga0105240_118428421 141
254 3300009094 Ga0111539_10042360 Ga0111539_100423603 141
255 3300009094 Ga0111539_10046542 Ga0111539_100465426 141
256 3300009098 Ga0105245_10022410 Ga0105245_100224103 141
257 3300009101 Ga0105247_10005723 Ga0105247_100057236 141
258 3300009147 Ga0114129_10704258 Ga0114129_107042582 141
259 3300009148 Ga0105243_10034521 Ga0105243_100345215 141
260 3300009174 Ga0105241_10182956 Ga0105241_101829563 141
261 3300009176 Ga0105242_10620194 Ga0105242_106201942 141
262 3300009177 Ga0105248_10057160 Ga0105248_100571604 141
263 3300009545 Ga0105237_10032086 Ga0105237_100320865 141
264 3300009545 Ga0105237_10130343 Ga0105237_101303432 141
265 3300009545 Ga0105237_10545420 Ga0105237_105454202 141
266 3300009553 Ga0105249_10003388 Ga0105249_1000338816 141
267 3300009553 Ga0105249_10502929 Ga0105249_105029292 141
268 3300010375 Ga0105239_10032716 Ga0105239_100327163 141
269 3300011119 Ga0105246_10001896 Ga0105246_100018965 141
270 3300011119 Ga0105246_10039566 Ga0105246_100395662 141
271 3300013104 Ga0157370_10729022 Ga0157370_107290222 141
272 3300013296 Ga0157374_10001952 Ga0157374_1000195214 141
273 3300013297 Ga0157378_10129254 Ga0157378_101292543 141
274 3300013306 Ga0163162_10019919 Ga0163162_100199193 141
275 3300013306 Ga0163162_10290246 Ga0163162_102902462 141
276 3300013308 Ga0157375_10223804 Ga0157375_102238041 141
277 3300013308 Ga0157375_10878370 Ga0157375_108783702 141
278 3300014325 Ga0163163_10006196 Ga0163163_100061965 141
279 3300014325 Ga0163163_10032015 Ga0163163_100320152 141
280 3300014326 Ga0157380_10126328 Ga0157380_101263283 141
281 3300014745 Ga0157377_10013298 Ga0157377_100132984 141
282 3300014968 Ga0157379_10133088 Ga0157379_101330883 141
283 3300014969 Ga0157376_10025233 Ga0157376_100252334 141
284 3300014969 Ga0157376_10081169 Ga0157376_100811692 141
285 3300014969 Ga0157376_12802226 Ga0157376_128022261 141
286 3300017792 Ga0163161_10071793 Ga0163161_100717933 141
287 3300025294 Ga0209025_1000110 Ga0209025_100011085 141
288 3300025321 Ga0207656_10095971 Ga0207656_100959712 141
289 3300025903 Ga0207680_10005072 Ga0207680_100050723 141
290 3300025907 Ga0207645_10061775 Ga0207645_100617753 141
291 3300025908 Ga0207643_10027582 Ga0207643_100275823 141
292 3300025911 Ga0207654_10294062 Ga0207654_102940622 141
293 3300025913 Ga0207695_10002780 Ga0207695_1000278015 141
294 3300025913 Ga0207695_10324661 Ga0207695_103246611 141
295 3300025914 Ga0207671_10137167 Ga0207671_101371673 141
296 3300025917 Ga0207660_10151661 Ga0207660_101516612 141
297 3300025918 Ga0207662_10091623 Ga0207662_100916233 141
298 3300025920 Ga0207649_10046994 Ga0207649_100469942 141
299 3300025921 Ga0207652_10180206 Ga0207652_101802062 141
300 3300025923 Ga0207681_10002425 Ga0207681_100024256 141
301 3300025923 Ga0207681_10597191 Ga0207681_105971912 141
302 3300025924 Ga0207694_10195504 Ga0207694_101955043 141
303 3300025925 Ga0207650_10170705 Ga0207650_101707051 141
304 3300025925 Ga0207650_10243756 Ga0207650_102437562 141
305 3300025926 Ga0207659_11497677 Ga0207659_114976771 141
306 3300025927 Ga0207687_10028134 Ga0207687_100281343 141
307 3300025928 Ga0207700_10072437 Ga0207700_100724373 141
308 3300025931 Ga0207644_10073792 Ga0207644_100737921 141
309 3300025931 Ga0207644_11526055 Ga0207644_115260551 141
310 3300025933 Ga0207706_10001664 Ga0207706_100016643 141
311 3300025933 Ga0207706_10009683 Ga0207706_100096835 141
312 3300025933 Ga0207706_10148934 Ga0207706_101489343 141
313 3300025933 Ga0207706_10162238 Ga0207706_101622382 141
314 3300025934 Ga0207686_10152470 Ga0207686_101524702 141
315 3300025936 Ga0207670_10053489 Ga0207670_100534892 141
316 3300025938 Ga0207704_10208235 Ga0207704_102082352 141
317 3300025938 Ga0207704_10248380 Ga0207704_102483802 141
318 3300025941 Ga0207711_10007346 Ga0207711_100073466 141
319 3300025942 Ga0207689_10070297 Ga0207689_100702973 141
320 3300025945 Ga0207679_10002815 Ga0207679_100028153 141
321 3300025949 Ga0207667_10903564 Ga0207667_109035642 141
322 3300025960 Ga0207651_10181701 Ga0207651_101817012 141
323 3300025961 Ga0207712_10001873 Ga0207712_1000187317 141
324 3300025961 Ga0207712_10403901 Ga0207712_104039012 141
325 3300025972 Ga0207668_10002152 Ga0207668_100021527 141
326 3300025981 Ga0207640_10155150 Ga0207640_101551502 141
327 3300025986 Ga0207658_10268710 Ga0207658_102687102 141
328 3300025986 Ga0207658_11563887 Ga0207658_115638872 141
329 3300026023 Ga0207677_10128264 Ga0207677_101282642 141
330 3300026035 Ga0207703_10034422 Ga0207703_100344222 141
331 3300026035 Ga0207703_10377795 Ga0207703_103777952 141
332 3300026041 Ga0207639_10050301 Ga0207639_100503012 141
333 3300026067 Ga0207678_10169621 Ga0207678_101696212 141
334 3300026067 Ga0207678_10444548 Ga0207678_104445482 141
335 3300026075 Ga0207708_10047607 Ga0207708_100476072 141
336 3300026075 Ga0207708_10069217 Ga0207708_100692173 141
337 3300026078 Ga0207702_10542847 Ga0207702_105428472 141
338 3300026088 Ga0207641_10065180 Ga0207641_100651806 141
339 3300026088 Ga0207641_10070494 Ga0207641_100704942 141
340 3300026095 Ga0207676_10052037 Ga0207676_100520371 141
341 3300026095 Ga0207676_10136792 Ga0207676_101367922 141
342 3300026116 Ga0207674_10097980 Ga0207674_100979805 141
343 3300026116 Ga0207674_10130008 Ga0207674_101300083 141
344 3300026116 Ga0207674_10170168 Ga0207674_101701683 141
345 3300026116 Ga0207674_10528265 Ga0207674_105282652 141
346 3300026118 Ga0207675_100001285 Ga0207675_10000128521 141
347 3300026121 Ga0207683_10019313 Ga0207683_100193137 141
348 3300026142 Ga0207698_10340921 Ga0207698_103409212 141
349 3300027907 Ga0207428_10037880 Ga0207428_100378806 141
350 3300027907 Ga0207428_10183615 Ga0207428_101836153 141
351 3300028379 Ga0268266_10131132 Ga0268266_101311323 141
352 3300028379 Ga0268266_11111798 Ga0268266_111117982 141
353 3300028380 Ga0268265_10000947 Ga0268265_1000094725 141
354 3300028380 Ga0268265_10081171 Ga0268265_100811712 141
355 3300028380 Ga0268265_10255278 Ga0268265_102552782 141
356 3300028380 Ga0268265_10297676 Ga0268265_102976762 141
357 3300028381 Ga0268264_11208437 Ga0268264_112084372 141
358 3300031507 Ga0307509_10275371 Ga0307509_102753712 141
359 3300031548 Ga0307408_100331520 Ga0307408_1003315202 141
360 3300031731 Ga0307405_10215764 Ga0307405_102157642 141
361 3300031731 Ga0307405_10341617 Ga0307405_103416172 141
362 3300031824 Ga0307413_10858784 Ga0307413_108587842 141
363 3300031901 Ga0307406_10619092 Ga0307406_106190921 141
364 3300031911 Ga0307412_10089607 Ga0307412_100896072 141
365 3300031911 Ga0307412_10416912 Ga0307412_104169122 141
366 3300032002 Ga0307416_100101563 Ga0307416_1001015632 141
367 3300032002 Ga0307416_100155770 Ga0307416_1001557702 141
368 3300032002 Ga0307416_100338008 Ga0307416_1003380082 141
369 3300032005 Ga0307411_10038814 Ga0307411_100388142 141
370 3300032005 Ga0307411_10632409 Ga0307411_106324091 141
371 3300032126 Ga0307415_102006430 Ga0307415_1020064301 141
372 3300035112 Ga0373932_0206023 Ga0373932_0206023_90_518 141
373 3300035112 Ga0373932_0286512 Ga0373932_0286512_132_557 141
374 3300035118 Ga0373954_0150382 Ga0373954_0150382_362_799 141
375 3300035119 Ga0373956_0082234 Ga0373956_0082234_329_832 141
376 3300035171 Ga0373946_0704071 Ga0373946_0704071_58_501 141
377 3300035691 Ga0373931_0120414 Ga0373931_0120414_896_1324 141
378 3300035724 Ga0373933_0265846 Ga0373933_0265846_553_1056 141
379 3300036401 Ga0373937_0439673 Ga0373937_0439673_680_1117 141
380 3300041406 Ga0439439_0000342 Ga0439439_0000342_2192_2674 141
381 3300041411 Ga0439466_0238771 Ga0439466_0238771_80_505 141
382 3300041413 Ga0439465_0024562 Ga0439465_0024562_116_598 141
383 3300042004 Ga0439445_0006847 Ga0439445_0006847_238_720 141
384 3300042006 Ga0439432_053968 Ga0439432_053968_10_492 141
385 3300042015 Ga0439462_0005948 Ga0439462_0005948_639_1121 141
386 3300042439 Ga0439464_0066304 Ga0439464_0066304_123_548 141
387 3300044658 Ga0466972_0020221 Ga0466972_0020221_2646_3104 141
388 3300044901 Ga0466960_0471291 Ga0466960_0471291_162_620 141
389 3300045051 Ga0451576_0040889 Ga0451576_0040889_1511_1939 141
390 3300045051 Ga0451576_0098299 Ga0451576_0098299_10_435 141
391 3300046455 Ga0495603_0504128 Ga0495603_0504128_197_625 141
392 3300046460 Ga0495638_0081818 Ga0495638_0081818_199_636 141
393 3300046472 Ga0495580_0625187 Ga0495580_0625187_218_646 141
394 3300046499 Ga0495594_0345900 Ga0495594_0345900_29_457 141
395 3300046512 Ga0495610_0031387 Ga0495610_0031387_1613_2050 141
396 3300046513 Ga0495616_0002046 Ga0495616_0002046_2449_2886 141
397 3300046530 Ga0495654_0012551 Ga0495654_0012551_335_772 141
398 3300046615 Ga0495656_0136891 Ga0495656_0136891_310_735 141
399 3300046616 Ga0495668_0125128 Ga0495668_0125128_586_1023 141
400 3300046660 Ga0495625_0143943 Ga0495625_0143943_950_1387 141
401 3300046681 Ga0495647_0324533 Ga0495647_0324533_30_458 141
402 3300048904 Ga0496101_0075829 Ga0496101_0075829_1431_1859 141
403 3300048907 Ga0496104_0199072 Ga0496104_0199072_421_855 141
404 3300048907 Ga0496104_0362008 Ga0496104_0362008_602_1027 141
405 3300048908 Ga0496105_1276202 Ga0496105_1276202_14_442 141
406 3300048909 Ga0496106_0080618 Ga0496106_0080618_1774_2199 141
407 3300048909 Ga0496106_1334540 Ga0496106_1334540_13_441 141
408 3300048911 Ga0496108_0094831 Ga0496108_0094831_1893_2321 141
409 3300048911 Ga0496108_0316911 Ga0496108_0316911_558_983 141
410 3300048912 Ga0496109_0080490 Ga0496109_0080490_122_547 141
411 3300048912 Ga0496109_0549071 Ga0496109_0549071_328_756 141
412 3300048913 Ga0496110_0516121 Ga0496110_0516121_128_553 141
413 3300048913 Ga0496110_1047006 Ga0496110_1047006_12_440 141
414 3300048914 Ga0496111_0420803 Ga0496111_0420803_449_877 141
415 3300048915 Ga0496112_0025010 Ga0496112_0025010_351_779 141
416 3300048917 Ga0496114_0003704 Ga0496114_0003704_5290_5718 141
417 3300048918 Ga0496115_1342556 Ga0496115_1342556_53_481 141
418 3300048922 Ga0496119_0120221 Ga0496119_0120221_941_1378 141
419 3300048924 Ga0496121_0476080 Ga0496121_0476080_24_461 141
420 3300048925 Ga0496122_0198427 Ga0496122_0198427_527_964 141
421 3300048926 Ga0496123_0041475 Ga0496123_0041475_81_518 141
422 3300048927 Ga0496124_0320455 Ga0496124_0320455_11_448 141
423 3300048928 Ga0496125_0115423 Ga0496125_0115423_753_1190 141
424 3300048929 Ga0496126_0082673 Ga0496126_0082673_1855_2292 141
425 3300049576 Ga0501040_0346634 Ga0501040_0346634_144_569 141
426 3300049586 Ga0501070_0155046 Ga0501070_0155046_344_775 141
427 3300050491 nmdc:mga00v17_680635_c1 nmdc:mga00v17_680635_c1_148_588 141
428 3300050507 nmdc:mga05p37_470892_c1 nmdc:mga05p37_470892_c1_672_1097 141
429 3300050511 nmdc:mga08y16_326219_c1 nmdc:mga08y16_326219_c1_193_618 141
430 3300050511 nmdc:mga08y16_970543_c1 nmdc:mga08y16_970543_c1_322_747 141
431 3300050512 nmdc:mga0n895_1714847_c1 nmdc:mga0n895_1714847_c1_52_480 141
432 3300050513 nmdc:mga0rr50_1684979_c1 nmdc:mga0rr50_1684979_c1_10_435 141
433 3300050514 nmdc:mga08x19_1002101_c1 nmdc:mga08x19_1002101_c1_129_554 141
434 3300053077 Ga0495601_0006023 Ga0495601_0006023_3799_4248 141
435 3300053077 Ga0495601_0789967 Ga0495601_0789967_32_460 141
436 3300053093 Ga0500651_0724558 Ga0500651_0724558_71_505 141
437 3300053119 Ga0500595_070000 Ga0500595_070000_295_732 141
438 3300053134 Ga0500658_0000674 Ga0500658_0000674_10278_10715 141
439 3300053139 Ga0500568_0005363 Ga0500568_0005363_2577_3014 141
440 3300053178 Ga0500637_0116388 Ga0500637_0116388_595_1023 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

4

71

0.94

PF09278

MerR-DNA-bind

MerR, DNA binding

46

105

0.89

PF00376

MerR

MerR family regulatory protein

5

41

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.8855 1 67
1jbg-assembly1.cif.gz_A-2 crystal structure of mtan, the bacillus subtilis multidrug transporter activator, n-terminus 0.8676 4 107
5i41-assembly1.cif.gz_B structure of the apo raca dna binding domain 0.8613 2 64
5c8d-assembly2.cif.gz_E crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) 0.8597 4 63
5c8d-assembly2.cif.gz_H crystal structure of full-length thermus thermophilus carh bound to adenosylcobalamin (dark state) 0.8495 1 61
ID Description Score Start End Superfamily
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9031 1 67 1.10.1660.10
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8956 2 64 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8915 2 64 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8908 2 64 1.10.1660.10
1r8dA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8878 2 107 1.10.1660.10
ID Description Score Start End GO Terms
AF-F1YW89-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9566 3 71 GO:0003677
GO:0003700
AF-A0A530M347-F1-model_v4 MerR family transcriptional regulator 0.9523 2 64 GO:0003677
GO:0003700
AF-N9K3F4-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9514 3 67 GO:0003677
GO:0003700
AF-A0A833KMK0-F1-model_v4 deleted 0.9474 1 64
AF-A4EPG8-F1-model_v4 MerR-family transcriptional regulator 0.9472 1 75 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
86.96 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map