F444411
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 440 | 258 | 436 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10023193|Ga0105247_100231933 |
| Length | 161 |
| Sequence | LFTDLKPGHHIQLEMLHISEVADMSWLVYAFVSAGAAALTAVLAKIGVEGVPSTLATAVRTVIITLFAWAITIGLKEHHALSGVSRRSLVFLVLSGLATGVSWLAYFRALQLAPASRVAPVDKLSLPLTIVLATLFLGEPLSWRLGLGVALMTAGAILTIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 4 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 5 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 157 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 158 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 159 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 160 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 161 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 203 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 204 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 205 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 227 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 237 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 238 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 250 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 252 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 253 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 254 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 255 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 256 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.09 |
| Metatranscriptomes | 0 |
| Isolates | 0.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.18 |
| Nodule | 0 |
| Rhizoplane | 0.68 |
| Rhizosphere | 93.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5261811 | 2162886012 | Unclassified | 844 |
| 2 | rootH1_10056446 | 3300003323 | Bacteria | 3824 |
| 3 | Ga0065715_10930145 | 3300005293 | Bacteria | 565 |
| 4 | Ga0070658_10183796 | 3300005327 | Bacteria | 1760 |
| 5 | Ga0070676_10012476 | 3300005328 | Bacteria | 4641 |
| 6 | Ga0070676_10624327 | 3300005328 | Unclassified | 779 |
| 7 | Ga0070677_10049851 | 3300005333 | Unclassified | 1688 |
| 8 | Ga0070677_10060727 | 3300005333 | Unclassified | 1558 |
| 9 | Ga0070677_10295822 | 3300005333 | Unclassified | 821 |
| 10 | Ga0070677_10576456 | 3300005333 | Bacteria | 620 |
| 11 | Ga0070677_10759843 | 3300005333 | Bacteria | 550 |
| 12 | Ga0068869_100000479 | 3300005334 | Bacteria | 22115 |
| 13 | Ga0068869_100025000 | 3300005334 | Bacteria | 4142 |
| 14 | Ga0068869_101670386 | 3300005334 | Unclassified | 568 |
| 15 | Ga0070666_10461304 | 3300005335 | Bacteria | 918 |
| 16 | Ga0070680_100107389 | 3300005336 | Unclassified | 2322 |
| 17 | Ga0070682_100003975 | 3300005337 | Bacteria | 8210 |
| 18 | Ga0068868_100104069 | 3300005338 | Bacteria | 2300 |
| 19 | Ga0070687_100069546 | 3300005343 | Bacteria | 1886 |
| 20 | Ga0070669_100506328 | 3300005353 | Bacteria | 1002 |
| 21 | Ga0070669_100562851 | 3300005353 | Unclassified | 951 |
| 22 | Ga0070675_100005942 | 3300005354 | Bacteria | 9351 |
| 23 | Ga0070675_100013178 | 3300005354 | Bacteria | 6496 |
| 24 | Ga0070675_100196644 | 3300005354 | Bacteria | 1749 |
| 25 | Ga0070671_100595293 | 3300005355 | Bacteria | 955 |
| 26 | Ga0070674_100050501 | 3300005356 | Bacteria | 2863 |
| 27 | Ga0070673_100004944 | 3300005364 | Bacteria | 8491 |
| 28 | Ga0070673_100139788 | 3300005364 | Unclassified | 2041 |
| 29 | Ga0070688_100341127 | 3300005365 | Bacteria | 1094 |
| 30 | Ga0070688_100544092 | 3300005365 | Unclassified | 882 |
| 31 | Ga0070667_100680644 | 3300005367 | Unclassified | 951 |
| 32 | Ga0070701_10705594 | 3300005438 | Unclassified | 679 |
| 33 | Ga0070701_10902396 | 3300005438 | Bacteria | 610 |
| 34 | Ga0070705_100295194 | 3300005440 | Unclassified | 1159 |
| 35 | Ga0070705_100446399 | 3300005440 | Unclassified | 969 |
| 36 | Ga0070700_100004859 | 3300005441 | Bacteria | 7061 |
| 37 | Ga0070694_100101079 | 3300005444 | Unclassified | 2040 |
| 38 | Ga0070708_100248413 | 3300005445 | Bacteria | 1671 |
| 39 | Ga0070663_100007672 | 3300005455 | Bacteria | 6585 |
| 40 | Ga0070663_100591721 | 3300005455 | Bacteria | 932 |
| 41 | Ga0070678_100258398 | 3300005456 | Bacteria | 1463 |
| 42 | Ga0070662_100026677 | 3300005457 | Bacteria | 4003 |
| 43 | Ga0068867_100001315 | 3300005459 | Bacteria | 17194 |
| 44 | Ga0068867_100063372 | 3300005459 | Bacteria | 2747 |
| 45 | Ga0068867_100248507 | 3300005459 | Unclassified | 1445 |
| 46 | Ga0068867_100309875 | 3300005459 | Unclassified | 1304 |
| 47 | Ga0070685_10340912 | 3300005466 | Unclassified | 1022 |
| 48 | Ga0070707_100590887 | 3300005468 | Unclassified | 1073 |
| 49 | Ga0070698_100013163 | 3300005471 | Bacteria | 8755 |
| 50 | Ga0070698_100177000 | 3300005471 | Bacteria | 2072 |
| 51 | Ga0070698_100230239 | 3300005471 | Bacteria | 1786 |
| 52 | Ga0070698_100461068 | 3300005471 | Unclassified | 1207 |
| 53 | Ga0070698_100825998 | 3300005471 | Bacteria | 871 |
| 54 | Ga0070698_101026581 | 3300005471 | Bacteria | 772 |
| 55 | Ga0070699_100036496 | 3300005518 | Bacteria | 4252 |
| 56 | Ga0070699_100157899 | 3300005518 | Bacteria | 2007 |
| 57 | Ga0070679_100063499 | 3300005530 | Bacteria | 3681 |
| 58 | Ga0070684_101213764 | 3300005535 | Unclassified | 709 |
| 59 | Ga0070697_101323899 | 3300005536 | Unclassified | 643 |
| 60 | Ga0070672_100023354 | 3300005543 | Bacteria | 4557 |
| 61 | Ga0070672_100038109 | 3300005543 | Bacteria | 3671 |
| 62 | Ga0070672_100343945 | 3300005543 | Unclassified | 1271 |
| 63 | Ga0070686_100586490 | 3300005544 | Unclassified | 876 |
| 64 | Ga0070695_100217126 | 3300005545 | Bacteria | 1376 |
| 65 | Ga0070695_100350559 | 3300005545 | Bacteria | 1106 |
| 66 | Ga0070695_101200210 | 3300005545 | Bacteria | 624 |
| 67 | Ga0070695_101514255 | 3300005545 | Unclassified | 558 |
| 68 | Ga0070696_100695993 | 3300005546 | Unclassified | 828 |
| 69 | Ga0070704_100083272 | 3300005549 | Unclassified | 2361 |
| 70 | Ga0068855_100001616 | 3300005563 | Bacteria | 28290 |
| 71 | Ga0068855_101429259 | 3300005563 | Bacteria | 712 |
| 72 | Ga0070664_100514412 | 3300005564 | Bacteria | 1104 |
| 73 | Ga0068857_100368260 | 3300005577 | Unclassified | 1333 |
| 74 | Ga0068854_100074821 | 3300005578 | Unclassified | 2485 |
| 75 | Ga0068854_100485605 | 3300005578 | Bacteria | 1038 |
| 76 | Ga0068854_101312182 | 3300005578 | Unclassified | 652 |
| 77 | Ga0070702_101303938 | 3300005615 | Unclassified | 590 |
| 78 | Ga0068859_100050250 | 3300005617 | Unclassified | 4189 |
| 79 | Ga0068859_100164104 | 3300005617 | Bacteria | 2300 |
| 80 | Ga0068859_100571173 | 3300005617 | Unclassified | 1225 |
| 81 | Ga0068859_100626139 | 3300005617 | Bacteria | 1168 |
| 82 | Ga0068864_100276598 | 3300005618 | Bacteria | 1566 |
| 83 | Ga0068866_10020520 | 3300005718 | Bacteria | 3029 |
| 84 | Ga0068866_10031308 | 3300005718 | Bacteria | 2561 |
| 85 | Ga0068866_10326106 | 3300005718 | Unclassified | 967 |
| 86 | Ga0068861_100026746 | 3300005719 | Bacteria | 4197 |
| 87 | Ga0068861_100910531 | 3300005719 | Unclassified | 833 |
| 88 | Ga0068861_102683235 | 3300005719 | Unclassified | 502 |
| 89 | Ga0068851_10188091 | 3300005834 | Bacteria | 1147 |
| 90 | Ga0068870_10109321 | 3300005840 | Unclassified | 1576 |
| 91 | Ga0068870_10147492 | 3300005840 | Unclassified | 1382 |
| 92 | Ga0068863_100068356 | 3300005841 | Bacteria | 3361 |
| 93 | Ga0068863_100354019 | 3300005841 | Bacteria | 1430 |
| 94 | Ga0068863_100447906 | 3300005841 | Bacteria | 1267 |
| 95 | Ga0068858_100063971 | 3300005842 | Bacteria | 3404 |
| 96 | Ga0068858_100103979 | 3300005842 | Bacteria | 2650 |
| 97 | Ga0068858_100113069 | 3300005842 | Bacteria | 2536 |
| 98 | Ga0068858_100197199 | 3300005842 | Unclassified | 1903 |
| 99 | Ga0068858_100966741 | 3300005842 | Unclassified | 834 |
| 100 | Ga0068860_100046431 | 3300005843 | Bacteria | 4141 |
| 101 | Ga0068860_100487655 | 3300005843 | Bacteria | 1229 |
| 102 | Ga0068860_101322174 | 3300005843 | Bacteria | 742 |
| 103 | Ga0068860_102420544 | 3300005843 | Bacteria | 545 |
| 104 | Ga0068862_100031169 | 3300005844 | Unclassified | 4498 |
| 105 | Ga0068862_100315344 | 3300005844 | Unclassified | 1442 |
| 106 | Ga0068862_100334436 | 3300005844 | Archaea | 1401 |
| 107 | Ga0068862_100949617 | 3300005844 | Unclassified | 848 |
| 108 | Ga0070717_11771893 | 3300006028 | Unclassified | 558 |
| 109 | Ga0070715_10133777 | 3300006163 | Bacteria | 1196 |
| 110 | Ga0097621_100001766 | 3300006237 | Bacteria | 14839 |
| 111 | Ga0097621_100797279 | 3300006237 | Bacteria | 875 |
| 112 | Ga0068871_100007340 | 3300006358 | Bacteria | 7867 |
| 113 | Ga0068871_101171609 | 3300006358 | Unclassified | 720 |
| 114 | Ga0075428_100000014 | 3300006844 | Bacteria | 166411 |
| 115 | Ga0075428_100815066 | 3300006844 | Unclassified | 992 |
| 116 | Ga0075430_101135656 | 3300006846 | Bacteria | 643 |
| 117 | Ga0075431_100299343 | 3300006847 | Bacteria | 1625 |
| 118 | Ga0075433_10203186 | 3300006852 | Bacteria | 1761 |
| 119 | Ga0075433_10333334 | 3300006852 | Bacteria | 1341 |
| 120 | Ga0075433_10340490 | 3300006852 | Unclassified | 1326 |
| 121 | Ga0075434_100097789 | 3300006871 | Bacteria | 2940 |
| 122 | Ga0075434_100428229 | 3300006871 | Bacteria | 1344 |
| 123 | Ga0075434_101295601 | 3300006871 | Unclassified | 739 |
| 124 | Ga0075434_102424202 | 3300006871 | Unclassified | 526 |
| 125 | Ga0068865_100000656 | 3300006881 | Bacteria | 19560 |
| 126 | Ga0068865_100039333 | 3300006881 | Bacteria | 3207 |
| 127 | Ga0068865_100139809 | 3300006881 | Bacteria | 1824 |
| 128 | Ga0075436_100089629 | 3300006914 | Unclassified | 2137 |
| 129 | Ga0097620_100050248 | 3300006931 | Unclassified | 4189 |
| 130 | Ga0097620_100164115 | 3300006931 | Bacteria | 2300 |
| 131 | Ga0097620_100571183 | 3300006931 | Unclassified | 1225 |
| 132 | Ga0097620_100626118 | 3300006931 | Bacteria | 1168 |
| 133 | Ga0075435_100593285 | 3300007076 | Unclassified | 960 |
| 134 | Ga0075435_100869295 | 3300007076 | Unclassified | 786 |
| 135 | Ga0075435_101387892 | 3300007076 | Unclassified | 616 |
| 136 | Ga0075435_101919926 | 3300007076 | Bacteria | 520 |
| 137 | Ga0111539_10000019 | 3300009094 | Bacteria | 266927 |
| 138 | Ga0111539_10223853 | 3300009094 | Bacteria | 2191 |
| 139 | Ga0105245_10410469 | 3300009098 | Bacteria | 1355 |
| 140 | Ga0105245_10947494 | 3300009098 | Unclassified | 904 |
| 141 | Ga0105247_10023193 | 3300009101 | Bacteria | 3739 |
| 142 | Ga0105247_10498383 | 3300009101 | Bacteria | 887 |
| 143 | Ga0114129_10164868 | 3300009147 | Unclassified | 3025 |
| 144 | Ga0114129_10209452 | 3300009147 | Bacteria | 2636 |
| 145 | Ga0114129_10230569 | 3300009147 | Unclassified | 2494 |
| 146 | Ga0114129_10737867 | 3300009147 | Unclassified | 1262 |
| 147 | Ga0114129_10850979 | 3300009147 | Unclassified | 1159 |
| 148 | Ga0105243_10016949 | 3300009148 | Bacteria | 5509 |
| 149 | Ga0105243_12407368 | 3300009148 | Bacteria | 565 |
| 150 | Ga0105241_11287361 | 3300009174 | Unclassified | 696 |
| 151 | Ga0105242_10165213 | 3300009176 | Bacteria | 1941 |
| 152 | Ga0105242_10597350 | 3300009176 | Unclassified | 1065 |
| 153 | Ga0105248_10090126 | 3300009177 | Bacteria | 3453 |
| 154 | Ga0105248_10091290 | 3300009177 | Bacteria | 3430 |
| 155 | Ga0105248_10668718 | 3300009177 | Bacteria | 1172 |
| 156 | Ga0105248_10809508 | 3300009177 | Bacteria | 1057 |
| 157 | Ga0105248_10868813 | 3300009177 | Unclassified | 1018 |
| 158 | Ga0105237_10066997 | 3300009545 | Bacteria | 3585 |
| 159 | Ga0105237_11096217 | 3300009545 | Unclassified | 803 |
| 160 | Ga0105238_10024553 | 3300009551 | Bacteria | 6144 |
| 161 | Ga0105238_10359914 | 3300009551 | Bacteria | 1444 |
| 162 | Ga0105249_10228523 | 3300009553 | Bacteria | 1834 |
| 163 | Ga0105249_12089497 | 3300009553 | Bacteria | 639 |
| 164 | Ga0105239_10276567 | 3300010375 | Unclassified | 1889 |
| 165 | Ga0157378_10343377 | 3300013297 | Bacteria | 1456 |
| 166 | Ga0157378_10352066 | 3300013297 | Unclassified | 1439 |
| 167 | Ga0163162_10816839 | 3300013306 | Bacteria | 1049 |
| 168 | Ga0163162_11563708 | 3300013306 | Unclassified | 752 |
| 169 | Ga0157375_10096115 | 3300013308 | Bacteria | 3035 |
| 170 | Ga0157375_11124914 | 3300013308 | Unclassified | 920 |
| 171 | Ga0157375_12900427 | 3300013308 | Unclassified | 573 |
| 172 | Ga0163163_10156320 | 3300014325 | Bacteria | 2325 |
| 173 | Ga0163163_10913543 | 3300014325 | Unclassified | 941 |
| 174 | Ga0157380_10048505 | 3300014326 | Bacteria | 3345 |
| 175 | Ga0157380_10099214 | 3300014326 | Bacteria | 2421 |
| 176 | Ga0157380_10099647 | 3300014326 | Bacteria | 2417 |
| 177 | Ga0157380_10216237 | 3300014326 | Bacteria | 1712 |
| 178 | Ga0157377_10077854 | 3300014745 | Bacteria | 1931 |
| 179 | Ga0157379_10009443 | 3300014968 | Bacteria | 8498 |
| 180 | Ga0157376_10256150 | 3300014969 | Bacteria | 1637 |
| 181 | Ga0163161_10175598 | 3300017792 | Bacteria | 1640 |
| 182 | Ga0207653_10053223 | 3300025885 | Unclassified | 1352 |
| 183 | Ga0207682_10011010 | 3300025893 | Bacteria | 3540 |
| 184 | Ga0207682_10612310 | 3300025893 | Unclassified | 513 |
| 185 | Ga0207642_10034298 | 3300025899 | Bacteria | 2157 |
| 186 | Ga0207642_10078792 | 3300025899 | Unclassified | 1593 |
| 187 | Ga0207642_10820770 | 3300025899 | Bacteria | 592 |
| 188 | Ga0207680_10206518 | 3300025903 | Bacteria | 1341 |
| 189 | Ga0207699_10816164 | 3300025906 | Bacteria | 686 |
| 190 | Ga0207645_10006720 | 3300025907 | Bacteria | 8222 |
| 191 | Ga0207645_10018540 | 3300025907 | Bacteria | 4576 |
| 192 | Ga0207643_10017840 | 3300025908 | Unclassified | 3885 |
| 193 | Ga0207643_10092160 | 3300025908 | Unclassified | 1768 |
| 194 | Ga0207684_10776282 | 3300025910 | Unclassified | 811 |
| 195 | Ga0207654_10409854 | 3300025911 | Unclassified | 944 |
| 196 | Ga0207654_10764838 | 3300025911 | Unclassified | 696 |
| 197 | Ga0207695_11635965 | 3300025913 | Bacteria | 525 |
| 198 | Ga0207671_10238405 | 3300025914 | Bacteria | 1428 |
| 199 | Ga0207671_10778749 | 3300025914 | Unclassified | 759 |
| 200 | Ga0207652_10037753 | 3300025921 | Bacteria | 4090 |
| 201 | Ga0207646_10457515 | 3300025922 | Bacteria | 1151 |
| 202 | Ga0207646_11218960 | 3300025922 | Unclassified | 659 |
| 203 | Ga0207681_10072991 | 3300025923 | Bacteria | 2399 |
| 204 | Ga0207681_10097171 | 3300025923 | Bacteria | 2116 |
| 205 | Ga0207694_10013517 | 3300025924 | Bacteria | 6150 |
| 206 | Ga0207659_10002587 | 3300025926 | Bacteria | 10780 |
| 207 | Ga0207659_10015657 | 3300025926 | Bacteria | 4921 |
| 208 | Ga0207706_10088704 | 3300025933 | Bacteria | 2719 |
| 209 | Ga0207706_10326983 | 3300025933 | Bacteria | 1334 |
| 210 | Ga0207706_10514002 | 3300025933 | Unclassified | 1033 |
| 211 | Ga0207686_10251152 | 3300025934 | Unclassified | 1292 |
| 212 | Ga0207709_10198169 | 3300025935 | Unclassified | 1432 |
| 213 | Ga0207669_10052694 | 3300025937 | Bacteria | 2446 |
| 214 | Ga0207669_10596183 | 3300025937 | Bacteria | 897 |
| 215 | Ga0207669_11118284 | 3300025937 | Unclassified | 665 |
| 216 | Ga0207704_10001153 | 3300025938 | Bacteria | 11753 |
| 217 | Ga0207704_10005959 | 3300025938 | Bacteria | 5651 |
| 218 | Ga0207704_10196014 | 3300025938 | Unclassified | 1473 |
| 219 | Ga0207691_10081698 | 3300025940 | Bacteria | 2904 |
| 220 | Ga0207691_10100194 | 3300025940 | Bacteria | 2586 |
| 221 | Ga0207691_10106164 | 3300025940 | Unclassified | 2502 |
| 222 | Ga0207689_10006551 | 3300025942 | Bacteria | 10273 |
| 223 | Ga0207667_10001645 | 3300025949 | Bacteria | 28155 |
| 224 | Ga0207667_11001536 | 3300025949 | Bacteria | 823 |
| 225 | Ga0207651_10003494 | 3300025960 | Bacteria | 7721 |
| 226 | Ga0207651_10154416 | 3300025960 | Unclassified | 1791 |
| 227 | Ga0207651_10178394 | 3300025960 | Bacteria | 1682 |
| 228 | Ga0207651_10225484 | 3300025960 | Bacteria | 1518 |
| 229 | Ga0207668_11876612 | 3300025972 | Unclassified | 540 |
| 230 | Ga0207640_10026096 | 3300025981 | Unclassified | 3543 |
| 231 | Ga0207640_10317199 | 3300025981 | Bacteria | 1239 |
| 232 | Ga0207677_10296230 | 3300026023 | Bacteria | 1334 |
| 233 | Ga0207703_10030855 | 3300026035 | Bacteria | 4236 |
| 234 | Ga0207703_10054646 | 3300026035 | Bacteria | 3248 |
| 235 | Ga0207703_10200724 | 3300026035 | Unclassified | 1772 |
| 236 | Ga0207703_10403413 | 3300026035 | Unclassified | 1269 |
| 237 | Ga0207703_10557540 | 3300026035 | Bacteria | 1081 |
| 238 | Ga0207678_10182176 | 3300026067 | Bacteria | 1794 |
| 239 | Ga0207708_10009974 | 3300026075 | Bacteria | 7055 |
| 240 | Ga0207641_10197823 | 3300026088 | Bacteria | 1851 |
| 241 | Ga0207641_10544316 | 3300026088 | Bacteria | 1131 |
| 242 | Ga0207641_12029734 | 3300026088 | Unclassified | 576 |
| 243 | Ga0207648_10001506 | 3300026089 | Bacteria | 25672 |
| 244 | Ga0207648_10006656 | 3300026089 | Bacteria | 11469 |
| 245 | Ga0207648_10211446 | 3300026089 | Unclassified | 1722 |
| 246 | Ga0207648_10623424 | 3300026089 | Unclassified | 995 |
| 247 | Ga0207648_10629698 | 3300026089 | Unclassified | 990 |
| 248 | Ga0207676_10033802 | 3300026095 | Bacteria | 3867 |
| 249 | Ga0207674_10497229 | 3300026116 | Unclassified | 1178 |
| 250 | Ga0207674_10659914 | 3300026116 | Bacteria | 1010 |
| 251 | Ga0207675_100007856 | 3300026118 | Bacteria | 10065 |
| 252 | Ga0207675_100014801 | 3300026118 | Bacteria | 7279 |
| 253 | Ga0207675_100209009 | 3300026118 | Unclassified | 1876 |
| 254 | Ga0207675_101527620 | 3300026118 | Unclassified | 688 |
| 255 | Ga0207683_10154432 | 3300026121 | Bacteria | 2073 |
| 256 | Ga0207683_10315761 | 3300026121 | Unclassified | 1431 |
| 257 | Ga0209970_1022008 | 3300027614 | Bacteria | 1081 |
| 258 | Ga0210002_1012711 | 3300027617 | Unclassified | 1310 |
| 259 | Ga0209971_1008243 | 3300027682 | Unclassified | 2471 |
| 260 | Ga0209998_10006654 | 3300027717 | Bacteria | 2398 |
| 261 | Ga0207428_10000052 | 3300027907 | Bacteria | 176270 |
| 262 | Ga0268266_10715254 | 3300028379 | Bacteria | 966 |
| 263 | Ga0268265_10017802 | 3300028380 | Unclassified | 4912 |
| 264 | Ga0268265_10362855 | 3300028380 | Bacteria | 1327 |
| 265 | Ga0268265_10446161 | 3300028380 | Unclassified | 1207 |
| 266 | Ga0268264_10085208 | 3300028381 | Bacteria | 2712 |
| 267 | Ga0268264_10402343 | 3300028381 | Bacteria | 1316 |
| 268 | Ga0268264_11057044 | 3300028381 | Bacteria | 819 |
| 269 | Ga0268264_11363564 | 3300028381 | Archaea | 719 |
| 270 | Ga0265318_10046863 | 3300028577 | Unclassified | 1631 |
| 271 | Ga0265330_10003361 | 3300031235 | Bacteria | 8390 |
| 272 | Ga0265331_10101465 | 3300031250 | Bacteria | 1324 |
| 273 | Ga0265316_10004947 | 3300031344 | Bacteria | 13100 |
| 274 | Ga0307408_101257214 | 3300031548 | Bacteria | 692 |
| 275 | Ga0307416_100170571 | 3300032002 | Bacteria | 2025 |
| 276 | Ga0307411_10042742 | 3300032005 | Unclassified | 2895 |
| 277 | Ga0373949_0141798 | 3300035090 | Bacteria | 689 |
| 278 | Ga0373954_0557040 | 3300035118 | Unclassified | 568 |
| 279 | Ga0373956_0257213 | 3300035119 | Unclassified | 830 |
| 280 | Ga0373943_0143324 | 3300035170 | Bacteria | 1289 |
| 281 | Ga0373946_0103634 | 3300035171 | Bacteria | 1279 |
| 282 | Ga0373955_0254190 | 3300035172 | Bacteria | 1054 |
| 283 | Ga0373927_0413652 | 3300035695 | Unclassified | 890 |
| 284 | Ga0373927_0640879 | 3300035695 | Unclassified | 702 |
| 285 | Ga0373947_0142330 | 3300035725 | Bacteria | 1539 |
| 286 | Ga0373937_0819190 | 3300036401 | Unclassified | 879 |
| 287 | Ga0373937_0905584 | 3300036401 | Bacteria | 831 |
| 288 | Ga0373937_1400969 | 3300036401 | Bacteria | 647 |
| 289 | Ga0395905_0207977 | 3300037471 | Bacteria | 1834 |
| 290 | Ga0436365_0745133 | 3300039437 | Unclassified | 665 |
| 291 | Ga0436365_1243498 | 3300039437 | Unclassified | 733 |
| 292 | Ga0451851_0919857 | 3300041507 | Bacteria | 570 |
| 293 | Ga0451855_0271469 | 3300041511 | Bacteria | 1700 |
| 294 | Ga0451853_0673947 | 3300041512 | Bacteria | 564 |
| 295 | Ga0451853_1532330 | 3300041512 | Unclassified | 594 |
| 296 | Ga0451577_0392063 | 3300042876 | Bacteria | 1260 |
| 297 | Ga0453683_1156922 | 3300044673 | Bacteria | 517 |
| 298 | Ga0453684_1240240 | 3300044712 | Bacteria | 781 |
| 299 | Ga0451576_0097096 | 3300045051 | Bacteria | 3064 |
| 300 | Ga0495592_0070985 | 3300046454 | Unclassified | 2536 |
| 301 | Ga0495590_0001380 | 3300046457 | Bacteria | 10544 |
| 302 | Ga0495629_0376566 | 3300046459 | Bacteria | 966 |
| 303 | Ga0495653_0230073 | 3300046463 | Bacteria | 1241 |
| 304 | Ga0495580_0030020 | 3300046472 | Unclassified | 3940 |
| 305 | Ga0495639_0030420 | 3300046475 | Bacteria | 2400 |
| 306 | Ga0495608_0007428 | 3300046511 | Bacteria | 7743 |
| 307 | Ga0495608_0052346 | 3300046511 | Bacteria | 2703 |
| 308 | Ga0495608_0562119 | 3300046511 | Bacteria | 687 |
| 309 | Ga0495616_0064529 | 3300046513 | Bacteria | 1787 |
| 310 | Ga0495628_0046322 | 3300046516 | Bacteria | 3454 |
| 311 | Ga0495628_0254690 | 3300046516 | Unclassified | 1309 |
| 312 | Ga0495630_0002332 | 3300046517 | Bacteria | 13208 |
| 313 | Ga0495630_0100319 | 3300046517 | Bacteria | 2190 |
| 314 | Ga0495631_0000959 | 3300046518 | Bacteria | 17978 |
| 315 | Ga0495632_0065068 | 3300046519 | Bacteria | 1762 |
| 316 | Ga0495637_0061753 | 3300046520 | Bacteria | 1535 |
| 317 | Ga0495648_0001204 | 3300046524 | Bacteria | 25917 |
| 318 | Ga0495652_0280253 | 3300046529 | Bacteria | 1221 |
| 319 | Ga0495587_0137343 | 3300046536 | Bacteria | 1396 |
| 320 | Ga0495598_0230498 | 3300046537 | Bacteria | 679 |
| 321 | Ga0495645_0015700 | 3300046543 | Bacteria | 5389 |
| 322 | Ga0495645_0051538 | 3300046543 | Bacteria | 2994 |
| 323 | Ga0495667_0153925 | 3300046559 | Bacteria | 1480 |
| 324 | Ga0495668_0001975 | 3300046616 | Bacteria | 17991 |
| 325 | Ga0495635_0768723 | 3300046663 | Unclassified | 622 |
| 326 | Ga0495588_0015439 | 3300046674 | Bacteria | 3675 |
| 327 | Ga0495588_0449803 | 3300046674 | Bacteria | 676 |
| 328 | Ga0495657_0059434 | 3300046675 | Bacteria | 2536 |
| 329 | Ga0495658_0273454 | 3300046683 | Bacteria | 1065 |
| 330 | Ga0495613_0003284 | 3300046689 | Bacteria | 12096 |
| 331 | Ga0495624_0003185 | 3300046690 | Bacteria | 12218 |
| 332 | Ga0495581_0013350 | 3300047315 | Unclassified | 4763 |
| 333 | Ga0495604_0046402 | 3300047317 | Bacteria | 3387 |
| 334 | Ga0495604_0265532 | 3300047317 | Unclassified | 1165 |
| 335 | Ga0495674_0006880 | 3300047319 | Bacteria | 10879 |
| 336 | Ga0495674_0028422 | 3300047319 | Bacteria | 5098 |
| 337 | Ga0495674_0096285 | 3300047319 | Bacteria | 2523 |
| 338 | Ga0495674_1114024 | 3300047319 | Bacteria | 600 |
| 339 | Ga0495676_0110652 | 3300047321 | Bacteria | 2016 |
| 340 | Ga0495680_0092576 | 3300047322 | Bacteria | 2264 |
| 341 | Ga0495675_0126203 | 3300047444 | Unclassified | 1592 |
| 342 | Ga0495673_0000467 | 3300047469 | Bacteria | 43912 |
| 343 | Ga0495684_0001201 | 3300047471 | Bacteria | 20851 |
| 344 | Ga0495684_0001466 | 3300047471 | Bacteria | 18891 |
| 345 | Ga0495686_0004684 | 3300047472 | Bacteria | 11102 |
| 346 | Ga0496102_0874169 | 3300048905 | Bacteria | 821 |
| 347 | Ga0496104_0091509 | 3300048907 | Archaea | 2908 |
| 348 | Ga0496114_0635375 | 3300048917 | Bacteria | 940 |
| 349 | Ga0496124_0324714 | 3300048927 | Bacteria | 1100 |
| 350 | Ga0496125_0028483 | 3300048928 | Bacteria | 5044 |
| 351 | Ga0496126_0027785 | 3300048929 | Bacteria | 5398 |
| 352 | Ga0501032_0003486 | 3300049569 | Bacteria | 12028 |
| 353 | Ga0501032_0057117 | 3300049569 | Bacteria | 2622 |
| 354 | Ga0501033_0001449 | 3300049570 | Bacteria | 21032 |
| 355 | Ga0501033_0055195 | 3300049570 | Bacteria | 2937 |
| 356 | Ga0501034_0009066 | 3300049571 | Bacteria | 10448 |
| 357 | Ga0501034_0595281 | 3300049571 | Bacteria | 1012 |
| 358 | Ga0501036_0039160 | 3300049572 | Bacteria | 4013 |
| 359 | Ga0501037_0004510 | 3300049573 | Bacteria | 10117 |
| 360 | Ga0501037_0181849 | 3300049573 | Unclassified | 1491 |
| 361 | Ga0501038_0004235 | 3300049574 | Bacteria | 13333 |
| 362 | Ga0501038_0041841 | 3300049574 | Bacteria | 3994 |
| 363 | Ga0501039_0129100 | 3300049575 | Bacteria | 1983 |
| 364 | Ga0501040_0038360 | 3300049576 | Bacteria | 3257 |
| 365 | Ga0501042_0161797 | 3300049578 | Bacteria | 1615 |
| 366 | Ga0501043_0026437 | 3300049579 | Bacteria | 4553 |
| 367 | Ga0501043_0121734 | 3300049579 | Unclassified | 2046 |
| 368 | Ga0501046_0001361 | 3300049580 | Bacteria | 23624 |
| 369 | Ga0501046_0293983 | 3300049580 | Bacteria | 1187 |
| 370 | Ga0501047_0004167 | 3300049581 | Bacteria | 13604 |
| 371 | Ga0501047_0203183 | 3300049581 | Bacteria | 1841 |
| 372 | Ga0501047_0361813 | 3300049581 | Bacteria | 1286 |
| 373 | Ga0501048_0000445 | 3300049582 | Bacteria | 29088 |
| 374 | Ga0501048_0054766 | 3300049582 | Bacteria | 2833 |
| 375 | Ga0501067_0020194 | 3300049583 | Bacteria | 3685 |
| 376 | Ga0501068_0004738 | 3300049584 | Bacteria | 7396 |
| 377 | Ga0501068_0020014 | 3300049584 | Bacteria | 3894 |
| 378 | Ga0501069_0014170 | 3300049585 | Bacteria | 4258 |
| 379 | Ga0501070_0004493 | 3300049586 | Bacteria | 11975 |
| 380 | Ga0501070_0098462 | 3300049586 | Bacteria | 2419 |
| 381 | Ga0501070_0158462 | 3300049586 | Bacteria | 1866 |
| 382 | Ga0501070_0957478 | 3300049586 | Bacteria | 665 |
| 383 | Ga0501071_0147514 | 3300049587 | Bacteria | 1754 |
| 384 | Ga0501071_0882567 | 3300049587 | Bacteria | 690 |
| 385 | Ga0501072_0177375 | 3300049588 | Bacteria | 1699 |
| 386 | Ga0501072_1425306 | 3300049588 | Bacteria | 535 |
| 387 | Ga0501073_0031493 | 3300049589 | Bacteria | 3783 |
| 388 | Ga0501073_0233413 | 3300049589 | Bacteria | 1270 |
| 389 | Ga0501074_0039866 | 3300049590 | Bacteria | 3401 |
| 390 | Ga0501074_0075915 | 3300049590 | Bacteria | 2412 |
| 391 | Ga0501221_118166 | 3300049704 | Unclassified | 675 |
| 392 | Ga0501245_079245 | 3300049708 | Bacteria | 632 |
| 393 | Ga0501079_0142864 | 3300049741 | Unclassified | 1864 |
| 394 | Ga0501079_0431508 | 3300049741 | Bacteria | 1034 |
| 395 | Ga0501080_0003186 | 3300049742 | Bacteria | 14469 |
| 396 | Ga0501080_1771115 | 3300049742 | Bacteria | 519 |
| 397 | Ga0501081_1195984 | 3300049743 | Bacteria | 576 |
| 398 | Ga0501083_0063038 | 3300049744 | Bacteria | 2472 |
| 399 | Ga0501283_035813 | 3300049779 | Unclassified | 846 |
| 400 | Ga0501035_0008847 | 3300049822 | Bacteria | 9369 |
| 401 | Ga0501035_0108590 | 3300049822 | Bacteria | 2432 |
| 402 | Ga0501044_0055671 | 3300049823 | Bacteria | 4061 |
| 403 | Ga0501045_0050854 | 3300049824 | Bacteria | 3024 |
| 404 | nmdc:mga0k408_939095_c1 | 3300050493 | Bacteria | 501 |
| 405 | nmdc:mga06z11_104358_c1 | 3300050494 | Bacteria | 1560 |
| 406 | nmdc:mga04h51_130584_c1 | 3300050495 | Bacteria | 944 |
| 407 | nmdc:mga05p37_1335142_c1 | 3300050507 | Unclassified | 728 |
| 408 | nmdc:mga05p37_58120_c1 | 3300050507 | Bacteria | 4763 |
| 409 | nmdc:mga05p37_75932_c1 | 3300050507 | Unclassified | 4137 |
| 410 | nmdc:mga06r32_952268_c1 | 3300050510 | Unclassified | 813 |
| 411 | nmdc:mga08y16_14_c1 | 3300050511 | Bacteria | 398067 |
| 412 | nmdc:mga0n895_1176012_c1 | 3300050512 | Unclassified | 742 |
| 413 | nmdc:mga0n895_1232157_c1 | 3300050512 | Unclassified | 721 |
| 414 | nmdc:mga0rr50_1102507_c1 | 3300050513 | Unclassified | 675 |
| 415 | nmdc:mga0rr50_878136_c1 | 3300050513 | Unclassified | 765 |
| 416 | nmdc:mga08x19_39459_c1 | 3300050514 | Bacteria | 3002 |
| 417 | nmdc:mga0a205_297280_c1 | 3300050515 | Unclassified | 1488 |
| 418 | nmdc:mga0a205_37348_c1 | 3300050515 | Bacteria | 4671 |
| 419 | Ga0495601_0013185 | 3300053077 | Bacteria | 4970 |
| 420 | Ga0495595_0467145 | 3300053084 | Bacteria | 642 |
| 421 | Ga0495619_0001983 | 3300053085 | Bacteria | 13623 |
| 422 | Ga0495619_0243682 | 3300053085 | Bacteria | 1245 |
| 423 | Ga0500643_059715 | 3300053087 | Bacteria | 1072 |
| 424 | Ga0500644_0000232 | 3300053088 | Bacteria | 31501 |
| 425 | Ga0500583_0000312 | 3300053092 | Bacteria | 16626 |
| 426 | Ga0500583_0056715 | 3300053092 | Bacteria | 1836 |
| 427 | Ga0500641_0004693 | 3300053096 | Bacteria | 4831 |
| 428 | Ga0500641_0024205 | 3300053096 | Bacteria | 2340 |
| 429 | Ga0500641_0045618 | 3300053096 | Unclassified | 1786 |
| 430 | Ga0500562_009930 | 3300053108 | Bacteria | 2407 |
| 431 | Ga0500564_000067 | 3300053138 | Bacteria | 27553 |
| 432 | Ga0500622_0003240 | 3300053156 | Bacteria | 11059 |
| 433 | Ga0501084_0111896 | 3300054114 | Bacteria | 2294 |
| 434 | Ga0500661_088333 | 3300055283 | Bacteria | 580 |
| 435 | Ga0501082_0172154 | 3300060353 | Unclassified | 1882 |
| 436 | Ga0501082_0368206 | 3300060353 | Unclassified | 1253 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005578 | Ga0068854_101312182 | Ga0068854_1013121821 | 93 |
| 2 | 3300037471 | Ga0395905_0207977 | Ga0395905_0207977_400_882 | 96 |
| 3 | 3300005844 | Ga0068862_100949617 | Ga0068862_1009496172 | 116 |
| 4 | 3300028380 | Ga0268265_10362855 | Ga0268265_103628552 | 116 |
| 5 | 3300005471 | Ga0070698_100461068 | Ga0070698_1004610682 | 121 |
| 6 | 3300005337 | Ga0070682_100003975 | Ga0070682_1000039753 | 130 |
| 7 | 3300041512 | Ga0451853_0673947 | Ga0451853_0673947_15_464 | 130 |
| 8 | 3300049586 | Ga0501070_0957478 | Ga0501070_0957478_10_405 | 130 |
| 9 | 3300013297 | Ga0157378_10352066 | Ga0157378_103520663 | 131 |
| 10 | iso_pu_bacteria | 2582581279 | 2585148822 | 133 |
| 11 | iso_pu_bacteria | 2889415604 | 2889418019 | 134 |
| 12 | iso_pu_bacteria | 2920107658 | 2920109735 | 134 |
| 13 | 3300005327 | Ga0070658_10183796 | Ga0070658_101837961 | 135 |
| 14 | 3300005535 | Ga0070684_101213764 | Ga0070684_1012137642 | 135 |
| 15 | 3300005843 | Ga0068860_100487655 | Ga0068860_1004876552 | 135 |
| 16 | 3300005844 | Ga0068862_100334436 | Ga0068862_1003344362 | 135 |
| 17 | 3300007076 | Ga0075435_101919926 | Ga0075435_1019199261 | 135 |
| 18 | 3300009174 | Ga0105241_11287361 | Ga0105241_112873611 | 135 |
| 19 | 3300009177 | Ga0105248_10809508 | Ga0105248_108095082 | 135 |
| 20 | 3300009545 | Ga0105237_11096217 | Ga0105237_110962171 | 135 |
| 21 | 3300010375 | Ga0105239_10276567 | Ga0105239_102765672 | 135 |
| 22 | 3300013306 | Ga0163162_11563708 | Ga0163162_115637083 | 135 |
| 23 | 3300025911 | Ga0207654_10409854 | Ga0207654_104098541 | 135 |
| 24 | 3300025911 | Ga0207654_10764838 | Ga0207654_107648381 | 135 |
| 25 | 3300025914 | Ga0207671_10778749 | Ga0207671_107787491 | 135 |
| 26 | 3300028381 | Ga0268264_10402343 | Ga0268264_104023432 | 135 |
| 27 | 3300035695 | Ga0373927_0640879 | Ga0373927_0640879_54_488 | 135 |
| 28 | 3300046457 | Ga0495590_0001380 | Ga0495590_0001380_1172_1612 | 135 |
| 29 | 3300046463 | Ga0495653_0230073 | Ga0495653_0230073_225_659 | 135 |
| 30 | 3300046472 | Ga0495580_0030020 | Ga0495580_0030020_1882_2316 | 135 |
| 31 | 3300046475 | Ga0495639_0030420 | Ga0495639_0030420_1065_1499 | 135 |
| 32 | 3300046511 | Ga0495608_0052346 | Ga0495608_0052346_1131_1565 | 135 |
| 33 | 3300046513 | Ga0495616_0064529 | Ga0495616_0064529_912_1352 | 135 |
| 34 | 3300046517 | Ga0495630_0100319 | Ga0495630_0100319_1443_1877 | 135 |
| 35 | 3300046518 | Ga0495631_0000959 | Ga0495631_0000959_2480_2920 | 135 |
| 36 | 3300046520 | Ga0495637_0061753 | Ga0495637_0061753_438_878 | 135 |
| 37 | 3300046524 | Ga0495648_0001204 | Ga0495648_0001204_2700_3140 | 135 |
| 38 | 3300046616 | Ga0495668_0001975 | Ga0495668_0001975_8836_9276 | 135 |
| 39 | 3300046663 | Ga0495635_0768723 | Ga0495635_0768723_152_586 | 135 |
| 40 | 3300046690 | Ga0495624_0003185 | Ga0495624_0003185_10510_10944 | 135 |
| 41 | 3300047315 | Ga0495581_0013350 | Ga0495581_0013350_2444_2878 | 135 |
| 42 | 3300047319 | Ga0495674_0006880 | Ga0495674_0006880_6835_7269 | 135 |
| 43 | 3300047321 | Ga0495676_0110652 | Ga0495676_0110652_1272_1706 | 135 |
| 44 | 3300047444 | Ga0495675_0126203 | Ga0495675_0126203_1001_1435 | 135 |
| 45 | 3300047469 | Ga0495673_0000467 | Ga0495673_0000467_22149_22589 | 135 |
| 46 | 3300047471 | Ga0495684_0001201 | Ga0495684_0001201_14658_15092 | 135 |
| 47 | 3300047472 | Ga0495686_0004684 | Ga0495686_0004684_1320_1760 | 135 |
| 48 | 3300048927 | Ga0496124_0324714 | Ga0496124_0324714_602_1042 | 135 |
| 49 | 3300048928 | Ga0496125_0028483 | Ga0496125_0028483_1845_2285 | 135 |
| 50 | 3300048929 | Ga0496126_0027785 | Ga0496126_0027785_2846_3286 | 135 |
| 51 | 3300049581 | Ga0501047_0203183 | Ga0501047_0203183_568_1005 | 135 |
| 52 | 3300050514 | nmdc:mga08x19_39459_c1 | nmdc:mga08x19_39459_c1_744_1151 | 135 |
| 53 | 3300053087 | Ga0500643_059715 | Ga0500643_059715_218_658 | 135 |
| 54 | 3300053088 | Ga0500644_0000232 | Ga0500644_0000232_4387_4827 | 135 |
| 55 | 3300053096 | Ga0500641_0024205 | Ga0500641_0024205_1845_2285 | 135 |
| 56 | 3300053108 | Ga0500562_009930 | Ga0500562_009930_587_1027 | 135 |
| 57 | 3300053138 | Ga0500564_000067 | Ga0500564_000067_22730_23170 | 135 |
| 58 | 3300053156 | Ga0500622_0003240 | Ga0500622_0003240_1468_1908 | 135 |
| 59 | 3300055283 | Ga0500661_088333 | Ga0500661_088333_46_486 | 135 |
| 60 | 3300005334 | Ga0068869_101670386 | Ga0068869_1016703861 | 137 |
| 61 | 3300005355 | Ga0070671_100595293 | Ga0070671_1005952932 | 137 |
| 62 | 3300005364 | Ga0070673_100139788 | Ga0070673_1001397883 | 137 |
| 63 | 3300006358 | Ga0068871_101171609 | Ga0068871_1011716091 | 137 |
| 64 | 3300009176 | Ga0105242_10165213 | Ga0105242_101652131 | 137 |
| 65 | 3300013308 | Ga0157375_12900427 | Ga0157375_129004271 | 137 |
| 66 | 3300025960 | Ga0207651_10225484 | Ga0207651_102254842 | 137 |
| 67 | iso_pu_bacteria | 2687453257 | 2688070300 | 137 |
| 68 | 2162886012 | MBSR1b_contig_5261811 | MBSR1b_0417.00004310 | 138 |
| 69 | 3300003323 | rootH1_10056446 | rootH1_100564464 | 138 |
| 70 | 3300005293 | Ga0065715_10930145 | Ga0065715_109301451 | 138 |
| 71 | 3300005328 | Ga0070676_10012476 | Ga0070676_100124762 | 138 |
| 72 | 3300005328 | Ga0070676_10624327 | Ga0070676_106243272 | 138 |
| 73 | 3300005333 | Ga0070677_10049851 | Ga0070677_100498512 | 138 |
| 74 | 3300005333 | Ga0070677_10060727 | Ga0070677_100607273 | 138 |
| 75 | 3300005333 | Ga0070677_10295822 | Ga0070677_102958221 | 138 |
| 76 | 3300005333 | Ga0070677_10576456 | Ga0070677_105764561 | 138 |
| 77 | 3300005333 | Ga0070677_10759843 | Ga0070677_107598431 | 138 |
| 78 | 3300005334 | Ga0068869_100000479 | Ga0068869_1000004796 | 138 |
| 79 | 3300005334 | Ga0068869_100025000 | Ga0068869_1000250002 | 138 |
| 80 | 3300005335 | Ga0070666_10461304 | Ga0070666_104613041 | 138 |
| 81 | 3300005336 | Ga0070680_100107389 | Ga0070680_1001073894 | 138 |
| 82 | 3300005338 | Ga0068868_100104069 | Ga0068868_1001040693 | 138 |
| 83 | 3300005343 | Ga0070687_100069546 | Ga0070687_1000695462 | 138 |
| 84 | 3300005353 | Ga0070669_100506328 | Ga0070669_1005063282 | 138 |
| 85 | 3300005353 | Ga0070669_100562851 | Ga0070669_1005628512 | 138 |
| 86 | 3300005354 | Ga0070675_100005942 | Ga0070675_10000594210 | 138 |
| 87 | 3300005354 | Ga0070675_100013178 | Ga0070675_1000131782 | 138 |
| 88 | 3300005354 | Ga0070675_100196644 | Ga0070675_1001966442 | 138 |
| 89 | 3300005356 | Ga0070674_100050501 | Ga0070674_1000505012 | 138 |
| 90 | 3300005364 | Ga0070673_100004944 | Ga0070673_10000494410 | 138 |
| 91 | 3300005365 | Ga0070688_100341127 | Ga0070688_1003411272 | 138 |
| 92 | 3300005365 | Ga0070688_100544092 | Ga0070688_1005440922 | 138 |
| 93 | 3300005367 | Ga0070667_100680644 | Ga0070667_1006806441 | 138 |
| 94 | 3300005438 | Ga0070701_10705594 | Ga0070701_107055941 | 138 |
| 95 | 3300005438 | Ga0070701_10902396 | Ga0070701_109023961 | 138 |
| 96 | 3300005440 | Ga0070705_100295194 | Ga0070705_1002951942 | 138 |
| 97 | 3300005440 | Ga0070705_100446399 | Ga0070705_1004463992 | 138 |
| 98 | 3300005441 | Ga0070700_100004859 | Ga0070700_1000048593 | 138 |
| 99 | 3300005444 | Ga0070694_100101079 | Ga0070694_1001010793 | 138 |
| 100 | 3300005445 | Ga0070708_100248413 | Ga0070708_1002484133 | 138 |
| 101 | 3300005455 | Ga0070663_100007672 | Ga0070663_1000076722 | 138 |
| 102 | 3300005455 | Ga0070663_100591721 | Ga0070663_1005917212 | 138 |
| 103 | 3300005456 | Ga0070678_100258398 | Ga0070678_1002583982 | 138 |
| 104 | 3300005457 | Ga0070662_100026677 | Ga0070662_1000266772 | 138 |
| 105 | 3300005459 | Ga0068867_100001315 | Ga0068867_10000131518 | 138 |
| 106 | 3300005459 | Ga0068867_100063372 | Ga0068867_1000633723 | 138 |
| 107 | 3300005459 | Ga0068867_100248507 | Ga0068867_1002485072 | 138 |
| 108 | 3300005459 | Ga0068867_100309875 | Ga0068867_1003098753 | 138 |
| 109 | 3300005466 | Ga0070685_10340912 | Ga0070685_103409122 | 138 |
| 110 | 3300005468 | Ga0070707_100590887 | Ga0070707_1005908872 | 138 |
| 111 | 3300005471 | Ga0070698_100013163 | Ga0070698_1000131633 | 138 |
| 112 | 3300005471 | Ga0070698_100177000 | Ga0070698_1001770002 | 138 |
| 113 | 3300005471 | Ga0070698_100230239 | Ga0070698_1002302392 | 138 |
| 114 | 3300005471 | Ga0070698_100825998 | Ga0070698_1008259982 | 138 |
| 115 | 3300005471 | Ga0070698_101026581 | Ga0070698_1010265812 | 138 |
| 116 | 3300005518 | Ga0070699_100036496 | Ga0070699_1000364964 | 138 |
| 117 | 3300005518 | Ga0070699_100157899 | Ga0070699_1001578993 | 138 |
| 118 | 3300005530 | Ga0070679_100063499 | Ga0070679_1000634991 | 138 |
| 119 | 3300005536 | Ga0070697_101323899 | Ga0070697_1013238991 | 138 |
| 120 | 3300005543 | Ga0070672_100023354 | Ga0070672_1000233545 | 138 |
| 121 | 3300005543 | Ga0070672_100038109 | Ga0070672_1000381093 | 138 |
| 122 | 3300005543 | Ga0070672_100343945 | Ga0070672_1003439452 | 138 |
| 123 | 3300005544 | Ga0070686_100586490 | Ga0070686_1005864901 | 138 |
| 124 | 3300005545 | Ga0070695_100217126 | Ga0070695_1002171262 | 138 |
| 125 | 3300005545 | Ga0070695_100350559 | Ga0070695_1003505591 | 138 |
| 126 | 3300005545 | Ga0070695_101200210 | Ga0070695_1012002101 | 138 |
| 127 | 3300005545 | Ga0070695_101514255 | Ga0070695_1015142551 | 138 |
| 128 | 3300005546 | Ga0070696_100695993 | Ga0070696_1006959931 | 138 |
| 129 | 3300005549 | Ga0070704_100083272 | Ga0070704_1000832722 | 138 |
| 130 | 3300005563 | Ga0068855_100001616 | Ga0068855_10000161611 | 138 |
| 131 | 3300005563 | Ga0068855_101429259 | Ga0068855_1014292591 | 138 |
| 132 | 3300005564 | Ga0070664_100514412 | Ga0070664_1005144121 | 138 |
| 133 | 3300005577 | Ga0068857_100368260 | Ga0068857_1003682602 | 138 |
| 134 | 3300005578 | Ga0068854_100074821 | Ga0068854_1000748212 | 138 |
| 135 | 3300005578 | Ga0068854_100485605 | Ga0068854_1004856052 | 138 |
| 136 | 3300005615 | Ga0070702_101303938 | Ga0070702_1013039381 | 138 |
| 137 | 3300005617 | Ga0068859_100050250 | Ga0068859_1000502502 | 138 |
| 138 | 3300005617 | Ga0068859_100164104 | Ga0068859_1001641044 | 138 |
| 139 | 3300005617 | Ga0068859_100571173 | Ga0068859_1005711732 | 138 |
| 140 | 3300005617 | Ga0068859_100626139 | Ga0068859_1006261393 | 138 |
| 141 | 3300005618 | Ga0068864_100276598 | Ga0068864_1002765982 | 138 |
| 142 | 3300005718 | Ga0068866_10020520 | Ga0068866_100205202 | 138 |
| 143 | 3300005718 | Ga0068866_10031308 | Ga0068866_100313082 | 138 |
| 144 | 3300005718 | Ga0068866_10326106 | Ga0068866_103261061 | 138 |
| 145 | 3300005719 | Ga0068861_100026746 | Ga0068861_1000267465 | 138 |
| 146 | 3300005719 | Ga0068861_100910531 | Ga0068861_1009105312 | 138 |
| 147 | 3300005719 | Ga0068861_102683235 | Ga0068861_1026832351 | 138 |
| 148 | 3300005834 | Ga0068851_10188091 | Ga0068851_101880912 | 138 |
| 149 | 3300005840 | Ga0068870_10109321 | Ga0068870_101093213 | 138 |
| 150 | 3300005840 | Ga0068870_10147492 | Ga0068870_101474922 | 138 |
| 151 | 3300005841 | Ga0068863_100068356 | Ga0068863_1000683562 | 138 |
| 152 | 3300005841 | Ga0068863_100354019 | Ga0068863_1003540193 | 138 |
| 153 | 3300005841 | Ga0068863_100447906 | Ga0068863_1004479062 | 138 |
| 154 | 3300005842 | Ga0068858_100063971 | Ga0068858_1000639712 | 138 |
| 155 | 3300005842 | Ga0068858_100103979 | Ga0068858_1001039793 | 138 |
| 156 | 3300005842 | Ga0068858_100113069 | Ga0068858_1001130692 | 138 |
| 157 | 3300005842 | Ga0068858_100197199 | Ga0068858_1001971992 | 138 |
| 158 | 3300005842 | Ga0068858_100966741 | Ga0068858_1009667412 | 138 |
| 159 | 3300005843 | Ga0068860_100046431 | Ga0068860_1000464312 | 138 |
| 160 | 3300005843 | Ga0068860_101322174 | Ga0068860_1013221742 | 138 |
| 161 | 3300005843 | Ga0068860_102420544 | Ga0068860_1024205442 | 138 |
| 162 | 3300005844 | Ga0068862_100031169 | Ga0068862_1000311695 | 138 |
| 163 | 3300005844 | Ga0068862_100315344 | Ga0068862_1003153442 | 138 |
| 164 | 3300006028 | Ga0070717_11771893 | Ga0070717_117718932 | 138 |
| 165 | 3300006163 | Ga0070715_10133777 | Ga0070715_101337772 | 138 |
| 166 | 3300006237 | Ga0097621_100001766 | Ga0097621_1000017669 | 138 |
| 167 | 3300006237 | Ga0097621_100797279 | Ga0097621_1007972792 | 138 |
| 168 | 3300006358 | Ga0068871_100007340 | Ga0068871_1000073403 | 138 |
| 169 | 3300006844 | Ga0075428_100000014 | Ga0075428_10000001466 | 138 |
| 170 | 3300006844 | Ga0075428_100815066 | Ga0075428_1008150662 | 138 |
| 171 | 3300006846 | Ga0075430_101135656 | Ga0075430_1011356562 | 138 |
| 172 | 3300006847 | Ga0075431_100299343 | Ga0075431_1002993432 | 138 |
| 173 | 3300006852 | Ga0075433_10203186 | Ga0075433_102031862 | 138 |
| 174 | 3300006852 | Ga0075433_10333334 | Ga0075433_103333342 | 138 |
| 175 | 3300006852 | Ga0075433_10340490 | Ga0075433_103404902 | 138 |
| 176 | 3300006871 | Ga0075434_100097789 | Ga0075434_1000977894 | 138 |
| 177 | 3300006871 | Ga0075434_100428229 | Ga0075434_1004282292 | 138 |
| 178 | 3300006871 | Ga0075434_101295601 | Ga0075434_1012956011 | 138 |
| 179 | 3300006871 | Ga0075434_102424202 | Ga0075434_1024242021 | 138 |
| 180 | 3300006881 | Ga0068865_100000656 | Ga0068865_1000006565 | 138 |
| 181 | 3300006881 | Ga0068865_100039333 | Ga0068865_1000393332 | 138 |
| 182 | 3300006881 | Ga0068865_100139809 | Ga0068865_1001398092 | 138 |
| 183 | 3300006914 | Ga0075436_100089629 | Ga0075436_1000896293 | 138 |
| 184 | 3300006931 | Ga0097620_100050248 | Ga0097620_1000502482 | 138 |
| 185 | 3300006931 | Ga0097620_100164115 | Ga0097620_1001641154 | 138 |
| 186 | 3300006931 | Ga0097620_100571183 | Ga0097620_1005711832 | 138 |
| 187 | 3300006931 | Ga0097620_100626118 | Ga0097620_1006261183 | 138 |
| 188 | 3300007076 | Ga0075435_100593285 | Ga0075435_1005932852 | 138 |
| 189 | 3300007076 | Ga0075435_100869295 | Ga0075435_1008692952 | 138 |
| 190 | 3300007076 | Ga0075435_101387892 | Ga0075435_1013878922 | 138 |
| 191 | 3300009094 | Ga0111539_10000019 | Ga0111539_1000001944 | 138 |
| 192 | 3300009094 | Ga0111539_10223853 | Ga0111539_102238534 | 138 |
| 193 | 3300009098 | Ga0105245_10410469 | Ga0105245_104104692 | 138 |
| 194 | 3300009098 | Ga0105245_10947494 | Ga0105245_109474942 | 138 |
| 195 | 3300009101 | Ga0105247_10023193 | Ga0105247_100231933 | 138 |
| 196 | 3300009101 | Ga0105247_10498383 | Ga0105247_104983832 | 138 |
| 197 | 3300009147 | Ga0114129_10164868 | Ga0114129_101648684 | 138 |
| 198 | 3300009147 | Ga0114129_10209452 | Ga0114129_102094524 | 138 |
| 199 | 3300009147 | Ga0114129_10230569 | Ga0114129_102305694 | 138 |
| 200 | 3300009147 | Ga0114129_10737867 | Ga0114129_107378673 | 138 |
| 201 | 3300009147 | Ga0114129_10850979 | Ga0114129_108509793 | 138 |
| 202 | 3300009148 | Ga0105243_10016949 | Ga0105243_100169497 | 138 |
| 203 | 3300009148 | Ga0105243_12407368 | Ga0105243_124073681 | 138 |
| 204 | 3300009176 | Ga0105242_10597350 | Ga0105242_105973502 | 138 |
| 205 | 3300009177 | Ga0105248_10090126 | Ga0105248_100901264 | 138 |
| 206 | 3300009177 | Ga0105248_10091290 | Ga0105248_100912901 | 138 |
| 207 | 3300009177 | Ga0105248_10668718 | Ga0105248_106687181 | 138 |
| 208 | 3300009177 | Ga0105248_10868813 | Ga0105248_108688132 | 138 |
| 209 | 3300009545 | Ga0105237_10066997 | Ga0105237_100669973 | 138 |
| 210 | 3300009551 | Ga0105238_10024553 | Ga0105238_100245534 | 138 |
| 211 | 3300009551 | Ga0105238_10359914 | Ga0105238_103599142 | 138 |
| 212 | 3300009553 | Ga0105249_10228523 | Ga0105249_102285232 | 138 |
| 213 | 3300009553 | Ga0105249_12089497 | Ga0105249_120894972 | 138 |
| 214 | 3300013297 | Ga0157378_10343377 | Ga0157378_103433771 | 138 |
| 215 | 3300013306 | Ga0163162_10816839 | Ga0163162_108168391 | 138 |
| 216 | 3300013308 | Ga0157375_10096115 | Ga0157375_100961154 | 138 |
| 217 | 3300013308 | Ga0157375_11124914 | Ga0157375_111249142 | 138 |
| 218 | 3300014325 | Ga0163163_10156320 | Ga0163163_101563202 | 138 |
| 219 | 3300014325 | Ga0163163_10913543 | Ga0163163_109135432 | 138 |
| 220 | 3300014326 | Ga0157380_10048505 | Ga0157380_100485053 | 138 |
| 221 | 3300014326 | Ga0157380_10099214 | Ga0157380_100992144 | 138 |
| 222 | 3300014326 | Ga0157380_10099647 | Ga0157380_100996472 | 138 |
| 223 | 3300014326 | Ga0157380_10216237 | Ga0157380_102162372 | 138 |
| 224 | 3300014745 | Ga0157377_10077854 | Ga0157377_100778542 | 138 |
| 225 | 3300014968 | Ga0157379_10009443 | Ga0157379_100094433 | 138 |
| 226 | 3300014969 | Ga0157376_10256150 | Ga0157376_102561502 | 138 |
| 227 | 3300017792 | Ga0163161_10175598 | Ga0163161_101755982 | 138 |
| 228 | 3300025885 | Ga0207653_10053223 | Ga0207653_100532231 | 138 |
| 229 | 3300025893 | Ga0207682_10011010 | Ga0207682_100110102 | 138 |
| 230 | 3300025893 | Ga0207682_10612310 | Ga0207682_106123101 | 138 |
| 231 | 3300025899 | Ga0207642_10034298 | Ga0207642_100342983 | 138 |
| 232 | 3300025899 | Ga0207642_10078792 | Ga0207642_100787921 | 138 |
| 233 | 3300025899 | Ga0207642_10820770 | Ga0207642_108207701 | 138 |
| 234 | 3300025903 | Ga0207680_10206518 | Ga0207680_102065182 | 138 |
| 235 | 3300025906 | Ga0207699_10816164 | Ga0207699_108161642 | 138 |
| 236 | 3300025907 | Ga0207645_10006720 | Ga0207645_100067203 | 138 |
| 237 | 3300025907 | Ga0207645_10018540 | Ga0207645_100185402 | 138 |
| 238 | 3300025908 | Ga0207643_10017840 | Ga0207643_100178402 | 138 |
| 239 | 3300025908 | Ga0207643_10092160 | Ga0207643_100921603 | 138 |
| 240 | 3300025910 | Ga0207684_10776282 | Ga0207684_107762822 | 138 |
| 241 | 3300025913 | Ga0207695_11635965 | Ga0207695_116359651 | 138 |
| 242 | 3300025914 | Ga0207671_10238405 | Ga0207671_102384052 | 138 |
| 243 | 3300025921 | Ga0207652_10037753 | Ga0207652_100377534 | 138 |
| 244 | 3300025922 | Ga0207646_10457515 | Ga0207646_104575152 | 138 |
| 245 | 3300025922 | Ga0207646_11218960 | Ga0207646_112189602 | 138 |
| 246 | 3300025923 | Ga0207681_10072991 | Ga0207681_100729913 | 138 |
| 247 | 3300025923 | Ga0207681_10097171 | Ga0207681_100971713 | 138 |
| 248 | 3300025924 | Ga0207694_10013517 | Ga0207694_100135173 | 138 |
| 249 | 3300025926 | Ga0207659_10002587 | Ga0207659_100025877 | 138 |
| 250 | 3300025926 | Ga0207659_10015657 | Ga0207659_100156572 | 138 |
| 251 | 3300025933 | Ga0207706_10088704 | Ga0207706_100887042 | 138 |
| 252 | 3300025933 | Ga0207706_10326983 | Ga0207706_103269832 | 138 |
| 253 | 3300025933 | Ga0207706_10514002 | Ga0207706_105140021 | 138 |
| 254 | 3300025934 | Ga0207686_10251152 | Ga0207686_102511522 | 138 |
| 255 | 3300025935 | Ga0207709_10198169 | Ga0207709_101981692 | 138 |
| 256 | 3300025937 | Ga0207669_10052694 | Ga0207669_100526942 | 138 |
| 257 | 3300025937 | Ga0207669_10596183 | Ga0207669_105961832 | 138 |
| 258 | 3300025937 | Ga0207669_11118284 | Ga0207669_111182842 | 138 |
| 259 | 3300025938 | Ga0207704_10001153 | Ga0207704_100011535 | 138 |
| 260 | 3300025938 | Ga0207704_10005959 | Ga0207704_100059592 | 138 |
| 261 | 3300025938 | Ga0207704_10196014 | Ga0207704_101960141 | 138 |
| 262 | 3300025940 | Ga0207691_10081698 | Ga0207691_100816982 | 138 |
| 263 | 3300025940 | Ga0207691_10100194 | Ga0207691_101001944 | 138 |
| 264 | 3300025940 | Ga0207691_10106164 | Ga0207691_101061644 | 138 |
| 265 | 3300025942 | Ga0207689_10006551 | Ga0207689_1000655110 | 138 |
| 266 | 3300025949 | Ga0207667_10001645 | Ga0207667_1000164511 | 138 |
| 267 | 3300025949 | Ga0207667_11001536 | Ga0207667_110015362 | 138 |
| 268 | 3300025960 | Ga0207651_10003494 | Ga0207651_100034945 | 138 |
| 269 | 3300025960 | Ga0207651_10154416 | Ga0207651_101544162 | 138 |
| 270 | 3300025960 | Ga0207651_10178394 | Ga0207651_101783942 | 138 |
| 271 | 3300025972 | Ga0207668_11876612 | Ga0207668_118766121 | 138 |
| 272 | 3300025981 | Ga0207640_10026096 | Ga0207640_100260965 | 138 |
| 273 | 3300025981 | Ga0207640_10317199 | Ga0207640_103171992 | 138 |
| 274 | 3300026023 | Ga0207677_10296230 | Ga0207677_102962302 | 138 |
| 275 | 3300026035 | Ga0207703_10030855 | Ga0207703_100308555 | 138 |
| 276 | 3300026035 | Ga0207703_10054646 | Ga0207703_100546465 | 138 |
| 277 | 3300026035 | Ga0207703_10200724 | Ga0207703_102007242 | 138 |
| 278 | 3300026035 | Ga0207703_10403413 | Ga0207703_104034132 | 138 |
| 279 | 3300026035 | Ga0207703_10557540 | Ga0207703_105575402 | 138 |
| 280 | 3300026067 | Ga0207678_10182176 | Ga0207678_101821762 | 138 |
| 281 | 3300026075 | Ga0207708_10009974 | Ga0207708_100099747 | 138 |
| 282 | 3300026088 | Ga0207641_10197823 | Ga0207641_101978233 | 138 |
| 283 | 3300026088 | Ga0207641_10544316 | Ga0207641_105443162 | 138 |
| 284 | 3300026088 | Ga0207641_12029734 | Ga0207641_120297341 | 138 |
| 285 | 3300026089 | Ga0207648_10001506 | Ga0207648_1000150612 | 138 |
| 286 | 3300026089 | Ga0207648_10006656 | Ga0207648_100066563 | 138 |
| 287 | 3300026089 | Ga0207648_10211446 | Ga0207648_102114463 | 138 |
| 288 | 3300026089 | Ga0207648_10623424 | Ga0207648_106234242 | 138 |
| 289 | 3300026089 | Ga0207648_10629698 | Ga0207648_106296982 | 138 |
| 290 | 3300026095 | Ga0207676_10033802 | Ga0207676_100338022 | 138 |
| 291 | 3300026116 | Ga0207674_10497229 | Ga0207674_104972292 | 138 |
| 292 | 3300026116 | Ga0207674_10659914 | Ga0207674_106599142 | 138 |
| 293 | 3300026118 | Ga0207675_100007856 | Ga0207675_1000078569 | 138 |
| 294 | 3300026118 | Ga0207675_100014801 | Ga0207675_1000148011 | 138 |
| 295 | 3300026118 | Ga0207675_100209009 | Ga0207675_1002090093 | 138 |
| 296 | 3300026118 | Ga0207675_101527620 | Ga0207675_1015276202 | 138 |
| 297 | 3300026121 | Ga0207683_10154432 | Ga0207683_101544322 | 138 |
| 298 | 3300026121 | Ga0207683_10315761 | Ga0207683_103157612 | 138 |
| 299 | 3300027614 | Ga0209970_1022008 | Ga0209970_10220082 | 138 |
| 300 | 3300027617 | Ga0210002_1012711 | Ga0210002_10127113 | 138 |
| 301 | 3300027682 | Ga0209971_1008243 | Ga0209971_10082433 | 138 |
| 302 | 3300027717 | Ga0209998_10006654 | Ga0209998_100066543 | 138 |
| 303 | 3300027907 | Ga0207428_10000052 | Ga0207428_1000005274 | 138 |
| 304 | 3300028379 | Ga0268266_10715254 | Ga0268266_107152542 | 138 |
| 305 | 3300028380 | Ga0268265_10017802 | Ga0268265_100178022 | 138 |
| 306 | 3300028380 | Ga0268265_10446161 | Ga0268265_104461612 | 138 |
| 307 | 3300028381 | Ga0268264_10085208 | Ga0268264_100852082 | 138 |
| 308 | 3300028381 | Ga0268264_11057044 | Ga0268264_110570441 | 138 |
| 309 | 3300028381 | Ga0268264_11363564 | Ga0268264_113635642 | 138 |
| 310 | 3300028577 | Ga0265318_10046863 | Ga0265318_100468633 | 138 |
| 311 | 3300031235 | Ga0265330_10003361 | Ga0265330_100033611 | 138 |
| 312 | 3300031250 | Ga0265331_10101465 | Ga0265331_101014652 | 138 |
| 313 | 3300031344 | Ga0265316_10004947 | Ga0265316_100049471 | 138 |
| 314 | 3300031548 | Ga0307408_101257214 | Ga0307408_1012572142 | 138 |
| 315 | 3300032002 | Ga0307416_100170571 | Ga0307416_1001705713 | 138 |
| 316 | 3300032005 | Ga0307411_10042742 | Ga0307411_100427426 | 138 |
| 317 | 3300035090 | Ga0373949_0141798 | Ga0373949_0141798_205_624 | 138 |
| 318 | 3300035118 | Ga0373954_0557040 | Ga0373954_0557040_33_449 | 138 |
| 319 | 3300035119 | Ga0373956_0257213 | Ga0373956_0257213_329_745 | 138 |
| 320 | 3300035170 | Ga0373943_0143324 | Ga0373943_0143324_536_952 | 138 |
| 321 | 3300035171 | Ga0373946_0103634 | Ga0373946_0103634_174_590 | 138 |
| 322 | 3300035172 | Ga0373955_0254190 | Ga0373955_0254190_383_799 | 138 |
| 323 | 3300035695 | Ga0373927_0413652 | Ga0373927_0413652_389_805 | 138 |
| 324 | 3300035725 | Ga0373947_0142330 | Ga0373947_0142330_818_1237 | 138 |
| 325 | 3300036401 | Ga0373937_0819190 | Ga0373937_0819190_315_731 | 138 |
| 326 | 3300036401 | Ga0373937_0905584 | Ga0373937_0905584_328_744 | 138 |
| 327 | 3300036401 | Ga0373937_1400969 | Ga0373937_1400969_160_579 | 138 |
| 328 | 3300039437 | Ga0436365_0745133 | Ga0436365_0745133_114_530 | 138 |
| 329 | 3300039437 | Ga0436365_1243498 | Ga0436365_1243498_55_510 | 138 |
| 330 | 3300041507 | Ga0451851_0919857 | Ga0451851_0919857_112_528 | 138 |
| 331 | 3300041511 | Ga0451855_0271469 | Ga0451855_0271469_605_1036 | 138 |
| 332 | 3300041512 | Ga0451853_1532330 | Ga0451853_1532330_148_564 | 138 |
| 333 | 3300042876 | Ga0451577_0392063 | Ga0451577_0392063_365_784 | 138 |
| 334 | 3300044673 | Ga0453683_1156922 | Ga0453683_1156922_28_447 | 138 |
| 335 | 3300044712 | Ga0453684_1240240 | Ga0453684_1240240_52_471 | 138 |
| 336 | 3300045051 | Ga0451576_0097096 | Ga0451576_0097096_482_901 | 138 |
| 337 | 3300046454 | Ga0495592_0070985 | Ga0495592_0070985_501_917 | 138 |
| 338 | 3300046459 | Ga0495629_0376566 | Ga0495629_0376566_403_819 | 138 |
| 339 | 3300046511 | Ga0495608_0007428 | Ga0495608_0007428_4280_4696 | 138 |
| 340 | 3300046511 | Ga0495608_0562119 | Ga0495608_0562119_123_542 | 138 |
| 341 | 3300046516 | Ga0495628_0046322 | Ga0495628_0046322_1623_2039 | 138 |
| 342 | 3300046516 | Ga0495628_0254690 | Ga0495628_0254690_157_573 | 138 |
| 343 | 3300046517 | Ga0495630_0002332 | Ga0495630_0002332_12381_12797 | 138 |
| 344 | 3300046519 | Ga0495632_0065068 | Ga0495632_0065068_1063_1482 | 138 |
| 345 | 3300046529 | Ga0495652_0280253 | Ga0495652_0280253_525_941 | 138 |
| 346 | 3300046536 | Ga0495587_0137343 | Ga0495587_0137343_916_1332 | 138 |
| 347 | 3300046537 | Ga0495598_0230498 | Ga0495598_0230498_29_445 | 138 |
| 348 | 3300046543 | Ga0495645_0015700 | Ga0495645_0015700_4839_5255 | 138 |
| 349 | 3300046543 | Ga0495645_0051538 | Ga0495645_0051538_2397_2813 | 138 |
| 350 | 3300046559 | Ga0495667_0153925 | Ga0495667_0153925_61_477 | 138 |
| 351 | 3300046674 | Ga0495588_0015439 | Ga0495588_0015439_550_966 | 138 |
| 352 | 3300046674 | Ga0495588_0449803 | Ga0495588_0449803_51_467 | 138 |
| 353 | 3300046675 | Ga0495657_0059434 | Ga0495657_0059434_527_943 | 138 |
| 354 | 3300046683 | Ga0495658_0273454 | Ga0495658_0273454_561_977 | 138 |
| 355 | 3300046689 | Ga0495613_0003284 | Ga0495613_0003284_3785_4201 | 138 |
| 356 | 3300047317 | Ga0495604_0046402 | Ga0495604_0046402_1855_2271 | 138 |
| 357 | 3300047317 | Ga0495604_0265532 | Ga0495604_0265532_178_594 | 138 |
| 358 | 3300047319 | Ga0495674_0028422 | Ga0495674_0028422_4413_4829 | 138 |
| 359 | 3300047319 | Ga0495674_0096285 | Ga0495674_0096285_312_728 | 138 |
| 360 | 3300047319 | Ga0495674_1114024 | Ga0495674_1114024_62_481 | 138 |
| 361 | 3300047322 | Ga0495680_0092576 | Ga0495680_0092576_200_616 | 138 |
| 362 | 3300047471 | Ga0495684_0001466 | Ga0495684_0001466_6100_6516 | 138 |
| 363 | 3300048905 | Ga0496102_0874169 | Ga0496102_0874169_191_679 | 138 |
| 364 | 3300048907 | Ga0496104_0091509 | Ga0496104_0091509_150_566 | 138 |
| 365 | 3300048917 | Ga0496114_0635375 | Ga0496114_0635375_347_763 | 138 |
| 366 | 3300049569 | Ga0501032_0003486 | Ga0501032_0003486_11152_11571 | 138 |
| 367 | 3300049569 | Ga0501032_0057117 | Ga0501032_0057117_453_872 | 138 |
| 368 | 3300049570 | Ga0501033_0001449 | Ga0501033_0001449_458_877 | 138 |
| 369 | 3300049570 | Ga0501033_0055195 | Ga0501033_0055195_617_1036 | 138 |
| 370 | 3300049571 | Ga0501034_0009066 | Ga0501034_0009066_6778_7197 | 138 |
| 371 | 3300049571 | Ga0501034_0595281 | Ga0501034_0595281_525_974 | 138 |
| 372 | 3300049572 | Ga0501036_0039160 | Ga0501036_0039160_1844_2263 | 138 |
| 373 | 3300049573 | Ga0501037_0004510 | Ga0501037_0004510_4119_4538 | 138 |
| 374 | 3300049573 | Ga0501037_0181849 | Ga0501037_0181849_53_472 | 138 |
| 375 | 3300049574 | Ga0501038_0004235 | Ga0501038_0004235_10250_10669 | 138 |
| 376 | 3300049574 | Ga0501038_0041841 | Ga0501038_0041841_1754_2173 | 138 |
| 377 | 3300049575 | Ga0501039_0129100 | Ga0501039_0129100_1410_1829 | 138 |
| 378 | 3300049576 | Ga0501040_0038360 | Ga0501040_0038360_710_1129 | 138 |
| 379 | 3300049578 | Ga0501042_0161797 | Ga0501042_0161797_982_1401 | 138 |
| 380 | 3300049579 | Ga0501043_0026437 | Ga0501043_0026437_2415_2834 | 138 |
| 381 | 3300049579 | Ga0501043_0121734 | Ga0501043_0121734_311_730 | 138 |
| 382 | 3300049580 | Ga0501046_0001361 | Ga0501046_0001361_8824_9243 | 138 |
| 383 | 3300049580 | Ga0501046_0293983 | Ga0501046_0293983_624_1043 | 138 |
| 384 | 3300049581 | Ga0501047_0004167 | Ga0501047_0004167_12290_12709 | 138 |
| 385 | 3300049581 | Ga0501047_0361813 | Ga0501047_0361813_444_863 | 138 |
| 386 | 3300049582 | Ga0501048_0000445 | Ga0501048_0000445_7231_7650 | 138 |
| 387 | 3300049582 | Ga0501048_0054766 | Ga0501048_0054766_1961_2380 | 138 |
| 388 | 3300049583 | Ga0501067_0020194 | Ga0501067_0020194_1118_1537 | 138 |
| 389 | 3300049584 | Ga0501068_0004738 | Ga0501068_0004738_6725_7144 | 138 |
| 390 | 3300049584 | Ga0501068_0020014 | Ga0501068_0020014_1517_1936 | 138 |
| 391 | 3300049585 | Ga0501069_0014170 | Ga0501069_0014170_1961_2380 | 138 |
| 392 | 3300049586 | Ga0501070_0004493 | Ga0501070_0004493_458_877 | 138 |
| 393 | 3300049586 | Ga0501070_0098462 | Ga0501070_0098462_904_1353 | 138 |
| 394 | 3300049586 | Ga0501070_0158462 | Ga0501070_0158462_1122_1541 | 138 |
| 395 | 3300049587 | Ga0501071_0147514 | Ga0501071_0147514_231_650 | 138 |
| 396 | 3300049587 | Ga0501071_0882567 | Ga0501071_0882567_248_667 | 138 |
| 397 | 3300049588 | Ga0501072_0177375 | Ga0501072_0177375_45_464 | 138 |
| 398 | 3300049588 | Ga0501072_1425306 | Ga0501072_1425306_82_501 | 138 |
| 399 | 3300049589 | Ga0501073_0031493 | Ga0501073_0031493_458_877 | 138 |
| 400 | 3300049589 | Ga0501073_0233413 | Ga0501073_0233413_768_1187 | 138 |
| 401 | 3300049590 | Ga0501074_0039866 | Ga0501074_0039866_1350_1769 | 138 |
| 402 | 3300049590 | Ga0501074_0075915 | Ga0501074_0075915_36_455 | 138 |
| 403 | 3300049704 | Ga0501221_118166 | Ga0501221_118166_13_429 | 138 |
| 404 | 3300049708 | Ga0501245_079245 | Ga0501245_079245_133_549 | 138 |
| 405 | 3300049741 | Ga0501079_0142864 | Ga0501079_0142864_162_581 | 138 |
| 406 | 3300049741 | Ga0501079_0431508 | Ga0501079_0431508_379_798 | 138 |
| 407 | 3300049742 | Ga0501080_0003186 | Ga0501080_0003186_458_877 | 138 |
| 408 | 3300049742 | Ga0501080_1771115 | Ga0501080_1771115_17_436 | 138 |
| 409 | 3300049743 | Ga0501081_1195984 | Ga0501081_1195984_61_480 | 138 |
| 410 | 3300049744 | Ga0501083_0063038 | Ga0501083_0063038_1227_1646 | 138 |
| 411 | 3300049779 | Ga0501283_035813 | Ga0501283_035813_395_811 | 138 |
| 412 | 3300049822 | Ga0501035_0008847 | Ga0501035_0008847_72_491 | 138 |
| 413 | 3300049822 | Ga0501035_0108590 | Ga0501035_0108590_1902_2321 | 138 |
| 414 | 3300049823 | Ga0501044_0055671 | Ga0501044_0055671_326_745 | 138 |
| 415 | 3300049824 | Ga0501045_0050854 | Ga0501045_0050854_155_574 | 138 |
| 416 | 3300050493 | nmdc:mga0k408_939095_c1 | nmdc:mga0k408_939095_c1_45_461 | 138 |
| 417 | 3300050494 | nmdc:mga06z11_104358_c1 | nmdc:mga06z11_104358_c1_572_994 | 138 |
| 418 | 3300050495 | nmdc:mga04h51_130584_c1 | nmdc:mga04h51_130584_c1_108_542 | 138 |
| 419 | 3300050507 | nmdc:mga05p37_1335142_c1 | nmdc:mga05p37_1335142_c1_260_676 | 138 |
| 420 | 3300050507 | nmdc:mga05p37_58120_c1 | nmdc:mga05p37_58120_c1_3295_3711 | 138 |
| 421 | 3300050507 | nmdc:mga05p37_75932_c1 | nmdc:mga05p37_75932_c1_26_442 | 138 |
| 422 | 3300050510 | nmdc:mga06r32_952268_c1 | nmdc:mga06r32_952268_c1_83_499 | 138 |
| 423 | 3300050511 | nmdc:mga08y16_14_c1 | nmdc:mga08y16_14_c1_322053_322472 | 138 |
| 424 | 3300050512 | nmdc:mga0n895_1176012_c1 | nmdc:mga0n895_1176012_c1_42_458 | 138 |
| 425 | 3300050512 | nmdc:mga0n895_1232157_c1 | nmdc:mga0n895_1232157_c1_126_542 | 138 |
| 426 | 3300050513 | nmdc:mga0rr50_1102507_c1 | nmdc:mga0rr50_1102507_c1_188_607 | 138 |
| 427 | 3300050513 | nmdc:mga0rr50_878136_c1 | nmdc:mga0rr50_878136_c1_61_477 | 138 |
| 428 | 3300050515 | nmdc:mga0a205_297280_c1 | nmdc:mga0a205_297280_c1_660_1076 | 138 |
| 429 | 3300050515 | nmdc:mga0a205_37348_c1 | nmdc:mga0a205_37348_c1_4037_4495 | 138 |
| 430 | 3300053077 | Ga0495601_0013185 | Ga0495601_0013185_3167_3583 | 138 |
| 431 | 3300053084 | Ga0495595_0467145 | Ga0495595_0467145_68_484 | 138 |
| 432 | 3300053085 | Ga0495619_0001983 | Ga0495619_0001983_7894_8310 | 138 |
| 433 | 3300053085 | Ga0495619_0243682 | Ga0495619_0243682_375_794 | 138 |
| 434 | 3300053092 | Ga0500583_0000312 | Ga0500583_0000312_8365_8784 | 138 |
| 435 | 3300053092 | Ga0500583_0056715 | Ga0500583_0056715_1143_1562 | 138 |
| 436 | 3300053096 | Ga0500641_0004693 | Ga0500641_0004693_3849_4418 | 138 |
| 437 | 3300053096 | Ga0500641_0045618 | Ga0500641_0045618_1150_1569 | 138 |
| 438 | 3300054114 | Ga0501084_0111896 | Ga0501084_0111896_125_544 | 138 |
| 439 | 3300060353 | Ga0501082_0172154 | Ga0501082_0172154_145_564 | 138 |
| 440 | 3300060353 | Ga0501082_0368206 | Ga0501082_0368206_418_837 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b0k-assembly1.cif.gz_A | membrane protein structure | 0.9045 | 5 | 138 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.8501 | 5 | 138 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.817 | 5 | 138 |
| 7b0k-assembly1.cif.gz_A | membrane protein structure | 0.799 | 5 | 138 |
| 5hx1-assembly2.cif.gz_D | crystal structure of dr2231_e46a mutant in complex with dump and magnesium | 0.6795 | 85 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q47377_2_110_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8954 | 61 | 136 | 1.10.3730.20 |
| af_Q5A5P7_5_125_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8405 | 76 | 136 | 1.10.3730.20 |
| af_Q3C1C7_10_111_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8182 | 68 | 135 | 1.10.3730.20 |
| af_Q8RWH8_5_118_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8152 | 75 | 136 | 1.10.3730.20 |
| af_Q8RY83_36_351_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8063 | 62 | 136 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519VE27-F1-model_v4 | EamA family transporter | 0.9968 | 3 | 138 |
GO:0016020
|
| AF-A0A0X8JIY0-F1-model_v4 | EamA domain-containing protein | 0.996 | 3 | 138 |
GO:0016020
|
| AF-A0A2R3MXU3-F1-model_v4 | EamA domain-containing protein | 0.9956 | 3 | 138 |
GO:0016020
|
| AF-A0A7C4T326-F1-model_v4 | EamA family transporter | 0.995 | 3 | 138 |
GO:0016020
|
| AF-A0A3B7N1N1-F1-model_v4 | EamA family transporter | 0.9946 | 3 | 138 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar