F444411

General Info

Members Datasets Scaffolds Average Seq Length
440 258 436 140

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10023193|Ga0105247_100231933
Length 161
Sequence LFTDLKPGHHIQLEMLHISEVADMSWLVYAFVSAGAAALTAVLAKIGVEGVPSTLATAVRTVIITLFAWAITIGLKEHHALSGVSRRSLVFLVLSGLATGVSWLAYFRALQLAPASRVAPVDKLSLPLTIVLATLFLGEPLSWRLGLGVALMTAGAILTIG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
4 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
5 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
227 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
254 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0
Rhizoplane 0.68
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5261811 2162886012 Unclassified 844
2 rootH1_10056446 3300003323 Bacteria 3824
3 Ga0065715_10930145 3300005293 Bacteria 565
4 Ga0070658_10183796 3300005327 Bacteria 1760
5 Ga0070676_10012476 3300005328 Bacteria 4641
6 Ga0070676_10624327 3300005328 Unclassified 779
7 Ga0070677_10049851 3300005333 Unclassified 1688
8 Ga0070677_10060727 3300005333 Unclassified 1558
9 Ga0070677_10295822 3300005333 Unclassified 821
10 Ga0070677_10576456 3300005333 Bacteria 620
11 Ga0070677_10759843 3300005333 Bacteria 550
12 Ga0068869_100000479 3300005334 Bacteria 22115
13 Ga0068869_100025000 3300005334 Bacteria 4142
14 Ga0068869_101670386 3300005334 Unclassified 568
15 Ga0070666_10461304 3300005335 Bacteria 918
16 Ga0070680_100107389 3300005336 Unclassified 2322
17 Ga0070682_100003975 3300005337 Bacteria 8210
18 Ga0068868_100104069 3300005338 Bacteria 2300
19 Ga0070687_100069546 3300005343 Bacteria 1886
20 Ga0070669_100506328 3300005353 Bacteria 1002
21 Ga0070669_100562851 3300005353 Unclassified 951
22 Ga0070675_100005942 3300005354 Bacteria 9351
23 Ga0070675_100013178 3300005354 Bacteria 6496
24 Ga0070675_100196644 3300005354 Bacteria 1749
25 Ga0070671_100595293 3300005355 Bacteria 955
26 Ga0070674_100050501 3300005356 Bacteria 2863
27 Ga0070673_100004944 3300005364 Bacteria 8491
28 Ga0070673_100139788 3300005364 Unclassified 2041
29 Ga0070688_100341127 3300005365 Bacteria 1094
30 Ga0070688_100544092 3300005365 Unclassified 882
31 Ga0070667_100680644 3300005367 Unclassified 951
32 Ga0070701_10705594 3300005438 Unclassified 679
33 Ga0070701_10902396 3300005438 Bacteria 610
34 Ga0070705_100295194 3300005440 Unclassified 1159
35 Ga0070705_100446399 3300005440 Unclassified 969
36 Ga0070700_100004859 3300005441 Bacteria 7061
37 Ga0070694_100101079 3300005444 Unclassified 2040
38 Ga0070708_100248413 3300005445 Bacteria 1671
39 Ga0070663_100007672 3300005455 Bacteria 6585
40 Ga0070663_100591721 3300005455 Bacteria 932
41 Ga0070678_100258398 3300005456 Bacteria 1463
42 Ga0070662_100026677 3300005457 Bacteria 4003
43 Ga0068867_100001315 3300005459 Bacteria 17194
44 Ga0068867_100063372 3300005459 Bacteria 2747
45 Ga0068867_100248507 3300005459 Unclassified 1445
46 Ga0068867_100309875 3300005459 Unclassified 1304
47 Ga0070685_10340912 3300005466 Unclassified 1022
48 Ga0070707_100590887 3300005468 Unclassified 1073
49 Ga0070698_100013163 3300005471 Bacteria 8755
50 Ga0070698_100177000 3300005471 Bacteria 2072
51 Ga0070698_100230239 3300005471 Bacteria 1786
52 Ga0070698_100461068 3300005471 Unclassified 1207
53 Ga0070698_100825998 3300005471 Bacteria 871
54 Ga0070698_101026581 3300005471 Bacteria 772
55 Ga0070699_100036496 3300005518 Bacteria 4252
56 Ga0070699_100157899 3300005518 Bacteria 2007
57 Ga0070679_100063499 3300005530 Bacteria 3681
58 Ga0070684_101213764 3300005535 Unclassified 709
59 Ga0070697_101323899 3300005536 Unclassified 643
60 Ga0070672_100023354 3300005543 Bacteria 4557
61 Ga0070672_100038109 3300005543 Bacteria 3671
62 Ga0070672_100343945 3300005543 Unclassified 1271
63 Ga0070686_100586490 3300005544 Unclassified 876
64 Ga0070695_100217126 3300005545 Bacteria 1376
65 Ga0070695_100350559 3300005545 Bacteria 1106
66 Ga0070695_101200210 3300005545 Bacteria 624
67 Ga0070695_101514255 3300005545 Unclassified 558
68 Ga0070696_100695993 3300005546 Unclassified 828
69 Ga0070704_100083272 3300005549 Unclassified 2361
70 Ga0068855_100001616 3300005563 Bacteria 28290
71 Ga0068855_101429259 3300005563 Bacteria 712
72 Ga0070664_100514412 3300005564 Bacteria 1104
73 Ga0068857_100368260 3300005577 Unclassified 1333
74 Ga0068854_100074821 3300005578 Unclassified 2485
75 Ga0068854_100485605 3300005578 Bacteria 1038
76 Ga0068854_101312182 3300005578 Unclassified 652
77 Ga0070702_101303938 3300005615 Unclassified 590
78 Ga0068859_100050250 3300005617 Unclassified 4189
79 Ga0068859_100164104 3300005617 Bacteria 2300
80 Ga0068859_100571173 3300005617 Unclassified 1225
81 Ga0068859_100626139 3300005617 Bacteria 1168
82 Ga0068864_100276598 3300005618 Bacteria 1566
83 Ga0068866_10020520 3300005718 Bacteria 3029
84 Ga0068866_10031308 3300005718 Bacteria 2561
85 Ga0068866_10326106 3300005718 Unclassified 967
86 Ga0068861_100026746 3300005719 Bacteria 4197
87 Ga0068861_100910531 3300005719 Unclassified 833
88 Ga0068861_102683235 3300005719 Unclassified 502
89 Ga0068851_10188091 3300005834 Bacteria 1147
90 Ga0068870_10109321 3300005840 Unclassified 1576
91 Ga0068870_10147492 3300005840 Unclassified 1382
92 Ga0068863_100068356 3300005841 Bacteria 3361
93 Ga0068863_100354019 3300005841 Bacteria 1430
94 Ga0068863_100447906 3300005841 Bacteria 1267
95 Ga0068858_100063971 3300005842 Bacteria 3404
96 Ga0068858_100103979 3300005842 Bacteria 2650
97 Ga0068858_100113069 3300005842 Bacteria 2536
98 Ga0068858_100197199 3300005842 Unclassified 1903
99 Ga0068858_100966741 3300005842 Unclassified 834
100 Ga0068860_100046431 3300005843 Bacteria 4141
101 Ga0068860_100487655 3300005843 Bacteria 1229
102 Ga0068860_101322174 3300005843 Bacteria 742
103 Ga0068860_102420544 3300005843 Bacteria 545
104 Ga0068862_100031169 3300005844 Unclassified 4498
105 Ga0068862_100315344 3300005844 Unclassified 1442
106 Ga0068862_100334436 3300005844 Archaea 1401
107 Ga0068862_100949617 3300005844 Unclassified 848
108 Ga0070717_11771893 3300006028 Unclassified 558
109 Ga0070715_10133777 3300006163 Bacteria 1196
110 Ga0097621_100001766 3300006237 Bacteria 14839
111 Ga0097621_100797279 3300006237 Bacteria 875
112 Ga0068871_100007340 3300006358 Bacteria 7867
113 Ga0068871_101171609 3300006358 Unclassified 720
114 Ga0075428_100000014 3300006844 Bacteria 166411
115 Ga0075428_100815066 3300006844 Unclassified 992
116 Ga0075430_101135656 3300006846 Bacteria 643
117 Ga0075431_100299343 3300006847 Bacteria 1625
118 Ga0075433_10203186 3300006852 Bacteria 1761
119 Ga0075433_10333334 3300006852 Bacteria 1341
120 Ga0075433_10340490 3300006852 Unclassified 1326
121 Ga0075434_100097789 3300006871 Bacteria 2940
122 Ga0075434_100428229 3300006871 Bacteria 1344
123 Ga0075434_101295601 3300006871 Unclassified 739
124 Ga0075434_102424202 3300006871 Unclassified 526
125 Ga0068865_100000656 3300006881 Bacteria 19560
126 Ga0068865_100039333 3300006881 Bacteria 3207
127 Ga0068865_100139809 3300006881 Bacteria 1824
128 Ga0075436_100089629 3300006914 Unclassified 2137
129 Ga0097620_100050248 3300006931 Unclassified 4189
130 Ga0097620_100164115 3300006931 Bacteria 2300
131 Ga0097620_100571183 3300006931 Unclassified 1225
132 Ga0097620_100626118 3300006931 Bacteria 1168
133 Ga0075435_100593285 3300007076 Unclassified 960
134 Ga0075435_100869295 3300007076 Unclassified 786
135 Ga0075435_101387892 3300007076 Unclassified 616
136 Ga0075435_101919926 3300007076 Bacteria 520
137 Ga0111539_10000019 3300009094 Bacteria 266927
138 Ga0111539_10223853 3300009094 Bacteria 2191
139 Ga0105245_10410469 3300009098 Bacteria 1355
140 Ga0105245_10947494 3300009098 Unclassified 904
141 Ga0105247_10023193 3300009101 Bacteria 3739
142 Ga0105247_10498383 3300009101 Bacteria 887
143 Ga0114129_10164868 3300009147 Unclassified 3025
144 Ga0114129_10209452 3300009147 Bacteria 2636
145 Ga0114129_10230569 3300009147 Unclassified 2494
146 Ga0114129_10737867 3300009147 Unclassified 1262
147 Ga0114129_10850979 3300009147 Unclassified 1159
148 Ga0105243_10016949 3300009148 Bacteria 5509
149 Ga0105243_12407368 3300009148 Bacteria 565
150 Ga0105241_11287361 3300009174 Unclassified 696
151 Ga0105242_10165213 3300009176 Bacteria 1941
152 Ga0105242_10597350 3300009176 Unclassified 1065
153 Ga0105248_10090126 3300009177 Bacteria 3453
154 Ga0105248_10091290 3300009177 Bacteria 3430
155 Ga0105248_10668718 3300009177 Bacteria 1172
156 Ga0105248_10809508 3300009177 Bacteria 1057
157 Ga0105248_10868813 3300009177 Unclassified 1018
158 Ga0105237_10066997 3300009545 Bacteria 3585
159 Ga0105237_11096217 3300009545 Unclassified 803
160 Ga0105238_10024553 3300009551 Bacteria 6144
161 Ga0105238_10359914 3300009551 Bacteria 1444
162 Ga0105249_10228523 3300009553 Bacteria 1834
163 Ga0105249_12089497 3300009553 Bacteria 639
164 Ga0105239_10276567 3300010375 Unclassified 1889
165 Ga0157378_10343377 3300013297 Bacteria 1456
166 Ga0157378_10352066 3300013297 Unclassified 1439
167 Ga0163162_10816839 3300013306 Bacteria 1049
168 Ga0163162_11563708 3300013306 Unclassified 752
169 Ga0157375_10096115 3300013308 Bacteria 3035
170 Ga0157375_11124914 3300013308 Unclassified 920
171 Ga0157375_12900427 3300013308 Unclassified 573
172 Ga0163163_10156320 3300014325 Bacteria 2325
173 Ga0163163_10913543 3300014325 Unclassified 941
174 Ga0157380_10048505 3300014326 Bacteria 3345
175 Ga0157380_10099214 3300014326 Bacteria 2421
176 Ga0157380_10099647 3300014326 Bacteria 2417
177 Ga0157380_10216237 3300014326 Bacteria 1712
178 Ga0157377_10077854 3300014745 Bacteria 1931
179 Ga0157379_10009443 3300014968 Bacteria 8498
180 Ga0157376_10256150 3300014969 Bacteria 1637
181 Ga0163161_10175598 3300017792 Bacteria 1640
182 Ga0207653_10053223 3300025885 Unclassified 1352
183 Ga0207682_10011010 3300025893 Bacteria 3540
184 Ga0207682_10612310 3300025893 Unclassified 513
185 Ga0207642_10034298 3300025899 Bacteria 2157
186 Ga0207642_10078792 3300025899 Unclassified 1593
187 Ga0207642_10820770 3300025899 Bacteria 592
188 Ga0207680_10206518 3300025903 Bacteria 1341
189 Ga0207699_10816164 3300025906 Bacteria 686
190 Ga0207645_10006720 3300025907 Bacteria 8222
191 Ga0207645_10018540 3300025907 Bacteria 4576
192 Ga0207643_10017840 3300025908 Unclassified 3885
193 Ga0207643_10092160 3300025908 Unclassified 1768
194 Ga0207684_10776282 3300025910 Unclassified 811
195 Ga0207654_10409854 3300025911 Unclassified 944
196 Ga0207654_10764838 3300025911 Unclassified 696
197 Ga0207695_11635965 3300025913 Bacteria 525
198 Ga0207671_10238405 3300025914 Bacteria 1428
199 Ga0207671_10778749 3300025914 Unclassified 759
200 Ga0207652_10037753 3300025921 Bacteria 4090
201 Ga0207646_10457515 3300025922 Bacteria 1151
202 Ga0207646_11218960 3300025922 Unclassified 659
203 Ga0207681_10072991 3300025923 Bacteria 2399
204 Ga0207681_10097171 3300025923 Bacteria 2116
205 Ga0207694_10013517 3300025924 Bacteria 6150
206 Ga0207659_10002587 3300025926 Bacteria 10780
207 Ga0207659_10015657 3300025926 Bacteria 4921
208 Ga0207706_10088704 3300025933 Bacteria 2719
209 Ga0207706_10326983 3300025933 Bacteria 1334
210 Ga0207706_10514002 3300025933 Unclassified 1033
211 Ga0207686_10251152 3300025934 Unclassified 1292
212 Ga0207709_10198169 3300025935 Unclassified 1432
213 Ga0207669_10052694 3300025937 Bacteria 2446
214 Ga0207669_10596183 3300025937 Bacteria 897
215 Ga0207669_11118284 3300025937 Unclassified 665
216 Ga0207704_10001153 3300025938 Bacteria 11753
217 Ga0207704_10005959 3300025938 Bacteria 5651
218 Ga0207704_10196014 3300025938 Unclassified 1473
219 Ga0207691_10081698 3300025940 Bacteria 2904
220 Ga0207691_10100194 3300025940 Bacteria 2586
221 Ga0207691_10106164 3300025940 Unclassified 2502
222 Ga0207689_10006551 3300025942 Bacteria 10273
223 Ga0207667_10001645 3300025949 Bacteria 28155
224 Ga0207667_11001536 3300025949 Bacteria 823
225 Ga0207651_10003494 3300025960 Bacteria 7721
226 Ga0207651_10154416 3300025960 Unclassified 1791
227 Ga0207651_10178394 3300025960 Bacteria 1682
228 Ga0207651_10225484 3300025960 Bacteria 1518
229 Ga0207668_11876612 3300025972 Unclassified 540
230 Ga0207640_10026096 3300025981 Unclassified 3543
231 Ga0207640_10317199 3300025981 Bacteria 1239
232 Ga0207677_10296230 3300026023 Bacteria 1334
233 Ga0207703_10030855 3300026035 Bacteria 4236
234 Ga0207703_10054646 3300026035 Bacteria 3248
235 Ga0207703_10200724 3300026035 Unclassified 1772
236 Ga0207703_10403413 3300026035 Unclassified 1269
237 Ga0207703_10557540 3300026035 Bacteria 1081
238 Ga0207678_10182176 3300026067 Bacteria 1794
239 Ga0207708_10009974 3300026075 Bacteria 7055
240 Ga0207641_10197823 3300026088 Bacteria 1851
241 Ga0207641_10544316 3300026088 Bacteria 1131
242 Ga0207641_12029734 3300026088 Unclassified 576
243 Ga0207648_10001506 3300026089 Bacteria 25672
244 Ga0207648_10006656 3300026089 Bacteria 11469
245 Ga0207648_10211446 3300026089 Unclassified 1722
246 Ga0207648_10623424 3300026089 Unclassified 995
247 Ga0207648_10629698 3300026089 Unclassified 990
248 Ga0207676_10033802 3300026095 Bacteria 3867
249 Ga0207674_10497229 3300026116 Unclassified 1178
250 Ga0207674_10659914 3300026116 Bacteria 1010
251 Ga0207675_100007856 3300026118 Bacteria 10065
252 Ga0207675_100014801 3300026118 Bacteria 7279
253 Ga0207675_100209009 3300026118 Unclassified 1876
254 Ga0207675_101527620 3300026118 Unclassified 688
255 Ga0207683_10154432 3300026121 Bacteria 2073
256 Ga0207683_10315761 3300026121 Unclassified 1431
257 Ga0209970_1022008 3300027614 Bacteria 1081
258 Ga0210002_1012711 3300027617 Unclassified 1310
259 Ga0209971_1008243 3300027682 Unclassified 2471
260 Ga0209998_10006654 3300027717 Bacteria 2398
261 Ga0207428_10000052 3300027907 Bacteria 176270
262 Ga0268266_10715254 3300028379 Bacteria 966
263 Ga0268265_10017802 3300028380 Unclassified 4912
264 Ga0268265_10362855 3300028380 Bacteria 1327
265 Ga0268265_10446161 3300028380 Unclassified 1207
266 Ga0268264_10085208 3300028381 Bacteria 2712
267 Ga0268264_10402343 3300028381 Bacteria 1316
268 Ga0268264_11057044 3300028381 Bacteria 819
269 Ga0268264_11363564 3300028381 Archaea 719
270 Ga0265318_10046863 3300028577 Unclassified 1631
271 Ga0265330_10003361 3300031235 Bacteria 8390
272 Ga0265331_10101465 3300031250 Bacteria 1324
273 Ga0265316_10004947 3300031344 Bacteria 13100
274 Ga0307408_101257214 3300031548 Bacteria 692
275 Ga0307416_100170571 3300032002 Bacteria 2025
276 Ga0307411_10042742 3300032005 Unclassified 2895
277 Ga0373949_0141798 3300035090 Bacteria 689
278 Ga0373954_0557040 3300035118 Unclassified 568
279 Ga0373956_0257213 3300035119 Unclassified 830
280 Ga0373943_0143324 3300035170 Bacteria 1289
281 Ga0373946_0103634 3300035171 Bacteria 1279
282 Ga0373955_0254190 3300035172 Bacteria 1054
283 Ga0373927_0413652 3300035695 Unclassified 890
284 Ga0373927_0640879 3300035695 Unclassified 702
285 Ga0373947_0142330 3300035725 Bacteria 1539
286 Ga0373937_0819190 3300036401 Unclassified 879
287 Ga0373937_0905584 3300036401 Bacteria 831
288 Ga0373937_1400969 3300036401 Bacteria 647
289 Ga0395905_0207977 3300037471 Bacteria 1834
290 Ga0436365_0745133 3300039437 Unclassified 665
291 Ga0436365_1243498 3300039437 Unclassified 733
292 Ga0451851_0919857 3300041507 Bacteria 570
293 Ga0451855_0271469 3300041511 Bacteria 1700
294 Ga0451853_0673947 3300041512 Bacteria 564
295 Ga0451853_1532330 3300041512 Unclassified 594
296 Ga0451577_0392063 3300042876 Bacteria 1260
297 Ga0453683_1156922 3300044673 Bacteria 517
298 Ga0453684_1240240 3300044712 Bacteria 781
299 Ga0451576_0097096 3300045051 Bacteria 3064
300 Ga0495592_0070985 3300046454 Unclassified 2536
301 Ga0495590_0001380 3300046457 Bacteria 10544
302 Ga0495629_0376566 3300046459 Bacteria 966
303 Ga0495653_0230073 3300046463 Bacteria 1241
304 Ga0495580_0030020 3300046472 Unclassified 3940
305 Ga0495639_0030420 3300046475 Bacteria 2400
306 Ga0495608_0007428 3300046511 Bacteria 7743
307 Ga0495608_0052346 3300046511 Bacteria 2703
308 Ga0495608_0562119 3300046511 Bacteria 687
309 Ga0495616_0064529 3300046513 Bacteria 1787
310 Ga0495628_0046322 3300046516 Bacteria 3454
311 Ga0495628_0254690 3300046516 Unclassified 1309
312 Ga0495630_0002332 3300046517 Bacteria 13208
313 Ga0495630_0100319 3300046517 Bacteria 2190
314 Ga0495631_0000959 3300046518 Bacteria 17978
315 Ga0495632_0065068 3300046519 Bacteria 1762
316 Ga0495637_0061753 3300046520 Bacteria 1535
317 Ga0495648_0001204 3300046524 Bacteria 25917
318 Ga0495652_0280253 3300046529 Bacteria 1221
319 Ga0495587_0137343 3300046536 Bacteria 1396
320 Ga0495598_0230498 3300046537 Bacteria 679
321 Ga0495645_0015700 3300046543 Bacteria 5389
322 Ga0495645_0051538 3300046543 Bacteria 2994
323 Ga0495667_0153925 3300046559 Bacteria 1480
324 Ga0495668_0001975 3300046616 Bacteria 17991
325 Ga0495635_0768723 3300046663 Unclassified 622
326 Ga0495588_0015439 3300046674 Bacteria 3675
327 Ga0495588_0449803 3300046674 Bacteria 676
328 Ga0495657_0059434 3300046675 Bacteria 2536
329 Ga0495658_0273454 3300046683 Bacteria 1065
330 Ga0495613_0003284 3300046689 Bacteria 12096
331 Ga0495624_0003185 3300046690 Bacteria 12218
332 Ga0495581_0013350 3300047315 Unclassified 4763
333 Ga0495604_0046402 3300047317 Bacteria 3387
334 Ga0495604_0265532 3300047317 Unclassified 1165
335 Ga0495674_0006880 3300047319 Bacteria 10879
336 Ga0495674_0028422 3300047319 Bacteria 5098
337 Ga0495674_0096285 3300047319 Bacteria 2523
338 Ga0495674_1114024 3300047319 Bacteria 600
339 Ga0495676_0110652 3300047321 Bacteria 2016
340 Ga0495680_0092576 3300047322 Bacteria 2264
341 Ga0495675_0126203 3300047444 Unclassified 1592
342 Ga0495673_0000467 3300047469 Bacteria 43912
343 Ga0495684_0001201 3300047471 Bacteria 20851
344 Ga0495684_0001466 3300047471 Bacteria 18891
345 Ga0495686_0004684 3300047472 Bacteria 11102
346 Ga0496102_0874169 3300048905 Bacteria 821
347 Ga0496104_0091509 3300048907 Archaea 2908
348 Ga0496114_0635375 3300048917 Bacteria 940
349 Ga0496124_0324714 3300048927 Bacteria 1100
350 Ga0496125_0028483 3300048928 Bacteria 5044
351 Ga0496126_0027785 3300048929 Bacteria 5398
352 Ga0501032_0003486 3300049569 Bacteria 12028
353 Ga0501032_0057117 3300049569 Bacteria 2622
354 Ga0501033_0001449 3300049570 Bacteria 21032
355 Ga0501033_0055195 3300049570 Bacteria 2937
356 Ga0501034_0009066 3300049571 Bacteria 10448
357 Ga0501034_0595281 3300049571 Bacteria 1012
358 Ga0501036_0039160 3300049572 Bacteria 4013
359 Ga0501037_0004510 3300049573 Bacteria 10117
360 Ga0501037_0181849 3300049573 Unclassified 1491
361 Ga0501038_0004235 3300049574 Bacteria 13333
362 Ga0501038_0041841 3300049574 Bacteria 3994
363 Ga0501039_0129100 3300049575 Bacteria 1983
364 Ga0501040_0038360 3300049576 Bacteria 3257
365 Ga0501042_0161797 3300049578 Bacteria 1615
366 Ga0501043_0026437 3300049579 Bacteria 4553
367 Ga0501043_0121734 3300049579 Unclassified 2046
368 Ga0501046_0001361 3300049580 Bacteria 23624
369 Ga0501046_0293983 3300049580 Bacteria 1187
370 Ga0501047_0004167 3300049581 Bacteria 13604
371 Ga0501047_0203183 3300049581 Bacteria 1841
372 Ga0501047_0361813 3300049581 Bacteria 1286
373 Ga0501048_0000445 3300049582 Bacteria 29088
374 Ga0501048_0054766 3300049582 Bacteria 2833
375 Ga0501067_0020194 3300049583 Bacteria 3685
376 Ga0501068_0004738 3300049584 Bacteria 7396
377 Ga0501068_0020014 3300049584 Bacteria 3894
378 Ga0501069_0014170 3300049585 Bacteria 4258
379 Ga0501070_0004493 3300049586 Bacteria 11975
380 Ga0501070_0098462 3300049586 Bacteria 2419
381 Ga0501070_0158462 3300049586 Bacteria 1866
382 Ga0501070_0957478 3300049586 Bacteria 665
383 Ga0501071_0147514 3300049587 Bacteria 1754
384 Ga0501071_0882567 3300049587 Bacteria 690
385 Ga0501072_0177375 3300049588 Bacteria 1699
386 Ga0501072_1425306 3300049588 Bacteria 535
387 Ga0501073_0031493 3300049589 Bacteria 3783
388 Ga0501073_0233413 3300049589 Bacteria 1270
389 Ga0501074_0039866 3300049590 Bacteria 3401
390 Ga0501074_0075915 3300049590 Bacteria 2412
391 Ga0501221_118166 3300049704 Unclassified 675
392 Ga0501245_079245 3300049708 Bacteria 632
393 Ga0501079_0142864 3300049741 Unclassified 1864
394 Ga0501079_0431508 3300049741 Bacteria 1034
395 Ga0501080_0003186 3300049742 Bacteria 14469
396 Ga0501080_1771115 3300049742 Bacteria 519
397 Ga0501081_1195984 3300049743 Bacteria 576
398 Ga0501083_0063038 3300049744 Bacteria 2472
399 Ga0501283_035813 3300049779 Unclassified 846
400 Ga0501035_0008847 3300049822 Bacteria 9369
401 Ga0501035_0108590 3300049822 Bacteria 2432
402 Ga0501044_0055671 3300049823 Bacteria 4061
403 Ga0501045_0050854 3300049824 Bacteria 3024
404 nmdc:mga0k408_939095_c1 3300050493 Bacteria 501
405 nmdc:mga06z11_104358_c1 3300050494 Bacteria 1560
406 nmdc:mga04h51_130584_c1 3300050495 Bacteria 944
407 nmdc:mga05p37_1335142_c1 3300050507 Unclassified 728
408 nmdc:mga05p37_58120_c1 3300050507 Bacteria 4763
409 nmdc:mga05p37_75932_c1 3300050507 Unclassified 4137
410 nmdc:mga06r32_952268_c1 3300050510 Unclassified 813
411 nmdc:mga08y16_14_c1 3300050511 Bacteria 398067
412 nmdc:mga0n895_1176012_c1 3300050512 Unclassified 742
413 nmdc:mga0n895_1232157_c1 3300050512 Unclassified 721
414 nmdc:mga0rr50_1102507_c1 3300050513 Unclassified 675
415 nmdc:mga0rr50_878136_c1 3300050513 Unclassified 765
416 nmdc:mga08x19_39459_c1 3300050514 Bacteria 3002
417 nmdc:mga0a205_297280_c1 3300050515 Unclassified 1488
418 nmdc:mga0a205_37348_c1 3300050515 Bacteria 4671
419 Ga0495601_0013185 3300053077 Bacteria 4970
420 Ga0495595_0467145 3300053084 Bacteria 642
421 Ga0495619_0001983 3300053085 Bacteria 13623
422 Ga0495619_0243682 3300053085 Bacteria 1245
423 Ga0500643_059715 3300053087 Bacteria 1072
424 Ga0500644_0000232 3300053088 Bacteria 31501
425 Ga0500583_0000312 3300053092 Bacteria 16626
426 Ga0500583_0056715 3300053092 Bacteria 1836
427 Ga0500641_0004693 3300053096 Bacteria 4831
428 Ga0500641_0024205 3300053096 Bacteria 2340
429 Ga0500641_0045618 3300053096 Unclassified 1786
430 Ga0500562_009930 3300053108 Bacteria 2407
431 Ga0500564_000067 3300053138 Bacteria 27553
432 Ga0500622_0003240 3300053156 Bacteria 11059
433 Ga0501084_0111896 3300054114 Bacteria 2294
434 Ga0500661_088333 3300055283 Bacteria 580
435 Ga0501082_0172154 3300060353 Unclassified 1882
436 Ga0501082_0368206 3300060353 Unclassified 1253

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_101312182 Ga0068854_1013121821 93
2 3300037471 Ga0395905_0207977 Ga0395905_0207977_400_882 96
3 3300005844 Ga0068862_100949617 Ga0068862_1009496172 116
4 3300028380 Ga0268265_10362855 Ga0268265_103628552 116
5 3300005471 Ga0070698_100461068 Ga0070698_1004610682 121
6 3300005337 Ga0070682_100003975 Ga0070682_1000039753 130
7 3300041512 Ga0451853_0673947 Ga0451853_0673947_15_464 130
8 3300049586 Ga0501070_0957478 Ga0501070_0957478_10_405 130
9 3300013297 Ga0157378_10352066 Ga0157378_103520663 131
10 iso_pu_bacteria 2582581279 2585148822 133
11 iso_pu_bacteria 2889415604 2889418019 134
12 iso_pu_bacteria 2920107658 2920109735 134
13 3300005327 Ga0070658_10183796 Ga0070658_101837961 135
14 3300005535 Ga0070684_101213764 Ga0070684_1012137642 135
15 3300005843 Ga0068860_100487655 Ga0068860_1004876552 135
16 3300005844 Ga0068862_100334436 Ga0068862_1003344362 135
17 3300007076 Ga0075435_101919926 Ga0075435_1019199261 135
18 3300009174 Ga0105241_11287361 Ga0105241_112873611 135
19 3300009177 Ga0105248_10809508 Ga0105248_108095082 135
20 3300009545 Ga0105237_11096217 Ga0105237_110962171 135
21 3300010375 Ga0105239_10276567 Ga0105239_102765672 135
22 3300013306 Ga0163162_11563708 Ga0163162_115637083 135
23 3300025911 Ga0207654_10409854 Ga0207654_104098541 135
24 3300025911 Ga0207654_10764838 Ga0207654_107648381 135
25 3300025914 Ga0207671_10778749 Ga0207671_107787491 135
26 3300028381 Ga0268264_10402343 Ga0268264_104023432 135
27 3300035695 Ga0373927_0640879 Ga0373927_0640879_54_488 135
28 3300046457 Ga0495590_0001380 Ga0495590_0001380_1172_1612 135
29 3300046463 Ga0495653_0230073 Ga0495653_0230073_225_659 135
30 3300046472 Ga0495580_0030020 Ga0495580_0030020_1882_2316 135
31 3300046475 Ga0495639_0030420 Ga0495639_0030420_1065_1499 135
32 3300046511 Ga0495608_0052346 Ga0495608_0052346_1131_1565 135
33 3300046513 Ga0495616_0064529 Ga0495616_0064529_912_1352 135
34 3300046517 Ga0495630_0100319 Ga0495630_0100319_1443_1877 135
35 3300046518 Ga0495631_0000959 Ga0495631_0000959_2480_2920 135
36 3300046520 Ga0495637_0061753 Ga0495637_0061753_438_878 135
37 3300046524 Ga0495648_0001204 Ga0495648_0001204_2700_3140 135
38 3300046616 Ga0495668_0001975 Ga0495668_0001975_8836_9276 135
39 3300046663 Ga0495635_0768723 Ga0495635_0768723_152_586 135
40 3300046690 Ga0495624_0003185 Ga0495624_0003185_10510_10944 135
41 3300047315 Ga0495581_0013350 Ga0495581_0013350_2444_2878 135
42 3300047319 Ga0495674_0006880 Ga0495674_0006880_6835_7269 135
43 3300047321 Ga0495676_0110652 Ga0495676_0110652_1272_1706 135
44 3300047444 Ga0495675_0126203 Ga0495675_0126203_1001_1435 135
45 3300047469 Ga0495673_0000467 Ga0495673_0000467_22149_22589 135
46 3300047471 Ga0495684_0001201 Ga0495684_0001201_14658_15092 135
47 3300047472 Ga0495686_0004684 Ga0495686_0004684_1320_1760 135
48 3300048927 Ga0496124_0324714 Ga0496124_0324714_602_1042 135
49 3300048928 Ga0496125_0028483 Ga0496125_0028483_1845_2285 135
50 3300048929 Ga0496126_0027785 Ga0496126_0027785_2846_3286 135
51 3300049581 Ga0501047_0203183 Ga0501047_0203183_568_1005 135
52 3300050514 nmdc:mga08x19_39459_c1 nmdc:mga08x19_39459_c1_744_1151 135
53 3300053087 Ga0500643_059715 Ga0500643_059715_218_658 135
54 3300053088 Ga0500644_0000232 Ga0500644_0000232_4387_4827 135
55 3300053096 Ga0500641_0024205 Ga0500641_0024205_1845_2285 135
56 3300053108 Ga0500562_009930 Ga0500562_009930_587_1027 135
57 3300053138 Ga0500564_000067 Ga0500564_000067_22730_23170 135
58 3300053156 Ga0500622_0003240 Ga0500622_0003240_1468_1908 135
59 3300055283 Ga0500661_088333 Ga0500661_088333_46_486 135
60 3300005334 Ga0068869_101670386 Ga0068869_1016703861 137
61 3300005355 Ga0070671_100595293 Ga0070671_1005952932 137
62 3300005364 Ga0070673_100139788 Ga0070673_1001397883 137
63 3300006358 Ga0068871_101171609 Ga0068871_1011716091 137
64 3300009176 Ga0105242_10165213 Ga0105242_101652131 137
65 3300013308 Ga0157375_12900427 Ga0157375_129004271 137
66 3300025960 Ga0207651_10225484 Ga0207651_102254842 137
67 iso_pu_bacteria 2687453257 2688070300 137
68 2162886012 MBSR1b_contig_5261811 MBSR1b_0417.00004310 138
69 3300003323 rootH1_10056446 rootH1_100564464 138
70 3300005293 Ga0065715_10930145 Ga0065715_109301451 138
71 3300005328 Ga0070676_10012476 Ga0070676_100124762 138
72 3300005328 Ga0070676_10624327 Ga0070676_106243272 138
73 3300005333 Ga0070677_10049851 Ga0070677_100498512 138
74 3300005333 Ga0070677_10060727 Ga0070677_100607273 138
75 3300005333 Ga0070677_10295822 Ga0070677_102958221 138
76 3300005333 Ga0070677_10576456 Ga0070677_105764561 138
77 3300005333 Ga0070677_10759843 Ga0070677_107598431 138
78 3300005334 Ga0068869_100000479 Ga0068869_1000004796 138
79 3300005334 Ga0068869_100025000 Ga0068869_1000250002 138
80 3300005335 Ga0070666_10461304 Ga0070666_104613041 138
81 3300005336 Ga0070680_100107389 Ga0070680_1001073894 138
82 3300005338 Ga0068868_100104069 Ga0068868_1001040693 138
83 3300005343 Ga0070687_100069546 Ga0070687_1000695462 138
84 3300005353 Ga0070669_100506328 Ga0070669_1005063282 138
85 3300005353 Ga0070669_100562851 Ga0070669_1005628512 138
86 3300005354 Ga0070675_100005942 Ga0070675_10000594210 138
87 3300005354 Ga0070675_100013178 Ga0070675_1000131782 138
88 3300005354 Ga0070675_100196644 Ga0070675_1001966442 138
89 3300005356 Ga0070674_100050501 Ga0070674_1000505012 138
90 3300005364 Ga0070673_100004944 Ga0070673_10000494410 138
91 3300005365 Ga0070688_100341127 Ga0070688_1003411272 138
92 3300005365 Ga0070688_100544092 Ga0070688_1005440922 138
93 3300005367 Ga0070667_100680644 Ga0070667_1006806441 138
94 3300005438 Ga0070701_10705594 Ga0070701_107055941 138
95 3300005438 Ga0070701_10902396 Ga0070701_109023961 138
96 3300005440 Ga0070705_100295194 Ga0070705_1002951942 138
97 3300005440 Ga0070705_100446399 Ga0070705_1004463992 138
98 3300005441 Ga0070700_100004859 Ga0070700_1000048593 138
99 3300005444 Ga0070694_100101079 Ga0070694_1001010793 138
100 3300005445 Ga0070708_100248413 Ga0070708_1002484133 138
101 3300005455 Ga0070663_100007672 Ga0070663_1000076722 138
102 3300005455 Ga0070663_100591721 Ga0070663_1005917212 138
103 3300005456 Ga0070678_100258398 Ga0070678_1002583982 138
104 3300005457 Ga0070662_100026677 Ga0070662_1000266772 138
105 3300005459 Ga0068867_100001315 Ga0068867_10000131518 138
106 3300005459 Ga0068867_100063372 Ga0068867_1000633723 138
107 3300005459 Ga0068867_100248507 Ga0068867_1002485072 138
108 3300005459 Ga0068867_100309875 Ga0068867_1003098753 138
109 3300005466 Ga0070685_10340912 Ga0070685_103409122 138
110 3300005468 Ga0070707_100590887 Ga0070707_1005908872 138
111 3300005471 Ga0070698_100013163 Ga0070698_1000131633 138
112 3300005471 Ga0070698_100177000 Ga0070698_1001770002 138
113 3300005471 Ga0070698_100230239 Ga0070698_1002302392 138
114 3300005471 Ga0070698_100825998 Ga0070698_1008259982 138
115 3300005471 Ga0070698_101026581 Ga0070698_1010265812 138
116 3300005518 Ga0070699_100036496 Ga0070699_1000364964 138
117 3300005518 Ga0070699_100157899 Ga0070699_1001578993 138
118 3300005530 Ga0070679_100063499 Ga0070679_1000634991 138
119 3300005536 Ga0070697_101323899 Ga0070697_1013238991 138
120 3300005543 Ga0070672_100023354 Ga0070672_1000233545 138
121 3300005543 Ga0070672_100038109 Ga0070672_1000381093 138
122 3300005543 Ga0070672_100343945 Ga0070672_1003439452 138
123 3300005544 Ga0070686_100586490 Ga0070686_1005864901 138
124 3300005545 Ga0070695_100217126 Ga0070695_1002171262 138
125 3300005545 Ga0070695_100350559 Ga0070695_1003505591 138
126 3300005545 Ga0070695_101200210 Ga0070695_1012002101 138
127 3300005545 Ga0070695_101514255 Ga0070695_1015142551 138
128 3300005546 Ga0070696_100695993 Ga0070696_1006959931 138
129 3300005549 Ga0070704_100083272 Ga0070704_1000832722 138
130 3300005563 Ga0068855_100001616 Ga0068855_10000161611 138
131 3300005563 Ga0068855_101429259 Ga0068855_1014292591 138
132 3300005564 Ga0070664_100514412 Ga0070664_1005144121 138
133 3300005577 Ga0068857_100368260 Ga0068857_1003682602 138
134 3300005578 Ga0068854_100074821 Ga0068854_1000748212 138
135 3300005578 Ga0068854_100485605 Ga0068854_1004856052 138
136 3300005615 Ga0070702_101303938 Ga0070702_1013039381 138
137 3300005617 Ga0068859_100050250 Ga0068859_1000502502 138
138 3300005617 Ga0068859_100164104 Ga0068859_1001641044 138
139 3300005617 Ga0068859_100571173 Ga0068859_1005711732 138
140 3300005617 Ga0068859_100626139 Ga0068859_1006261393 138
141 3300005618 Ga0068864_100276598 Ga0068864_1002765982 138
142 3300005718 Ga0068866_10020520 Ga0068866_100205202 138
143 3300005718 Ga0068866_10031308 Ga0068866_100313082 138
144 3300005718 Ga0068866_10326106 Ga0068866_103261061 138
145 3300005719 Ga0068861_100026746 Ga0068861_1000267465 138
146 3300005719 Ga0068861_100910531 Ga0068861_1009105312 138
147 3300005719 Ga0068861_102683235 Ga0068861_1026832351 138
148 3300005834 Ga0068851_10188091 Ga0068851_101880912 138
149 3300005840 Ga0068870_10109321 Ga0068870_101093213 138
150 3300005840 Ga0068870_10147492 Ga0068870_101474922 138
151 3300005841 Ga0068863_100068356 Ga0068863_1000683562 138
152 3300005841 Ga0068863_100354019 Ga0068863_1003540193 138
153 3300005841 Ga0068863_100447906 Ga0068863_1004479062 138
154 3300005842 Ga0068858_100063971 Ga0068858_1000639712 138
155 3300005842 Ga0068858_100103979 Ga0068858_1001039793 138
156 3300005842 Ga0068858_100113069 Ga0068858_1001130692 138
157 3300005842 Ga0068858_100197199 Ga0068858_1001971992 138
158 3300005842 Ga0068858_100966741 Ga0068858_1009667412 138
159 3300005843 Ga0068860_100046431 Ga0068860_1000464312 138
160 3300005843 Ga0068860_101322174 Ga0068860_1013221742 138
161 3300005843 Ga0068860_102420544 Ga0068860_1024205442 138
162 3300005844 Ga0068862_100031169 Ga0068862_1000311695 138
163 3300005844 Ga0068862_100315344 Ga0068862_1003153442 138
164 3300006028 Ga0070717_11771893 Ga0070717_117718932 138
165 3300006163 Ga0070715_10133777 Ga0070715_101337772 138
166 3300006237 Ga0097621_100001766 Ga0097621_1000017669 138
167 3300006237 Ga0097621_100797279 Ga0097621_1007972792 138
168 3300006358 Ga0068871_100007340 Ga0068871_1000073403 138
169 3300006844 Ga0075428_100000014 Ga0075428_10000001466 138
170 3300006844 Ga0075428_100815066 Ga0075428_1008150662 138
171 3300006846 Ga0075430_101135656 Ga0075430_1011356562 138
172 3300006847 Ga0075431_100299343 Ga0075431_1002993432 138
173 3300006852 Ga0075433_10203186 Ga0075433_102031862 138
174 3300006852 Ga0075433_10333334 Ga0075433_103333342 138
175 3300006852 Ga0075433_10340490 Ga0075433_103404902 138
176 3300006871 Ga0075434_100097789 Ga0075434_1000977894 138
177 3300006871 Ga0075434_100428229 Ga0075434_1004282292 138
178 3300006871 Ga0075434_101295601 Ga0075434_1012956011 138
179 3300006871 Ga0075434_102424202 Ga0075434_1024242021 138
180 3300006881 Ga0068865_100000656 Ga0068865_1000006565 138
181 3300006881 Ga0068865_100039333 Ga0068865_1000393332 138
182 3300006881 Ga0068865_100139809 Ga0068865_1001398092 138
183 3300006914 Ga0075436_100089629 Ga0075436_1000896293 138
184 3300006931 Ga0097620_100050248 Ga0097620_1000502482 138
185 3300006931 Ga0097620_100164115 Ga0097620_1001641154 138
186 3300006931 Ga0097620_100571183 Ga0097620_1005711832 138
187 3300006931 Ga0097620_100626118 Ga0097620_1006261183 138
188 3300007076 Ga0075435_100593285 Ga0075435_1005932852 138
189 3300007076 Ga0075435_100869295 Ga0075435_1008692952 138
190 3300007076 Ga0075435_101387892 Ga0075435_1013878922 138
191 3300009094 Ga0111539_10000019 Ga0111539_1000001944 138
192 3300009094 Ga0111539_10223853 Ga0111539_102238534 138
193 3300009098 Ga0105245_10410469 Ga0105245_104104692 138
194 3300009098 Ga0105245_10947494 Ga0105245_109474942 138
195 3300009101 Ga0105247_10023193 Ga0105247_100231933 138
196 3300009101 Ga0105247_10498383 Ga0105247_104983832 138
197 3300009147 Ga0114129_10164868 Ga0114129_101648684 138
198 3300009147 Ga0114129_10209452 Ga0114129_102094524 138
199 3300009147 Ga0114129_10230569 Ga0114129_102305694 138
200 3300009147 Ga0114129_10737867 Ga0114129_107378673 138
201 3300009147 Ga0114129_10850979 Ga0114129_108509793 138
202 3300009148 Ga0105243_10016949 Ga0105243_100169497 138
203 3300009148 Ga0105243_12407368 Ga0105243_124073681 138
204 3300009176 Ga0105242_10597350 Ga0105242_105973502 138
205 3300009177 Ga0105248_10090126 Ga0105248_100901264 138
206 3300009177 Ga0105248_10091290 Ga0105248_100912901 138
207 3300009177 Ga0105248_10668718 Ga0105248_106687181 138
208 3300009177 Ga0105248_10868813 Ga0105248_108688132 138
209 3300009545 Ga0105237_10066997 Ga0105237_100669973 138
210 3300009551 Ga0105238_10024553 Ga0105238_100245534 138
211 3300009551 Ga0105238_10359914 Ga0105238_103599142 138
212 3300009553 Ga0105249_10228523 Ga0105249_102285232 138
213 3300009553 Ga0105249_12089497 Ga0105249_120894972 138
214 3300013297 Ga0157378_10343377 Ga0157378_103433771 138
215 3300013306 Ga0163162_10816839 Ga0163162_108168391 138
216 3300013308 Ga0157375_10096115 Ga0157375_100961154 138
217 3300013308 Ga0157375_11124914 Ga0157375_111249142 138
218 3300014325 Ga0163163_10156320 Ga0163163_101563202 138
219 3300014325 Ga0163163_10913543 Ga0163163_109135432 138
220 3300014326 Ga0157380_10048505 Ga0157380_100485053 138
221 3300014326 Ga0157380_10099214 Ga0157380_100992144 138
222 3300014326 Ga0157380_10099647 Ga0157380_100996472 138
223 3300014326 Ga0157380_10216237 Ga0157380_102162372 138
224 3300014745 Ga0157377_10077854 Ga0157377_100778542 138
225 3300014968 Ga0157379_10009443 Ga0157379_100094433 138
226 3300014969 Ga0157376_10256150 Ga0157376_102561502 138
227 3300017792 Ga0163161_10175598 Ga0163161_101755982 138
228 3300025885 Ga0207653_10053223 Ga0207653_100532231 138
229 3300025893 Ga0207682_10011010 Ga0207682_100110102 138
230 3300025893 Ga0207682_10612310 Ga0207682_106123101 138
231 3300025899 Ga0207642_10034298 Ga0207642_100342983 138
232 3300025899 Ga0207642_10078792 Ga0207642_100787921 138
233 3300025899 Ga0207642_10820770 Ga0207642_108207701 138
234 3300025903 Ga0207680_10206518 Ga0207680_102065182 138
235 3300025906 Ga0207699_10816164 Ga0207699_108161642 138
236 3300025907 Ga0207645_10006720 Ga0207645_100067203 138
237 3300025907 Ga0207645_10018540 Ga0207645_100185402 138
238 3300025908 Ga0207643_10017840 Ga0207643_100178402 138
239 3300025908 Ga0207643_10092160 Ga0207643_100921603 138
240 3300025910 Ga0207684_10776282 Ga0207684_107762822 138
241 3300025913 Ga0207695_11635965 Ga0207695_116359651 138
242 3300025914 Ga0207671_10238405 Ga0207671_102384052 138
243 3300025921 Ga0207652_10037753 Ga0207652_100377534 138
244 3300025922 Ga0207646_10457515 Ga0207646_104575152 138
245 3300025922 Ga0207646_11218960 Ga0207646_112189602 138
246 3300025923 Ga0207681_10072991 Ga0207681_100729913 138
247 3300025923 Ga0207681_10097171 Ga0207681_100971713 138
248 3300025924 Ga0207694_10013517 Ga0207694_100135173 138
249 3300025926 Ga0207659_10002587 Ga0207659_100025877 138
250 3300025926 Ga0207659_10015657 Ga0207659_100156572 138
251 3300025933 Ga0207706_10088704 Ga0207706_100887042 138
252 3300025933 Ga0207706_10326983 Ga0207706_103269832 138
253 3300025933 Ga0207706_10514002 Ga0207706_105140021 138
254 3300025934 Ga0207686_10251152 Ga0207686_102511522 138
255 3300025935 Ga0207709_10198169 Ga0207709_101981692 138
256 3300025937 Ga0207669_10052694 Ga0207669_100526942 138
257 3300025937 Ga0207669_10596183 Ga0207669_105961832 138
258 3300025937 Ga0207669_11118284 Ga0207669_111182842 138
259 3300025938 Ga0207704_10001153 Ga0207704_100011535 138
260 3300025938 Ga0207704_10005959 Ga0207704_100059592 138
261 3300025938 Ga0207704_10196014 Ga0207704_101960141 138
262 3300025940 Ga0207691_10081698 Ga0207691_100816982 138
263 3300025940 Ga0207691_10100194 Ga0207691_101001944 138
264 3300025940 Ga0207691_10106164 Ga0207691_101061644 138
265 3300025942 Ga0207689_10006551 Ga0207689_1000655110 138
266 3300025949 Ga0207667_10001645 Ga0207667_1000164511 138
267 3300025949 Ga0207667_11001536 Ga0207667_110015362 138
268 3300025960 Ga0207651_10003494 Ga0207651_100034945 138
269 3300025960 Ga0207651_10154416 Ga0207651_101544162 138
270 3300025960 Ga0207651_10178394 Ga0207651_101783942 138
271 3300025972 Ga0207668_11876612 Ga0207668_118766121 138
272 3300025981 Ga0207640_10026096 Ga0207640_100260965 138
273 3300025981 Ga0207640_10317199 Ga0207640_103171992 138
274 3300026023 Ga0207677_10296230 Ga0207677_102962302 138
275 3300026035 Ga0207703_10030855 Ga0207703_100308555 138
276 3300026035 Ga0207703_10054646 Ga0207703_100546465 138
277 3300026035 Ga0207703_10200724 Ga0207703_102007242 138
278 3300026035 Ga0207703_10403413 Ga0207703_104034132 138
279 3300026035 Ga0207703_10557540 Ga0207703_105575402 138
280 3300026067 Ga0207678_10182176 Ga0207678_101821762 138
281 3300026075 Ga0207708_10009974 Ga0207708_100099747 138
282 3300026088 Ga0207641_10197823 Ga0207641_101978233 138
283 3300026088 Ga0207641_10544316 Ga0207641_105443162 138
284 3300026088 Ga0207641_12029734 Ga0207641_120297341 138
285 3300026089 Ga0207648_10001506 Ga0207648_1000150612 138
286 3300026089 Ga0207648_10006656 Ga0207648_100066563 138
287 3300026089 Ga0207648_10211446 Ga0207648_102114463 138
288 3300026089 Ga0207648_10623424 Ga0207648_106234242 138
289 3300026089 Ga0207648_10629698 Ga0207648_106296982 138
290 3300026095 Ga0207676_10033802 Ga0207676_100338022 138
291 3300026116 Ga0207674_10497229 Ga0207674_104972292 138
292 3300026116 Ga0207674_10659914 Ga0207674_106599142 138
293 3300026118 Ga0207675_100007856 Ga0207675_1000078569 138
294 3300026118 Ga0207675_100014801 Ga0207675_1000148011 138
295 3300026118 Ga0207675_100209009 Ga0207675_1002090093 138
296 3300026118 Ga0207675_101527620 Ga0207675_1015276202 138
297 3300026121 Ga0207683_10154432 Ga0207683_101544322 138
298 3300026121 Ga0207683_10315761 Ga0207683_103157612 138
299 3300027614 Ga0209970_1022008 Ga0209970_10220082 138
300 3300027617 Ga0210002_1012711 Ga0210002_10127113 138
301 3300027682 Ga0209971_1008243 Ga0209971_10082433 138
302 3300027717 Ga0209998_10006654 Ga0209998_100066543 138
303 3300027907 Ga0207428_10000052 Ga0207428_1000005274 138
304 3300028379 Ga0268266_10715254 Ga0268266_107152542 138
305 3300028380 Ga0268265_10017802 Ga0268265_100178022 138
306 3300028380 Ga0268265_10446161 Ga0268265_104461612 138
307 3300028381 Ga0268264_10085208 Ga0268264_100852082 138
308 3300028381 Ga0268264_11057044 Ga0268264_110570441 138
309 3300028381 Ga0268264_11363564 Ga0268264_113635642 138
310 3300028577 Ga0265318_10046863 Ga0265318_100468633 138
311 3300031235 Ga0265330_10003361 Ga0265330_100033611 138
312 3300031250 Ga0265331_10101465 Ga0265331_101014652 138
313 3300031344 Ga0265316_10004947 Ga0265316_100049471 138
314 3300031548 Ga0307408_101257214 Ga0307408_1012572142 138
315 3300032002 Ga0307416_100170571 Ga0307416_1001705713 138
316 3300032005 Ga0307411_10042742 Ga0307411_100427426 138
317 3300035090 Ga0373949_0141798 Ga0373949_0141798_205_624 138
318 3300035118 Ga0373954_0557040 Ga0373954_0557040_33_449 138
319 3300035119 Ga0373956_0257213 Ga0373956_0257213_329_745 138
320 3300035170 Ga0373943_0143324 Ga0373943_0143324_536_952 138
321 3300035171 Ga0373946_0103634 Ga0373946_0103634_174_590 138
322 3300035172 Ga0373955_0254190 Ga0373955_0254190_383_799 138
323 3300035695 Ga0373927_0413652 Ga0373927_0413652_389_805 138
324 3300035725 Ga0373947_0142330 Ga0373947_0142330_818_1237 138
325 3300036401 Ga0373937_0819190 Ga0373937_0819190_315_731 138
326 3300036401 Ga0373937_0905584 Ga0373937_0905584_328_744 138
327 3300036401 Ga0373937_1400969 Ga0373937_1400969_160_579 138
328 3300039437 Ga0436365_0745133 Ga0436365_0745133_114_530 138
329 3300039437 Ga0436365_1243498 Ga0436365_1243498_55_510 138
330 3300041507 Ga0451851_0919857 Ga0451851_0919857_112_528 138
331 3300041511 Ga0451855_0271469 Ga0451855_0271469_605_1036 138
332 3300041512 Ga0451853_1532330 Ga0451853_1532330_148_564 138
333 3300042876 Ga0451577_0392063 Ga0451577_0392063_365_784 138
334 3300044673 Ga0453683_1156922 Ga0453683_1156922_28_447 138
335 3300044712 Ga0453684_1240240 Ga0453684_1240240_52_471 138
336 3300045051 Ga0451576_0097096 Ga0451576_0097096_482_901 138
337 3300046454 Ga0495592_0070985 Ga0495592_0070985_501_917 138
338 3300046459 Ga0495629_0376566 Ga0495629_0376566_403_819 138
339 3300046511 Ga0495608_0007428 Ga0495608_0007428_4280_4696 138
340 3300046511 Ga0495608_0562119 Ga0495608_0562119_123_542 138
341 3300046516 Ga0495628_0046322 Ga0495628_0046322_1623_2039 138
342 3300046516 Ga0495628_0254690 Ga0495628_0254690_157_573 138
343 3300046517 Ga0495630_0002332 Ga0495630_0002332_12381_12797 138
344 3300046519 Ga0495632_0065068 Ga0495632_0065068_1063_1482 138
345 3300046529 Ga0495652_0280253 Ga0495652_0280253_525_941 138
346 3300046536 Ga0495587_0137343 Ga0495587_0137343_916_1332 138
347 3300046537 Ga0495598_0230498 Ga0495598_0230498_29_445 138
348 3300046543 Ga0495645_0015700 Ga0495645_0015700_4839_5255 138
349 3300046543 Ga0495645_0051538 Ga0495645_0051538_2397_2813 138
350 3300046559 Ga0495667_0153925 Ga0495667_0153925_61_477 138
351 3300046674 Ga0495588_0015439 Ga0495588_0015439_550_966 138
352 3300046674 Ga0495588_0449803 Ga0495588_0449803_51_467 138
353 3300046675 Ga0495657_0059434 Ga0495657_0059434_527_943 138
354 3300046683 Ga0495658_0273454 Ga0495658_0273454_561_977 138
355 3300046689 Ga0495613_0003284 Ga0495613_0003284_3785_4201 138
356 3300047317 Ga0495604_0046402 Ga0495604_0046402_1855_2271 138
357 3300047317 Ga0495604_0265532 Ga0495604_0265532_178_594 138
358 3300047319 Ga0495674_0028422 Ga0495674_0028422_4413_4829 138
359 3300047319 Ga0495674_0096285 Ga0495674_0096285_312_728 138
360 3300047319 Ga0495674_1114024 Ga0495674_1114024_62_481 138
361 3300047322 Ga0495680_0092576 Ga0495680_0092576_200_616 138
362 3300047471 Ga0495684_0001466 Ga0495684_0001466_6100_6516 138
363 3300048905 Ga0496102_0874169 Ga0496102_0874169_191_679 138
364 3300048907 Ga0496104_0091509 Ga0496104_0091509_150_566 138
365 3300048917 Ga0496114_0635375 Ga0496114_0635375_347_763 138
366 3300049569 Ga0501032_0003486 Ga0501032_0003486_11152_11571 138
367 3300049569 Ga0501032_0057117 Ga0501032_0057117_453_872 138
368 3300049570 Ga0501033_0001449 Ga0501033_0001449_458_877 138
369 3300049570 Ga0501033_0055195 Ga0501033_0055195_617_1036 138
370 3300049571 Ga0501034_0009066 Ga0501034_0009066_6778_7197 138
371 3300049571 Ga0501034_0595281 Ga0501034_0595281_525_974 138
372 3300049572 Ga0501036_0039160 Ga0501036_0039160_1844_2263 138
373 3300049573 Ga0501037_0004510 Ga0501037_0004510_4119_4538 138
374 3300049573 Ga0501037_0181849 Ga0501037_0181849_53_472 138
375 3300049574 Ga0501038_0004235 Ga0501038_0004235_10250_10669 138
376 3300049574 Ga0501038_0041841 Ga0501038_0041841_1754_2173 138
377 3300049575 Ga0501039_0129100 Ga0501039_0129100_1410_1829 138
378 3300049576 Ga0501040_0038360 Ga0501040_0038360_710_1129 138
379 3300049578 Ga0501042_0161797 Ga0501042_0161797_982_1401 138
380 3300049579 Ga0501043_0026437 Ga0501043_0026437_2415_2834 138
381 3300049579 Ga0501043_0121734 Ga0501043_0121734_311_730 138
382 3300049580 Ga0501046_0001361 Ga0501046_0001361_8824_9243 138
383 3300049580 Ga0501046_0293983 Ga0501046_0293983_624_1043 138
384 3300049581 Ga0501047_0004167 Ga0501047_0004167_12290_12709 138
385 3300049581 Ga0501047_0361813 Ga0501047_0361813_444_863 138
386 3300049582 Ga0501048_0000445 Ga0501048_0000445_7231_7650 138
387 3300049582 Ga0501048_0054766 Ga0501048_0054766_1961_2380 138
388 3300049583 Ga0501067_0020194 Ga0501067_0020194_1118_1537 138
389 3300049584 Ga0501068_0004738 Ga0501068_0004738_6725_7144 138
390 3300049584 Ga0501068_0020014 Ga0501068_0020014_1517_1936 138
391 3300049585 Ga0501069_0014170 Ga0501069_0014170_1961_2380 138
392 3300049586 Ga0501070_0004493 Ga0501070_0004493_458_877 138
393 3300049586 Ga0501070_0098462 Ga0501070_0098462_904_1353 138
394 3300049586 Ga0501070_0158462 Ga0501070_0158462_1122_1541 138
395 3300049587 Ga0501071_0147514 Ga0501071_0147514_231_650 138
396 3300049587 Ga0501071_0882567 Ga0501071_0882567_248_667 138
397 3300049588 Ga0501072_0177375 Ga0501072_0177375_45_464 138
398 3300049588 Ga0501072_1425306 Ga0501072_1425306_82_501 138
399 3300049589 Ga0501073_0031493 Ga0501073_0031493_458_877 138
400 3300049589 Ga0501073_0233413 Ga0501073_0233413_768_1187 138
401 3300049590 Ga0501074_0039866 Ga0501074_0039866_1350_1769 138
402 3300049590 Ga0501074_0075915 Ga0501074_0075915_36_455 138
403 3300049704 Ga0501221_118166 Ga0501221_118166_13_429 138
404 3300049708 Ga0501245_079245 Ga0501245_079245_133_549 138
405 3300049741 Ga0501079_0142864 Ga0501079_0142864_162_581 138
406 3300049741 Ga0501079_0431508 Ga0501079_0431508_379_798 138
407 3300049742 Ga0501080_0003186 Ga0501080_0003186_458_877 138
408 3300049742 Ga0501080_1771115 Ga0501080_1771115_17_436 138
409 3300049743 Ga0501081_1195984 Ga0501081_1195984_61_480 138
410 3300049744 Ga0501083_0063038 Ga0501083_0063038_1227_1646 138
411 3300049779 Ga0501283_035813 Ga0501283_035813_395_811 138
412 3300049822 Ga0501035_0008847 Ga0501035_0008847_72_491 138
413 3300049822 Ga0501035_0108590 Ga0501035_0108590_1902_2321 138
414 3300049823 Ga0501044_0055671 Ga0501044_0055671_326_745 138
415 3300049824 Ga0501045_0050854 Ga0501045_0050854_155_574 138
416 3300050493 nmdc:mga0k408_939095_c1 nmdc:mga0k408_939095_c1_45_461 138
417 3300050494 nmdc:mga06z11_104358_c1 nmdc:mga06z11_104358_c1_572_994 138
418 3300050495 nmdc:mga04h51_130584_c1 nmdc:mga04h51_130584_c1_108_542 138
419 3300050507 nmdc:mga05p37_1335142_c1 nmdc:mga05p37_1335142_c1_260_676 138
420 3300050507 nmdc:mga05p37_58120_c1 nmdc:mga05p37_58120_c1_3295_3711 138
421 3300050507 nmdc:mga05p37_75932_c1 nmdc:mga05p37_75932_c1_26_442 138
422 3300050510 nmdc:mga06r32_952268_c1 nmdc:mga06r32_952268_c1_83_499 138
423 3300050511 nmdc:mga08y16_14_c1 nmdc:mga08y16_14_c1_322053_322472 138
424 3300050512 nmdc:mga0n895_1176012_c1 nmdc:mga0n895_1176012_c1_42_458 138
425 3300050512 nmdc:mga0n895_1232157_c1 nmdc:mga0n895_1232157_c1_126_542 138
426 3300050513 nmdc:mga0rr50_1102507_c1 nmdc:mga0rr50_1102507_c1_188_607 138
427 3300050513 nmdc:mga0rr50_878136_c1 nmdc:mga0rr50_878136_c1_61_477 138
428 3300050515 nmdc:mga0a205_297280_c1 nmdc:mga0a205_297280_c1_660_1076 138
429 3300050515 nmdc:mga0a205_37348_c1 nmdc:mga0a205_37348_c1_4037_4495 138
430 3300053077 Ga0495601_0013185 Ga0495601_0013185_3167_3583 138
431 3300053084 Ga0495595_0467145 Ga0495595_0467145_68_484 138
432 3300053085 Ga0495619_0001983 Ga0495619_0001983_7894_8310 138
433 3300053085 Ga0495619_0243682 Ga0495619_0243682_375_794 138
434 3300053092 Ga0500583_0000312 Ga0500583_0000312_8365_8784 138
435 3300053092 Ga0500583_0056715 Ga0500583_0056715_1143_1562 138
436 3300053096 Ga0500641_0004693 Ga0500641_0004693_3849_4418 138
437 3300053096 Ga0500641_0045618 Ga0500641_0045618_1150_1569 138
438 3300054114 Ga0501084_0111896 Ga0501084_0111896_125_544 138
439 3300060353 Ga0501082_0172154 Ga0501082_0172154_145_564 138
440 3300060353 Ga0501082_0368206 Ga0501082_0368206_418_837 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

24

161

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0k-assembly1.cif.gz_A membrane protein structure 0.9045 5 138
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8501 5 138
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.817 5 138
7b0k-assembly1.cif.gz_A membrane protein structure 0.799 5 138
5hx1-assembly2.cif.gz_D crystal structure of dr2231_e46a mutant in complex with dump and magnesium 0.6795 85 136
ID Description Score Start End Superfamily
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8954 61 136 1.10.3730.20
af_Q5A5P7_5_125_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8405 76 136 1.10.3730.20
af_Q3C1C7_10_111_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8182 68 135 1.10.3730.20
af_Q8RWH8_5_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8152 75 136 1.10.3730.20
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8063 62 136 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A519VE27-F1-model_v4 EamA family transporter 0.9968 3 138 GO:0016020
AF-A0A0X8JIY0-F1-model_v4 EamA domain-containing protein 0.996 3 138 GO:0016020
AF-A0A2R3MXU3-F1-model_v4 EamA domain-containing protein 0.9956 3 138 GO:0016020
AF-A0A7C4T326-F1-model_v4 EamA family transporter 0.995 3 138 GO:0016020
AF-A0A3B7N1N1-F1-model_v4 EamA family transporter 0.9946 3 138 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.89 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map