F444424
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 440 | 244 | 421 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10373992|Ga0157375_103739922 |
| Length | 353 |
| Sequence | MSTTPAAASGTRRTPTERPDELDRTDPARHVAESAEAFRNWGRWGEDDRLGTLNFIGDAERARAATLVRRGASFSLSQPFDMNGPQQGWRRRTNPVHTMLDTGTDAAAGTQGFPHGIGGADDVVAMPLQCSTQWDGLGHIFDRGMAWNGRPAGSVVTSDGDLVTGIEHAASAIVGRGVLLDLGRFLRPEPTDDDADNGAVGELPDGYAITTAELEACISAQGATSAVGRGDLVLVRTGRYARALREGWNGYAGGPSAGLSFTTAGWLHRTEIAAIATDTWGFEVRPNEFDVPAFQPLHQVVIPNLGLTIGEMWDLDELGDVCAQTRRYHFFLSAPPLPITGAVGSPINPVAIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 4 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 5 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 6 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 7 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 8 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 9 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 10 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 11 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 12 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 13 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 14 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 15 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 16 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 17 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 18 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 19 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 156 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 157 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 158 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 159 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 160 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 161 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 162 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 163 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 164 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 165 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 166 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 167 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 168 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 169 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 170 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 171 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 172 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 173 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 205 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 206 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 207 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 208 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 209 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 210 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 211 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 212 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 225 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 233 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 235 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 236 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 237 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 238 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 239 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 240 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 243 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 244 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.68 |
| Metatranscriptomes | 0 |
| Isolates | 4.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.59 |
| Nodule | 0 |
| Rhizoplane | 9.32 |
| Rhizosphere | 66.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1002490 | 3300001977 | Bacteria | 2934 |
| 2 | JGI24744J21845_10002573 | 3300002077 | Bacteria | 3704 |
| 3 | JGI24744J21845_10003112 | 3300002077 | Bacteria | 3401 |
| 4 | JGI24034J26672_10013465 | 3300002239 | Bacteria | 1241 |
| 5 | Ga0065714_10081064 | 3300005288 | Bacteria | 2399 |
| 6 | Ga0068869_100015510 | 3300005334 | Bacteria | 5114 |
| 7 | Ga0068869_100069444 | 3300005334 | Bacteria | 2605 |
| 8 | Ga0070682_100081387 | 3300005337 | Bacteria | 2096 |
| 9 | Ga0068868_100052337 | 3300005338 | Bacteria | 3214 |
| 10 | Ga0068868_100306585 | 3300005338 | Bacteria | 1350 |
| 11 | Ga0070691_10099316 | 3300005341 | Bacteria | 1444 |
| 12 | Ga0070668_100000415 | 3300005347 | Bacteria | 28362 |
| 13 | Ga0070668_100003680 | 3300005347 | Bacteria | 11320 |
| 14 | Ga0070668_100096244 | 3300005347 | Bacteria | 2340 |
| 15 | Ga0070668_100125449 | 3300005347 | Bacteria | 2056 |
| 16 | Ga0070668_100139978 | 3300005347 | Bacteria | 1949 |
| 17 | Ga0070668_100335727 | 3300005347 | Bacteria | 1276 |
| 18 | Ga0070669_100001239 | 3300005353 | Bacteria | 18500 |
| 19 | Ga0070669_100067660 | 3300005353 | Bacteria | 2635 |
| 20 | Ga0070675_100098553 | 3300005354 | Bacteria | 2459 |
| 21 | Ga0070674_100130564 | 3300005356 | Bacteria | 1872 |
| 22 | Ga0070673_100377686 | 3300005364 | Bacteria | 1263 |
| 23 | Ga0070688_100062020 | 3300005365 | Bacteria | 2366 |
| 24 | Ga0070667_100000679 | 3300005367 | Bacteria | 32958 |
| 25 | Ga0070667_100006205 | 3300005367 | Bacteria | 9944 |
| 26 | Ga0070667_100054985 | 3300005367 | Bacteria | 3361 |
| 27 | Ga0070667_100084903 | 3300005367 | Bacteria | 2714 |
| 28 | Ga0070709_10012970 | 3300005434 | Bacteria | 4675 |
| 29 | Ga0070714_100037059 | 3300005435 | Bacteria | 4096 |
| 30 | Ga0070714_100132080 | 3300005435 | Bacteria | 2232 |
| 31 | Ga0070714_100200052 | 3300005435 | Bacteria | 1827 |
| 32 | Ga0070710_10006167 | 3300005437 | Bacteria | 5737 |
| 33 | Ga0070701_10000802 | 3300005438 | Bacteria | 11224 |
| 34 | Ga0070711_100002361 | 3300005439 | Bacteria | 10733 |
| 35 | Ga0070663_100041173 | 3300005455 | Bacteria | 3238 |
| 36 | Ga0070663_100223296 | 3300005455 | Bacteria | 1480 |
| 37 | Ga0070678_100002715 | 3300005456 | Bacteria | 9767 |
| 38 | Ga0070678_100062580 | 3300005456 | Bacteria | 2748 |
| 39 | Ga0070662_100011550 | 3300005457 | Bacteria | 5827 |
| 40 | Ga0068867_100003221 | 3300005459 | Bacteria | 11509 |
| 41 | Ga0068867_100036364 | 3300005459 | Bacteria | 3575 |
| 42 | Ga0070672_100090876 | 3300005543 | Bacteria | 2463 |
| 43 | Ga0070695_100022325 | 3300005545 | Bacteria | 3882 |
| 44 | Ga0070696_100066499 | 3300005546 | Bacteria | 2528 |
| 45 | Ga0070693_100034349 | 3300005547 | Bacteria | 2806 |
| 46 | Ga0070665_100001757 | 3300005548 | Bacteria | 24788 |
| 47 | Ga0070665_100008312 | 3300005548 | Bacteria | 10498 |
| 48 | Ga0070665_100063964 | 3300005548 | Bacteria | 3689 |
| 49 | Ga0070665_100087058 | 3300005548 | Bacteria | 3129 |
| 50 | Ga0070704_100000443 | 3300005549 | Bacteria | 19456 |
| 51 | Ga0068855_100104991 | 3300005563 | Bacteria | 3249 |
| 52 | Ga0068854_100000515 | 3300005578 | Bacteria | 23453 |
| 53 | Ga0070702_100023924 | 3300005615 | Bacteria | 3252 |
| 54 | Ga0068852_100157896 | 3300005616 | Bacteria | 2115 |
| 55 | Ga0068859_100000276 | 3300005617 | Bacteria | 51118 |
| 56 | Ga0068859_100025626 | 3300005617 | Bacteria | 5915 |
| 57 | Ga0068859_100085108 | 3300005617 | Bacteria | 3207 |
| 58 | Ga0068866_10000609 | 3300005718 | Bacteria | 16358 |
| 59 | Ga0068861_100000307 | 3300005719 | Bacteria | 27379 |
| 60 | Ga0068861_100145257 | 3300005719 | Bacteria | 1941 |
| 61 | Ga0068861_100196838 | 3300005719 | Bacteria | 1689 |
| 62 | Ga0068863_100000768 | 3300005841 | Bacteria | 32211 |
| 63 | Ga0068863_100000835 | 3300005841 | Bacteria | 30885 |
| 64 | Ga0068863_100020245 | 3300005841 | Bacteria | 6364 |
| 65 | Ga0068863_100029468 | 3300005841 | Bacteria | 5239 |
| 66 | Ga0068863_100110335 | 3300005841 | Bacteria | 2620 |
| 67 | Ga0068858_100000440 | 3300005842 | Bacteria | 43437 |
| 68 | Ga0068858_100008729 | 3300005842 | Bacteria | 9731 |
| 69 | Ga0068860_100000232 | 3300005843 | Bacteria | 85501 |
| 70 | Ga0068860_100009056 | 3300005843 | Bacteria | 9907 |
| 71 | Ga0068860_100025102 | 3300005843 | Bacteria | 5751 |
| 72 | Ga0068862_100000055 | 3300005844 | Bacteria | 142386 |
| 73 | Ga0068862_100027936 | 3300005844 | Bacteria | 4751 |
| 74 | Ga0068862_100045415 | 3300005844 | Bacteria | 3749 |
| 75 | Ga0081538_10113529 | 3300005981 | Bacteria | 1323 |
| 76 | Ga0075365_10005734 | 3300006038 | Bacteria | 6738 |
| 77 | Ga0075365_10025315 | 3300006038 | Bacteria | 3755 |
| 78 | Ga0075365_10036037 | 3300006038 | Bacteria | 3204 |
| 79 | Ga0075365_10094529 | 3300006038 | Bacteria | 2040 |
| 80 | Ga0075368_10018698 | 3300006042 | Bacteria | 2607 |
| 81 | Ga0075363_100006782 | 3300006048 | Bacteria | 5229 |
| 82 | Ga0075363_100013376 | 3300006048 | Bacteria | 3975 |
| 83 | Ga0075363_100017787 | 3300006048 | Bacteria | 3531 |
| 84 | Ga0075363_100020887 | 3300006048 | Bacteria | 3290 |
| 85 | Ga0075363_100024049 | 3300006048 | Bacteria | 3094 |
| 86 | Ga0075363_100092846 | 3300006048 | Bacteria | 1663 |
| 87 | Ga0075363_100106996 | 3300006048 | Bacteria | 1552 |
| 88 | Ga0075364_10000391 | 3300006051 | Bacteria | 21816 |
| 89 | Ga0075364_10001597 | 3300006051 | Bacteria | 12392 |
| 90 | Ga0075364_10014676 | 3300006051 | Bacteria | 4846 |
| 91 | Ga0075364_10015074 | 3300006051 | Bacteria | 4786 |
| 92 | Ga0075364_10015374 | 3300006051 | Bacteria | 4745 |
| 93 | Ga0075364_10021521 | 3300006051 | Bacteria | 4065 |
| 94 | Ga0070712_100001270 | 3300006175 | Bacteria | 15233 |
| 95 | Ga0070712_100009279 | 3300006175 | Bacteria | 6198 |
| 96 | Ga0075362_10009407 | 3300006177 | Bacteria | 3780 |
| 97 | Ga0075362_10070177 | 3300006177 | Bacteria | 1599 |
| 98 | Ga0075367_10015394 | 3300006178 | Bacteria | 4156 |
| 99 | Ga0075367_10189036 | 3300006178 | Bacteria | 1285 |
| 100 | Ga0075367_10244339 | 3300006178 | Bacteria | 1125 |
| 101 | Ga0075369_10050875 | 3300006186 | Bacteria | 1793 |
| 102 | Ga0075366_10085130 | 3300006195 | Bacteria | 1891 |
| 103 | Ga0097621_100258425 | 3300006237 | Bacteria | 1527 |
| 104 | Ga0075370_10000744 | 3300006353 | Bacteria | 13002 |
| 105 | Ga0075370_10001636 | 3300006353 | Bacteria | 9880 |
| 106 | Ga0075370_10010380 | 3300006353 | Bacteria | 4869 |
| 107 | Ga0075370_10010428 | 3300006353 | Bacteria | 4859 |
| 108 | Ga0068871_100216498 | 3300006358 | Bacteria | 1658 |
| 109 | Ga0075430_100032892 | 3300006846 | Bacteria | 4401 |
| 110 | Ga0075431_100145936 | 3300006847 | Bacteria | 2438 |
| 111 | Ga0068865_100046063 | 3300006881 | Bacteria | 2991 |
| 112 | Ga0097620_100000276 | 3300006931 | Bacteria | 51118 |
| 113 | Ga0097620_100025628 | 3300006931 | Bacteria | 5915 |
| 114 | Ga0097620_100085106 | 3300006931 | Bacteria | 3207 |
| 115 | Ga0105244_10000295 | 3300009036 | Bacteria | 48840 |
| 116 | Ga0105245_10010633 | 3300009098 | Bacteria | 8007 |
| 117 | Ga0105245_10031418 | 3300009098 | Bacteria | 4699 |
| 118 | Ga0105247_10000029 | 3300009101 | Bacteria | 198763 |
| 119 | Ga0114129_10644922 | 3300009147 | Bacteria | 1367 |
| 120 | Ga0105243_10005029 | 3300009148 | Bacteria | 10371 |
| 121 | Ga0105243_10009400 | 3300009148 | Bacteria | 7450 |
| 122 | Ga0105243_10059113 | 3300009148 | Bacteria | 3058 |
| 123 | Ga0105242_10003225 | 3300009176 | Bacteria | 12717 |
| 124 | Ga0105248_10000136 | 3300009177 | Bacteria | 85507 |
| 125 | Ga0105248_10014990 | 3300009177 | Bacteria | 8533 |
| 126 | Ga0105248_10023798 | 3300009177 | Bacteria | 6808 |
| 127 | Ga0105248_10094825 | 3300009177 | Bacteria | 3360 |
| 128 | Ga0105249_10000077 | 3300009553 | Bacteria | 141905 |
| 129 | Ga0105249_10024146 | 3300009553 | Bacteria | 5462 |
| 130 | Ga0105249_10104263 | 3300009553 | Bacteria | 2672 |
| 131 | Ga0105249_10339393 | 3300009553 | Bacteria | 1519 |
| 132 | Ga0105239_10005314 | 3300010375 | Bacteria | 15120 |
| 133 | Ga0105239_10167154 | 3300010375 | Bacteria | 2460 |
| 134 | Ga0105246_10137790 | 3300011119 | Bacteria | 1831 |
| 135 | Ga0157369_10127271 | 3300013105 | Bacteria | 2700 |
| 136 | Ga0157378_10005026 | 3300013297 | Bacteria | 11608 |
| 137 | Ga0163162_10010099 | 3300013306 | Bacteria | 9178 |
| 138 | Ga0163162_10040972 | 3300013306 | Bacteria | 4633 |
| 139 | Ga0163162_10087660 | 3300013306 | Bacteria | 3191 |
| 140 | Ga0163162_10252945 | 3300013306 | Bacteria | 1893 |
| 141 | Ga0163162_10298634 | 3300013306 | Bacteria | 1742 |
| 142 | Ga0157372_10000875 | 3300013307 | Bacteria | 32716 |
| 143 | Ga0157375_10010499 | 3300013308 | Bacteria | 8153 |
| 144 | Ga0157375_10030659 | 3300013308 | Bacteria | 5073 |
| 145 | Ga0157375_10373992 | 3300013308 | Bacteria | 1591 |
| 146 | Ga0163163_10006703 | 3300014325 | Bacteria | 10092 |
| 147 | Ga0163163_10163826 | 3300014325 | Bacteria | 2269 |
| 148 | Ga0157380_10023769 | 3300014326 | Bacteria | 4628 |
| 149 | Ga0182008_10116848 | 3300014497 | Bacteria | 1324 |
| 150 | Ga0157379_10208952 | 3300014968 | Bacteria | 1766 |
| 151 | Ga0157376_10048523 | 3300014969 | Bacteria | 3511 |
| 152 | Ga0163161_10001293 | 3300017792 | Bacteria | 18669 |
| 153 | Ga0163161_10108683 | 3300017792 | Bacteria | 2071 |
| 154 | Ga0163161_10357989 | 3300017792 | Bacteria | 1162 |
| 155 | Ga0213876_10069535 | 3300021384 | Bacteria | 1860 |
| 156 | Ga0209672_100011 | 3300025228 | Bacteria | 856297 |
| 157 | Ga0209147_100675 | 3300025229 | Bacteria | 17592 |
| 158 | Ga0209148_1000132 | 3300025254 | Bacteria | 171529 |
| 159 | Ga0209455_1000122 | 3300025272 | Bacteria | 170954 |
| 160 | Ga0207655_1000526 | 3300025728 | Bacteria | 48861 |
| 161 | Ga0207692_10065706 | 3300025898 | Bacteria | 1893 |
| 162 | Ga0207642_10003076 | 3300025899 | Bacteria | 5227 |
| 163 | Ga0207642_10028214 | 3300025899 | Bacteria | 2308 |
| 164 | Ga0207642_10163134 | 3300025899 | Bacteria | 1199 |
| 165 | Ga0207710_10000046 | 3300025900 | Bacteria | 198754 |
| 166 | Ga0207710_10003445 | 3300025900 | Bacteria | 7053 |
| 167 | Ga0207710_10079113 | 3300025900 | Bacteria | 1522 |
| 168 | Ga0207688_10000623 | 3300025901 | Bacteria | 17410 |
| 169 | Ga0207688_10000910 | 3300025901 | Bacteria | 14940 |
| 170 | Ga0207647_10048853 | 3300025904 | Bacteria | 2626 |
| 171 | Ga0207699_10036450 | 3300025906 | Bacteria | 2804 |
| 172 | Ga0207699_10102458 | 3300025906 | Bacteria | 1819 |
| 173 | Ga0207693_10000614 | 3300025915 | Bacteria | 31922 |
| 174 | Ga0207663_10002572 | 3300025916 | Bacteria | 8730 |
| 175 | Ga0207681_10000341 | 3300025923 | Bacteria | 33602 |
| 176 | Ga0207694_10354272 | 3300025924 | Bacteria | 1215 |
| 177 | Ga0207650_10128705 | 3300025925 | Bacteria | 1979 |
| 178 | Ga0207659_10035327 | 3300025926 | Bacteria | 3454 |
| 179 | Ga0207687_10001777 | 3300025927 | Bacteria | 14824 |
| 180 | Ga0207687_10011562 | 3300025927 | Bacteria | 5770 |
| 181 | Ga0207644_10414353 | 3300025931 | Bacteria | 1103 |
| 182 | Ga0207706_10001079 | 3300025933 | Bacteria | 27701 |
| 183 | Ga0207686_10004045 | 3300025934 | Bacteria | 7870 |
| 184 | Ga0207709_10002916 | 3300025935 | Bacteria | 10440 |
| 185 | Ga0207709_10045476 | 3300025935 | Bacteria | 2659 |
| 186 | Ga0207669_10000085 | 3300025937 | Bacteria | 47505 |
| 187 | Ga0207669_10047229 | 3300025937 | Bacteria | 2549 |
| 188 | Ga0207669_10056817 | 3300025937 | Bacteria | 2379 |
| 189 | Ga0207704_10006243 | 3300025938 | Bacteria | 5541 |
| 190 | Ga0207665_10012387 | 3300025939 | Bacteria | 5602 |
| 191 | Ga0207665_10029462 | 3300025939 | Bacteria | 3628 |
| 192 | Ga0207711_10000111 | 3300025941 | Bacteria | 85466 |
| 193 | Ga0207711_10091812 | 3300025941 | Bacteria | 2671 |
| 194 | Ga0207711_10097372 | 3300025941 | Bacteria | 2597 |
| 195 | Ga0207689_10036744 | 3300025942 | Bacteria | 4065 |
| 196 | Ga0207689_10264308 | 3300025942 | Bacteria | 1424 |
| 197 | Ga0207712_10000017 | 3300025961 | Bacteria | 337943 |
| 198 | Ga0207712_10212965 | 3300025961 | Bacteria | 1540 |
| 199 | Ga0207712_10321587 | 3300025961 | Bacteria | 1277 |
| 200 | Ga0207668_10065680 | 3300025972 | Bacteria | 2569 |
| 201 | Ga0207668_10242181 | 3300025972 | Bacteria | 1460 |
| 202 | Ga0207640_10010787 | 3300025981 | Bacteria | 5156 |
| 203 | Ga0207658_10000612 | 3300025986 | Bacteria | 31708 |
| 204 | Ga0207658_10027811 | 3300025986 | Bacteria | 3977 |
| 205 | Ga0207658_10103610 | 3300025986 | Bacteria | 2234 |
| 206 | Ga0207677_10065449 | 3300026023 | Bacteria | 2536 |
| 207 | Ga0207677_10212655 | 3300026023 | Bacteria | 1545 |
| 208 | Ga0207703_10002482 | 3300026035 | Bacteria | 15994 |
| 209 | Ga0207703_10072731 | 3300026035 | Bacteria | 2843 |
| 210 | Ga0207703_10165955 | 3300026035 | Bacteria | 1938 |
| 211 | Ga0207639_10149045 | 3300026041 | Bacteria | 1957 |
| 212 | Ga0207678_10044033 | 3300026067 | Bacteria | 3862 |
| 213 | Ga0207708_10000329 | 3300026075 | Bacteria | 37329 |
| 214 | Ga0207641_10000378 | 3300026088 | Bacteria | 53027 |
| 215 | Ga0207641_10010420 | 3300026088 | Bacteria | 7639 |
| 216 | Ga0207641_10019974 | 3300026088 | Bacteria | 5499 |
| 217 | Ga0207641_10034558 | 3300026088 | Bacteria | 4206 |
| 218 | Ga0207648_10000112 | 3300026089 | Bacteria | 78746 |
| 219 | Ga0207648_10166049 | 3300026089 | Bacteria | 1951 |
| 220 | Ga0207675_100000117 | 3300026118 | Bacteria | 64829 |
| 221 | Ga0207675_100046569 | 3300026118 | Bacteria | 4052 |
| 222 | Ga0207675_100085380 | 3300026118 | Bacteria | 2962 |
| 223 | Ga0207683_10000451 | 3300026121 | Bacteria | 38077 |
| 224 | Ga0207683_10232737 | 3300026121 | Bacteria | 1680 |
| 225 | Ga0268266_10001547 | 3300028379 | Bacteria | 26936 |
| 226 | Ga0268266_10019511 | 3300028379 | Bacteria | 5777 |
| 227 | Ga0268266_10222589 | 3300028379 | Bacteria | 1735 |
| 228 | Ga0268266_10272934 | 3300028379 | Bacteria | 1570 |
| 229 | Ga0268265_10000067 | 3300028380 | Bacteria | 142389 |
| 230 | Ga0268265_10019465 | 3300028380 | Bacteria | 4719 |
| 231 | Ga0268265_10031249 | 3300028380 | Bacteria | 3844 |
| 232 | Ga0268264_10000146 | 3300028381 | Bacteria | 165733 |
| 233 | Ga0268264_10008289 | 3300028381 | Bacteria | 8635 |
| 234 | Ga0268264_10263709 | 3300028381 | Bacteria | 1606 |
| 235 | Ga0307405_10089587 | 3300031731 | Bacteria | 2033 |
| 236 | Ga0307413_10076278 | 3300031824 | Bacteria | 2130 |
| 237 | Ga0307413_10315439 | 3300031824 | Bacteria | 1192 |
| 238 | Ga0307410_10168927 | 3300031852 | Bacteria | 1646 |
| 239 | Ga0307410_10210417 | 3300031852 | Bacteria | 1490 |
| 240 | Ga0307406_10027007 | 3300031901 | Bacteria | 3454 |
| 241 | Ga0307406_10087310 | 3300031901 | Bacteria | 2090 |
| 242 | Ga0307412_10327681 | 3300031911 | Bacteria | 1221 |
| 243 | Ga0307409_100060920 | 3300031995 | Bacteria | 2946 |
| 244 | Ga0307411_10259174 | 3300032005 | Bacteria | 1372 |
| 245 | Ga0307415_100192116 | 3300032126 | Bacteria | 1612 |
| 246 | Ga0373931_0025686 | 3300035691 | Bacteria | 2992 |
| 247 | Ga0316584_0040394 | 3300036712 | Bacteria | 3475 |
| 248 | Ga0395898_0304093 | 3300037466 | Bacteria | 1521 |
| 249 | Ga0436364_0370259 | 3300037853 | Bacteria | 2780 |
| 250 | Ga0436364_1272522 | 3300037853 | Bacteria | 142026 |
| 251 | Ga0436365_0957112 | 3300039437 | Bacteria | 4970 |
| 252 | Ga0436365_1737435 | 3300039437 | Bacteria | 6167 |
| 253 | Ga0436365_1935781 | 3300039437 | Bacteria | 4460 |
| 254 | Ga0436363_0716906 | 3300039450 | Bacteria | 1900 |
| 255 | Ga0439461_0004719 | 3300041410 | Bacteria | 2290 |
| 256 | Ga0439466_0014050 | 3300041411 | Bacteria | 2922 |
| 257 | Ga0439465_0002060 | 3300041413 | Bacteria | 6590 |
| 258 | Ga0439465_0062623 | 3300041413 | Bacteria | 1234 |
| 259 | Ga0451841_0596037 | 3300041498 | Bacteria | 1152 |
| 260 | Ga0439431_0002571 | 3300041997 | Bacteria | 4007 |
| 261 | Ga0439431_0003398 | 3300041997 | Bacteria | 3504 |
| 262 | Ga0439431_0013996 | 3300041997 | Bacteria | 1856 |
| 263 | Ga0439445_0012670 | 3300042004 | Bacteria | 2030 |
| 264 | Ga0439449_0002073 | 3300042007 | Bacteria | 7886 |
| 265 | Ga0439434_0006002 | 3300042435 | Bacteria | 3545 |
| 266 | Ga0439434_0008882 | 3300042435 | Bacteria | 2952 |
| 267 | Ga0466969_0043786 | 3300044656 | Bacteria | 2229 |
| 268 | Ga0466969_0049308 | 3300044656 | Bacteria | 2078 |
| 269 | Ga0466972_0017376 | 3300044658 | Bacteria | 3601 |
| 270 | Ga0466972_0030024 | 3300044658 | Bacteria | 2676 |
| 271 | Ga0466972_0049154 | 3300044658 | Bacteria | 2037 |
| 272 | Ga0466965_0050907 | 3300044683 | Bacteria | 2054 |
| 273 | Ga0466966_0000885 | 3300044684 | Bacteria | 19103 |
| 274 | Ga0466966_0004648 | 3300044684 | Bacteria | 9043 |
| 275 | Ga0466966_0022227 | 3300044684 | Bacteria | 4164 |
| 276 | Ga0466961_0000876 | 3300044693 | Bacteria | 18697 |
| 277 | Ga0466961_0097068 | 3300044693 | Bacteria | 1858 |
| 278 | Ga0466963_0005101 | 3300044694 | Bacteria | 7672 |
| 279 | Ga0466964_0000712 | 3300044706 | Bacteria | 10755 |
| 280 | Ga0466971_0000938 | 3300044719 | Bacteria | 11979 |
| 281 | Ga0466968_0001343 | 3300044735 | Bacteria | 8770 |
| 282 | Ga0466968_0043633 | 3300044735 | Bacteria | 1899 |
| 283 | Ga0466970_0000909 | 3300044765 | Bacteria | 14310 |
| 284 | Ga0466970_0144171 | 3300044765 | Bacteria | 1313 |
| 285 | Ga0466957_0002992 | 3300044842 | Bacteria | 9178 |
| 286 | Ga0466957_0006134 | 3300044842 | Bacteria | 6783 |
| 287 | Ga0466957_0024254 | 3300044842 | Bacteria | 3589 |
| 288 | Ga0466960_0000447 | 3300044901 | Bacteria | 14126 |
| 289 | Ga0466960_0001027 | 3300044901 | Bacteria | 9982 |
| 290 | Ga0466959_0000921 | 3300045049 | Bacteria | 17440 |
| 291 | Ga0466959_0003579 | 3300045049 | Bacteria | 10230 |
| 292 | Ga0466959_0032455 | 3300045049 | Bacteria | 3865 |
| 293 | Ga0466959_0160773 | 3300045049 | Bacteria | 1579 |
| 294 | Ga0466958_0000144 | 3300045836 | Bacteria | 24551 |
| 295 | Ga0466958_0001254 | 3300045836 | Bacteria | 11889 |
| 296 | Ga0466958_0049201 | 3300045836 | Bacteria | 2550 |
| 297 | Ga0466967_0004058 | 3300045976 | Bacteria | 9769 |
| 298 | Ga0466967_0007332 | 3300045976 | Bacteria | 7943 |
| 299 | Ga0466967_0017251 | 3300045976 | Bacteria | 5725 |
| 300 | Ga0466967_0026988 | 3300045976 | Bacteria | 4768 |
| 301 | Ga0495629_0030780 | 3300046459 | Bacteria | 3802 |
| 302 | Ga0495638_0002021 | 3300046460 | Bacteria | 17284 |
| 303 | Ga0495580_0099511 | 3300046472 | Bacteria | 2023 |
| 304 | Ga0495582_0034087 | 3300046473 | Bacteria | 2799 |
| 305 | Ga0495594_0086105 | 3300046499 | Bacteria | 1758 |
| 306 | Ga0495618_0029537 | 3300046514 | Bacteria | 3421 |
| 307 | Ga0495628_0001491 | 3300046516 | Bacteria | 21439 |
| 308 | Ga0495634_0045386 | 3300046642 | Bacteria | 2971 |
| 309 | Ga0495624_0079336 | 3300046690 | Bacteria | 2036 |
| 310 | Ga0495672_0101390 | 3300047320 | Bacteria | 1560 |
| 311 | Ga0495686_0037954 | 3300047472 | Bacteria | 3084 |
| 312 | Ga0496100_0000395 | 3300048903 | Bacteria | 21117 |
| 313 | Ga0496100_0009529 | 3300048903 | Bacteria | 5458 |
| 314 | Ga0496100_0030130 | 3300048903 | Bacteria | 3363 |
| 315 | Ga0496100_0293424 | 3300048903 | Bacteria | 1215 |
| 316 | Ga0496101_0001579 | 3300048904 | Bacteria | 13661 |
| 317 | Ga0496101_0004109 | 3300048904 | Bacteria | 9110 |
| 318 | Ga0496101_0038834 | 3300048904 | Bacteria | 3383 |
| 319 | Ga0496102_0000268 | 3300048905 | Bacteria | 66717 |
| 320 | Ga0496102_0010611 | 3300048905 | Bacteria | 7936 |
| 321 | Ga0496102_0032601 | 3300048905 | Bacteria | 4680 |
| 322 | Ga0496102_0064615 | 3300048905 | Bacteria | 3352 |
| 323 | Ga0496102_0130211 | 3300048905 | Bacteria | 2354 |
| 324 | Ga0496102_0275987 | 3300048905 | Bacteria | 1584 |
| 325 | Ga0496103_0000237 | 3300048906 | Bacteria | 53762 |
| 326 | Ga0496103_0003795 | 3300048906 | Bacteria | 9195 |
| 327 | Ga0496103_0175141 | 3300048906 | Bacteria | 1378 |
| 328 | Ga0496105_0031605 | 3300048908 | Bacteria | 4340 |
| 329 | Ga0496105_0125688 | 3300048908 | Bacteria | 2114 |
| 330 | Ga0496105_0295269 | 3300048908 | Bacteria | 1304 |
| 331 | Ga0496106_0002405 | 3300048909 | Bacteria | 13942 |
| 332 | Ga0496106_0006699 | 3300048909 | Bacteria | 8531 |
| 333 | Ga0496106_0084182 | 3300048909 | Bacteria | 2447 |
| 334 | Ga0496106_0214460 | 3300048909 | Bacteria | 1534 |
| 335 | Ga0496107_0004395 | 3300048910 | Bacteria | 9548 |
| 336 | Ga0496108_0002116 | 3300048911 | Bacteria | 15905 |
| 337 | Ga0496108_0044032 | 3300048911 | Bacteria | 3727 |
| 338 | Ga0496108_0147461 | 3300048911 | Bacteria | 2029 |
| 339 | Ga0496109_0007462 | 3300048912 | Bacteria | 9260 |
| 340 | Ga0496110_0028720 | 3300048913 | Bacteria | 4780 |
| 341 | Ga0496110_0253029 | 3300048913 | Bacteria | 1603 |
| 342 | Ga0496110_0459846 | 3300048913 | Bacteria | 1160 |
| 343 | Ga0496112_0004365 | 3300048915 | Bacteria | 11964 |
| 344 | Ga0496112_0038710 | 3300048915 | Bacteria | 4658 |
| 345 | Ga0496112_0133336 | 3300048915 | Bacteria | 2455 |
| 346 | Ga0496113_0002563 | 3300048916 | Bacteria | 10615 |
| 347 | Ga0496113_0097022 | 3300048916 | Bacteria | 2280 |
| 348 | Ga0496113_0179922 | 3300048916 | Bacteria | 1676 |
| 349 | Ga0496114_0000629 | 3300048917 | Bacteria | 26088 |
| 350 | Ga0496114_0002083 | 3300048917 | Bacteria | 15214 |
| 351 | Ga0496115_0000824 | 3300048918 | Bacteria | 22725 |
| 352 | Ga0496115_0001294 | 3300048918 | Bacteria | 17870 |
| 353 | Ga0496116_0007423 | 3300048919 | Bacteria | 9729 |
| 354 | Ga0496117_0001548 | 3300048920 | Bacteria | 32660 |
| 355 | Ga0496118_0001284 | 3300048921 | Bacteria | 38348 |
| 356 | Ga0496119_0010884 | 3300048922 | Bacteria | 7602 |
| 357 | Ga0496121_0003814 | 3300048924 | Bacteria | 21004 |
| 358 | Ga0496122_0014952 | 3300048925 | Bacteria | 7463 |
| 359 | Ga0496123_0004488 | 3300048926 | Bacteria | 14627 |
| 360 | Ga0496125_0008684 | 3300048928 | Bacteria | 10582 |
| 361 | Ga0496126_0004792 | 3300048929 | Bacteria | 15900 |
| 362 | Ga0496126_0008009 | 3300048929 | Bacteria | 11469 |
| 363 | Ga0501032_0002313 | 3300049569 | Bacteria | 14948 |
| 364 | Ga0501033_0018634 | 3300049570 | Bacteria | 5246 |
| 365 | Ga0501034_0006673 | 3300049571 | Bacteria | 12378 |
| 366 | Ga0501034_0066271 | 3300049571 | Bacteria | 3624 |
| 367 | Ga0501034_0194650 | 3300049571 | Bacteria | 1988 |
| 368 | Ga0501037_0001502 | 3300049573 | Bacteria | 17059 |
| 369 | Ga0501038_0001711 | 3300049574 | Bacteria | 20376 |
| 370 | Ga0501039_0000526 | 3300049575 | Bacteria | 27681 |
| 371 | Ga0501043_0000633 | 3300049579 | Bacteria | 31114 |
| 372 | Ga0501070_0000448 | 3300049586 | Bacteria | 37506 |
| 373 | Ga0501070_0111388 | 3300049586 | Bacteria | 2262 |
| 374 | Ga0501035_0000753 | 3300049822 | Bacteria | 34892 |
| 375 | Ga0501035_0020975 | 3300049822 | Bacteria | 6005 |
| 376 | Ga0501044_0031803 | 3300049823 | Bacteria | 5550 |
| 377 | nmdc:mga03683_40485_c1 | 3300050489 | Bacteria | 1911 |
| 378 | nmdc:mga03n38_10861_c1 | 3300050490 | Bacteria | 3369 |
| 379 | nmdc:mga03n38_4468_c1 | 3300050490 | Bacteria | 4641 |
| 380 | nmdc:mga03n38_5303_c1 | 3300050490 | Bacteria | 4376 |
| 381 | nmdc:mga03n38_68129_c1 | 3300050490 | Bacteria | 1640 |
| 382 | nmdc:mga03n38_9923_c1 | 3300050490 | Bacteria | 3484 |
| 383 | nmdc:mga00v17_1485_c1 | 3300050491 | Bacteria | 12272 |
| 384 | nmdc:mga00v17_148873_c1 | 3300050491 | Bacteria | 1503 |
| 385 | nmdc:mga00v17_31066_c1 | 3300050491 | Bacteria | 3147 |
| 386 | nmdc:mga00v17_3556_c1 | 3300050491 | Bacteria | 8051 |
| 387 | nmdc:mga00v17_36857_c1 | 3300050491 | Bacteria | 2917 |
| 388 | nmdc:mga00v17_47360_c1 | 3300050491 | Bacteria | 2604 |
| 389 | nmdc:mga00v17_4942_c1 | 3300050491 | Bacteria | 6991 |
| 390 | nmdc:mga00v17_9836_c1 | 3300050491 | Bacteria | 5196 |
| 391 | nmdc:mga0yw44_112976_c1 | 3300050492 | Bacteria | 1742 |
| 392 | nmdc:mga0yw44_24643_c1 | 3300050492 | Bacteria | 3408 |
| 393 | nmdc:mga0yw44_297012_c1 | 3300050492 | Bacteria | 1082 |
| 394 | nmdc:mga0yw44_33988_c1 | 3300050492 | Bacteria | 2984 |
| 395 | nmdc:mga0yw44_39948_c1 | 3300050492 | Bacteria | 2784 |
| 396 | nmdc:mga0yw44_5173_c1 | 3300050492 | Bacteria | 6112 |
| 397 | nmdc:mga06z11_123951_c1 | 3300050494 | Bacteria | 1444 |
| 398 | nmdc:mga06z11_180244_c1 | 3300050494 | Bacteria | 1218 |
| 399 | nmdc:mga06z11_18125_c1 | 3300050494 | Bacteria | 3210 |
| 400 | nmdc:mga07m45_813_c2 | 3300050496 | Bacteria | 12202 |
| 401 | nmdc:mga07m45_8384_c1 | 3300050496 | Bacteria | 5312 |
| 402 | nmdc:mga05p37_374819_c1 | 3300050507 | Bacteria | 1669 |
| 403 | nmdc:mga0qj67_27780_c1 | 3300050509 | Bacteria | 4387 |
| 404 | nmdc:mga06r32_29577_c1 | 3300050510 | Bacteria | 2554 |
| 405 | nmdc:mga0sz30_24898_c1 | 3300050516 | Bacteria | 2445 |
| 406 | nmdc:mga0sz30_385_c1 | 3300050516 | Bacteria | 16818 |
| 407 | Ga0495601_0000697 | 3300053077 | Bacteria | 18051 |
| 408 | Ga0500635_0007142 | 3300053080 | Bacteria | 3018 |
| 409 | Ga0500643_024608 | 3300053087 | Bacteria | 1909 |
| 410 | Ga0500643_033109 | 3300053087 | Bacteria | 1564 |
| 411 | Ga0500556_0012086 | 3300053104 | Bacteria | 2570 |
| 412 | Ga0500569_036683 | 3300053109 | Bacteria | 1413 |
| 413 | Ga0500652_046702 | 3300053131 | Bacteria | 1758 |
| 414 | Ga0500559_0001028 | 3300053136 | Bacteria | 17105 |
| 415 | Ga0500604_0023688 | 3300053151 | Bacteria | 1753 |
| 416 | Ga0500616_0003873 | 3300053153 | Bacteria | 11012 |
| 417 | Ga0500616_0072491 | 3300053153 | Bacteria | 1751 |
| 418 | Ga0500645_000007 | 3300053730 | Bacteria | 233700 |
| 419 | Ga0500645_042795 | 3300053730 | Bacteria | 1335 |
| 420 | Ga0500645_057143 | 3300053730 | Bacteria | 1131 |
| 421 | Ga0466962_0000712 | 3300061719 | Bacteria | 14819 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031852 | Ga0307410_10210417 | Ga0307410_102104172 | 263 |
| 2 | 3300037853 | Ga0436364_0370259 | Ga0436364_0370259_24_959 | 276 |
| 3 | 3300025904 | Ga0207647_10048853 | Ga0207647_100488532 | 289 |
| 4 | 3300005548 | Ga0070665_100001757 | Ga0070665_10000175711 | 290 |
| 5 | 3300005617 | Ga0068859_100085108 | Ga0068859_1000851082 | 290 |
| 6 | 3300005841 | Ga0068863_100000835 | Ga0068863_10000083516 | 290 |
| 7 | 3300006931 | Ga0097620_100085106 | Ga0097620_1000851062 | 290 |
| 8 | 3300026088 | Ga0207641_10010420 | Ga0207641_100104203 | 290 |
| 9 | 3300028379 | Ga0268266_10001547 | Ga0268266_1000154714 | 290 |
| 10 | 3300046514 | Ga0495618_0029537 | Ga0495618_0029537_523_1482 | 290 |
| 11 | 3300046516 | Ga0495628_0001491 | Ga0495628_0001491_12009_12968 | 290 |
| 12 | 3300046642 | Ga0495634_0045386 | Ga0495634_0045386_1640_2599 | 290 |
| 13 | 3300048905 | Ga0496102_0032601 | Ga0496102_0032601_1344_2360 | 290 |
| 14 | 3300048906 | Ga0496103_0175141 | Ga0496103_0175141_223_1239 | 290 |
| 15 | 3300053077 | Ga0495601_0000697 | Ga0495601_0000697_10037_10996 | 290 |
| 16 | 3300025228 | Ga0209672_100011 | Ga0209672_10001114 | 294 |
| 17 | 3300025229 | Ga0209147_100675 | Ga0209147_10067510 | 294 |
| 18 | 3300025254 | Ga0209148_1000132 | Ga0209148_1000132148 | 294 |
| 19 | 3300025272 | Ga0209455_1000122 | Ga0209455_100012214 | 294 |
| 20 | 3300048908 | Ga0496105_0295269 | Ga0496105_0295269_54_1010 | 297 |
| 21 | 3300049822 | Ga0501035_0020975 | Ga0501035_0020975_3521_4531 | 299 |
| 22 | 3300009177 | Ga0105248_10023798 | Ga0105248_100237985 | 303 |
| 23 | 3300021384 | Ga0213876_10069535 | Ga0213876_100695352 | 303 |
| 24 | 3300039437 | Ga0436365_1935781 | Ga0436365_1935781_2007_2963 | 303 |
| 25 | 3300039450 | Ga0436363_0716906 | Ga0436363_0716906_316_1272 | 303 |
| 26 | 3300005347 | Ga0070668_100335727 | Ga0070668_1003357272 | 306 |
| 27 | 3300025941 | Ga0207711_10097372 | Ga0207711_100973723 | 306 |
| 28 | 3300041498 | Ga0451841_0596037 | Ga0451841_0596037_129_1121 | 306 |
| 29 | 3300042007 | Ga0439449_0002073 | Ga0439449_0002073_976_2004 | 306 |
| 30 | iso_pu_bacteria | 2808606375 | 2808915949 | 306 |
| 31 | 3300005288 | Ga0065714_10081064 | Ga0065714_100810642 | 307 |
| 32 | 3300006038 | Ga0075365_10094529 | Ga0075365_100945292 | 307 |
| 33 | 3300006051 | Ga0075364_10015374 | Ga0075364_100153743 | 307 |
| 34 | 3300009036 | Ga0105244_10000295 | Ga0105244_1000029517 | 307 |
| 35 | 3300009148 | Ga0105243_10005029 | Ga0105243_100050294 | 307 |
| 36 | 3300025728 | Ga0207655_1000526 | Ga0207655_100052634 | 307 |
| 37 | 3300025935 | Ga0207709_10002916 | Ga0207709_100029164 | 307 |
| 38 | 3300037466 | Ga0395898_0304093 | Ga0395898_0304093_272_1234 | 307 |
| 39 | 3300044656 | Ga0466969_0049308 | Ga0466969_0049308_960_1916 | 307 |
| 40 | 3300044684 | Ga0466966_0000885 | Ga0466966_0000885_14651_15607 | 307 |
| 41 | 3300044693 | Ga0466961_0000876 | Ga0466961_0000876_3592_4548 | 307 |
| 42 | 3300044694 | Ga0466963_0005101 | Ga0466963_0005101_5086_6042 | 307 |
| 43 | 3300044706 | Ga0466964_0000712 | Ga0466964_0000712_4027_4983 | 307 |
| 44 | 3300044719 | Ga0466971_0000938 | Ga0466971_0000938_884_1840 | 307 |
| 45 | 3300044765 | Ga0466970_0000909 | Ga0466970_0000909_3724_4680 | 307 |
| 46 | 3300044842 | Ga0466957_0006134 | Ga0466957_0006134_3724_4680 | 307 |
| 47 | 3300045049 | Ga0466959_0000921 | Ga0466959_0000921_8551_9507 | 307 |
| 48 | 3300045836 | Ga0466958_0000144 | Ga0466958_0000144_15662_16618 | 307 |
| 49 | 3300045976 | Ga0466967_0026988 | Ga0466967_0026988_204_1160 | 307 |
| 50 | 3300048913 | Ga0496110_0253029 | Ga0496110_0253029_195_1172 | 307 |
| 51 | 3300050492 | nmdc:mga0yw44_24643_c1 | nmdc:mga0yw44_24643_c1_1027_2019 | 307 |
| 52 | 3300050492 | nmdc:mga0yw44_39948_c1 | nmdc:mga0yw44_39948_c1_42_1019 | 307 |
| 53 | 3300050494 | nmdc:mga06z11_123951_c1 | nmdc:mga06z11_123951_c1_322_1314 | 307 |
| 54 | 3300061719 | Ga0466962_0000712 | Ga0466962_0000712_10140_11096 | 307 |
| 55 | iso_pu_bacteria | 2643221575 | 2643886825 | 307 |
| 56 | iso_pu_bacteria | 2773857763 | 2774397747 | 307 |
| 57 | iso_pu_bacteria | 2811994872 | 2812324955 | 307 |
| 58 | iso_pu_bacteria | 2821268502 | 2821271488 | 307 |
| 59 | iso_pu_bacteria | 2870628048 | 2870629065 | 307 |
| 60 | iso_pu_bacteria | 2946080515 | 2946082103 | 307 |
| 61 | iso_pu_bacteria | 2974294766 | 2974295694 | 307 |
| 62 | iso_pu_bacteria | 2977264416 | 2977264809 | 307 |
| 63 | iso_pu_bacteria | 8016254467 | 8016255910 | 307 |
| 64 | 3300053136 | Ga0500559_0001028 | Ga0500559_0001028_15906_16928 | 308 |
| 65 | 3300005347 | Ga0070668_100125449 | Ga0070668_1001254492 | 309 |
| 66 | 3300005354 | Ga0070675_100098553 | Ga0070675_1000985532 | 309 |
| 67 | 3300005455 | Ga0070663_100223296 | Ga0070663_1002232962 | 309 |
| 68 | 3300005719 | Ga0068861_100145257 | Ga0068861_1001452572 | 309 |
| 69 | 3300005844 | Ga0068862_100045415 | Ga0068862_1000454152 | 309 |
| 70 | 3300014326 | Ga0157380_10023769 | Ga0157380_100237692 | 309 |
| 71 | 3300017792 | Ga0163161_10357989 | Ga0163161_103579891 | 309 |
| 72 | 3300025926 | Ga0207659_10035327 | Ga0207659_100353273 | 309 |
| 73 | 3300025942 | Ga0207689_10264308 | Ga0207689_102643082 | 309 |
| 74 | 3300025972 | Ga0207668_10065680 | Ga0207668_100656803 | 309 |
| 75 | 3300026118 | Ga0207675_100085380 | Ga0207675_1000853802 | 309 |
| 76 | 3300028380 | Ga0268265_10031249 | Ga0268265_100312492 | 309 |
| 77 | 3300031824 | Ga0307413_10315439 | Ga0307413_103154392 | 309 |
| 78 | 3300048905 | Ga0496102_0064615 | Ga0496102_0064615_683_1696 | 309 |
| 79 | 3300048916 | Ga0496113_0097022 | Ga0496113_0097022_699_1712 | 309 |
| 80 | iso_pu_bacteria | 2808606372 | 2808903568 | 309 |
| 81 | iso_pu_bacteria | 2919443155 | 2919446689 | 309 |
| 82 | 3300005435 | Ga0070714_100037059 | Ga0070714_1000370593 | 310 |
| 83 | 3300013308 | Ga0157375_10373992 | Ga0157375_103739922 | 310 |
| 84 | iso_pu_bacteria | 2895660088 | 2895660331 | 310 |
| 85 | 3300044656 | Ga0466969_0043786 | Ga0466969_0043786_1087_2118 | 311 |
| 86 | 3300044684 | Ga0466966_0004648 | Ga0466966_0004648_4527_5558 | 311 |
| 87 | 3300045049 | Ga0466959_0003579 | Ga0466959_0003579_4525_5556 | 311 |
| 88 | 3300009553 | Ga0105249_10339393 | Ga0105249_103393931 | 312 |
| 89 | 3300026118 | Ga0207675_100046569 | Ga0207675_1000465695 | 312 |
| 90 | 3300050491 | nmdc:mga00v17_148873_c1 | nmdc:mga00v17_148873_c1_103_1074 | 321 |
| 91 | iso_pu_bacteria | 2902799365 | 2902800112 | 322 |
| 92 | iso_pu_bacteria | 2902810491 | 2902811988 | 322 |
| 93 | iso_pu_bacteria | 2929212328 | 2929216824 | 322 |
| 94 | iso_pu_bacteria | 2643221715 | 2644635930 | 325 |
| 95 | 3300005347 | Ga0070668_100000415 | Ga0070668_10000041520 | 326 |
| 96 | 3300005353 | Ga0070669_100001239 | Ga0070669_1000012393 | 326 |
| 97 | 3300005367 | Ga0070667_100000679 | Ga0070667_10000067916 | 326 |
| 98 | 3300009101 | Ga0105247_10000029 | Ga0105247_10000029157 | 326 |
| 99 | 3300009177 | Ga0105248_10000136 | Ga0105248_1000013643 | 326 |
| 100 | 3300009177 | Ga0105248_10094825 | Ga0105248_100948252 | 326 |
| 101 | 3300009553 | Ga0105249_10000077 | Ga0105249_1000007747 | 326 |
| 102 | 3300013306 | Ga0163162_10298634 | Ga0163162_102986342 | 326 |
| 103 | 3300014325 | Ga0163163_10006703 | Ga0163163_100067034 | 326 |
| 104 | 3300014968 | Ga0157379_10208952 | Ga0157379_102089522 | 326 |
| 105 | 3300025972 | Ga0207668_10242181 | Ga0207668_102421811 | 326 |
| 106 | 3300036712 | Ga0316584_0040394 | Ga0316584_0040394_1832_2812 | 326 |
| 107 | 3300041411 | Ga0439466_0014050 | Ga0439466_0014050_1580_2560 | 326 |
| 108 | 3300041413 | Ga0439465_0062623 | Ga0439465_0062623_63_1043 | 326 |
| 109 | 3300041997 | Ga0439431_0002571 | Ga0439431_0002571_450_1436 | 326 |
| 110 | 3300041997 | Ga0439431_0013996 | Ga0439431_0013996_437_1417 | 326 |
| 111 | 3300042004 | Ga0439445_0012670 | Ga0439445_0012670_528_1514 | 326 |
| 112 | 3300042435 | Ga0439434_0008882 | Ga0439434_0008882_704_1690 | 326 |
| 113 | 3300044658 | Ga0466972_0030024 | Ga0466972_0030024_1060_2040 | 326 |
| 114 | 3300044683 | Ga0466965_0050907 | Ga0466965_0050907_207_1193 | 326 |
| 115 | 3300044693 | Ga0466961_0097068 | Ga0466961_0097068_150_1130 | 326 |
| 116 | 3300044735 | Ga0466968_0001343 | Ga0466968_0001343_1223_2209 | 326 |
| 117 | 3300044765 | Ga0466970_0144171 | Ga0466970_0144171_258_1244 | 326 |
| 118 | 3300044842 | Ga0466957_0002992 | Ga0466957_0002992_7531_8517 | 326 |
| 119 | 3300044901 | Ga0466960_0000447 | Ga0466960_0000447_391_1377 | 326 |
| 120 | 3300044901 | Ga0466960_0001027 | Ga0466960_0001027_4469_5455 | 326 |
| 121 | 3300045049 | Ga0466959_0032455 | Ga0466959_0032455_2709_3689 | 326 |
| 122 | 3300045976 | Ga0466967_0004058 | Ga0466967_0004058_7454_8440 | 326 |
| 123 | 3300046460 | Ga0495638_0002021 | Ga0495638_0002021_1757_2740 | 326 |
| 124 | 3300047320 | Ga0495672_0101390 | Ga0495672_0101390_49_1029 | 326 |
| 125 | 3300048903 | Ga0496100_0009529 | Ga0496100_0009529_1726_2709 | 326 |
| 126 | 3300048904 | Ga0496101_0038834 | Ga0496101_0038834_2088_3071 | 326 |
| 127 | 3300048905 | Ga0496102_0000268 | Ga0496102_0000268_23451_24434 | 326 |
| 128 | 3300048906 | Ga0496103_0000237 | Ga0496103_0000237_26149_27132 | 326 |
| 129 | 3300048909 | Ga0496106_0214460 | Ga0496106_0214460_525_1508 | 326 |
| 130 | 3300048919 | Ga0496116_0007423 | Ga0496116_0007423_5296_6279 | 326 |
| 131 | 3300048920 | Ga0496117_0001548 | Ga0496117_0001548_3873_4856 | 326 |
| 132 | 3300048921 | Ga0496118_0001284 | Ga0496118_0001284_27533_28516 | 326 |
| 133 | 3300048922 | Ga0496119_0010884 | Ga0496119_0010884_4304_5287 | 326 |
| 134 | 3300048924 | Ga0496121_0003814 | Ga0496121_0003814_5744_6727 | 326 |
| 135 | 3300048925 | Ga0496122_0014952 | Ga0496122_0014952_5632_6618 | 326 |
| 136 | 3300048926 | Ga0496123_0004488 | Ga0496123_0004488_4316_5302 | 326 |
| 137 | 3300048928 | Ga0496125_0008684 | Ga0496125_0008684_8627_9610 | 326 |
| 138 | 3300048929 | Ga0496126_0004792 | Ga0496126_0004792_10027_11013 | 326 |
| 139 | 3300049569 | Ga0501032_0002313 | Ga0501032_0002313_2725_3705 | 326 |
| 140 | 3300049571 | Ga0501034_0006673 | Ga0501034_0006673_11231_12211 | 326 |
| 141 | 3300049573 | Ga0501037_0001502 | Ga0501037_0001502_13078_14058 | 326 |
| 142 | 3300049574 | Ga0501038_0001711 | Ga0501038_0001711_7799_8779 | 326 |
| 143 | 3300049575 | Ga0501039_0000526 | Ga0501039_0000526_15330_16310 | 326 |
| 144 | 3300049579 | Ga0501043_0000633 | Ga0501043_0000633_16868_17848 | 326 |
| 145 | 3300049586 | Ga0501070_0000448 | Ga0501070_0000448_15444_16424 | 326 |
| 146 | 3300049823 | Ga0501044_0031803 | Ga0501044_0031803_206_1186 | 326 |
| 147 | 3300050491 | nmdc:mga00v17_47360_c1 | nmdc:mga00v17_47360_c1_81_1067 | 326 |
| 148 | 3300053104 | Ga0500556_0012086 | Ga0500556_0012086_112_1095 | 326 |
| 149 | 3300053151 | Ga0500604_0023688 | Ga0500604_0023688_187_1170 | 326 |
| 150 | 3300053153 | Ga0500616_0003873 | Ga0500616_0003873_1898_2881 | 326 |
| 151 | 3300037853 | Ga0436364_1272522 | Ga0436364_1272522_125654_126652 | 328 |
| 152 | iso_pu_bacteria | 2738541274 | 2738705768 | 328 |
| 153 | iso_pu_bacteria | 2738543028 | 2739330258 | 328 |
| 154 | 3300001977 | JGI24746J21847_1002490 | JGI24746J21847_10024902 | 329 |
| 155 | 3300002077 | JGI24744J21845_10002573 | JGI24744J21845_100025733 | 329 |
| 156 | 3300002077 | JGI24744J21845_10003112 | JGI24744J21845_100031122 | 329 |
| 157 | 3300002239 | JGI24034J26672_10013465 | JGI24034J26672_100134651 | 329 |
| 158 | 3300005334 | Ga0068869_100015510 | Ga0068869_1000155103 | 329 |
| 159 | 3300005334 | Ga0068869_100069444 | Ga0068869_1000694443 | 329 |
| 160 | 3300005337 | Ga0070682_100081387 | Ga0070682_1000813872 | 329 |
| 161 | 3300005338 | Ga0068868_100052337 | Ga0068868_1000523373 | 329 |
| 162 | 3300005338 | Ga0068868_100306585 | Ga0068868_1003065852 | 329 |
| 163 | 3300005341 | Ga0070691_10099316 | Ga0070691_100993161 | 329 |
| 164 | 3300005347 | Ga0070668_100003680 | Ga0070668_1000036802 | 329 |
| 165 | 3300005347 | Ga0070668_100096244 | Ga0070668_1000962442 | 329 |
| 166 | 3300005347 | Ga0070668_100139978 | Ga0070668_1001399782 | 329 |
| 167 | 3300005353 | Ga0070669_100067660 | Ga0070669_1000676603 | 329 |
| 168 | 3300005356 | Ga0070674_100130564 | Ga0070674_1001305641 | 329 |
| 169 | 3300005364 | Ga0070673_100377686 | Ga0070673_1003776861 | 329 |
| 170 | 3300005365 | Ga0070688_100062020 | Ga0070688_1000620202 | 329 |
| 171 | 3300005367 | Ga0070667_100006205 | Ga0070667_1000062053 | 329 |
| 172 | 3300005367 | Ga0070667_100054985 | Ga0070667_1000549853 | 329 |
| 173 | 3300005367 | Ga0070667_100084903 | Ga0070667_1000849034 | 329 |
| 174 | 3300005434 | Ga0070709_10012970 | Ga0070709_100129706 | 329 |
| 175 | 3300005435 | Ga0070714_100132080 | Ga0070714_1001320802 | 329 |
| 176 | 3300005435 | Ga0070714_100200052 | Ga0070714_1002000522 | 329 |
| 177 | 3300005437 | Ga0070710_10006167 | Ga0070710_100061675 | 329 |
| 178 | 3300005438 | Ga0070701_10000802 | Ga0070701_100008022 | 329 |
| 179 | 3300005439 | Ga0070711_100002361 | Ga0070711_1000023619 | 329 |
| 180 | 3300005455 | Ga0070663_100041173 | Ga0070663_1000411731 | 329 |
| 181 | 3300005456 | Ga0070678_100002715 | Ga0070678_1000027155 | 329 |
| 182 | 3300005456 | Ga0070678_100062580 | Ga0070678_1000625803 | 329 |
| 183 | 3300005457 | Ga0070662_100011550 | Ga0070662_1000115504 | 329 |
| 184 | 3300005459 | Ga0068867_100003221 | Ga0068867_1000032217 | 329 |
| 185 | 3300005459 | Ga0068867_100036364 | Ga0068867_1000363643 | 329 |
| 186 | 3300005543 | Ga0070672_100090876 | Ga0070672_1000908762 | 329 |
| 187 | 3300005545 | Ga0070695_100022325 | Ga0070695_1000223252 | 329 |
| 188 | 3300005546 | Ga0070696_100066499 | Ga0070696_1000664993 | 329 |
| 189 | 3300005547 | Ga0070693_100034349 | Ga0070693_1000343492 | 329 |
| 190 | 3300005548 | Ga0070665_100008312 | Ga0070665_1000083123 | 329 |
| 191 | 3300005548 | Ga0070665_100063964 | Ga0070665_1000639643 | 329 |
| 192 | 3300005548 | Ga0070665_100087058 | Ga0070665_1000870583 | 329 |
| 193 | 3300005549 | Ga0070704_100000443 | Ga0070704_10000044317 | 329 |
| 194 | 3300005563 | Ga0068855_100104991 | Ga0068855_1001049914 | 329 |
| 195 | 3300005578 | Ga0068854_100000515 | Ga0068854_1000005155 | 329 |
| 196 | 3300005615 | Ga0070702_100023924 | Ga0070702_1000239243 | 329 |
| 197 | 3300005616 | Ga0068852_100157896 | Ga0068852_1001578963 | 329 |
| 198 | 3300005617 | Ga0068859_100000276 | Ga0068859_10000027647 | 329 |
| 199 | 3300005617 | Ga0068859_100025626 | Ga0068859_1000256265 | 329 |
| 200 | 3300005718 | Ga0068866_10000609 | Ga0068866_100006093 | 329 |
| 201 | 3300005719 | Ga0068861_100000307 | Ga0068861_1000003075 | 329 |
| 202 | 3300005719 | Ga0068861_100196838 | Ga0068861_1001968382 | 329 |
| 203 | 3300005841 | Ga0068863_100000768 | Ga0068863_1000007682 | 329 |
| 204 | 3300005841 | Ga0068863_100020245 | Ga0068863_1000202454 | 329 |
| 205 | 3300005841 | Ga0068863_100029468 | Ga0068863_1000294683 | 329 |
| 206 | 3300005841 | Ga0068863_100110335 | Ga0068863_1001103353 | 329 |
| 207 | 3300005842 | Ga0068858_100000440 | Ga0068858_1000004408 | 329 |
| 208 | 3300005842 | Ga0068858_100008729 | Ga0068858_1000087294 | 329 |
| 209 | 3300005843 | Ga0068860_100000232 | Ga0068860_10000023243 | 329 |
| 210 | 3300005843 | Ga0068860_100009056 | Ga0068860_1000090563 | 329 |
| 211 | 3300005843 | Ga0068860_100025102 | Ga0068860_1000251024 | 329 |
| 212 | 3300005844 | Ga0068862_100000055 | Ga0068862_10000005549 | 329 |
| 213 | 3300005844 | Ga0068862_100027936 | Ga0068862_1000279364 | 329 |
| 214 | 3300005981 | Ga0081538_10113529 | Ga0081538_101135292 | 329 |
| 215 | 3300006038 | Ga0075365_10005734 | Ga0075365_100057342 | 329 |
| 216 | 3300006038 | Ga0075365_10025315 | Ga0075365_100253155 | 329 |
| 217 | 3300006038 | Ga0075365_10036037 | Ga0075365_100360373 | 329 |
| 218 | 3300006042 | Ga0075368_10018698 | Ga0075368_100186983 | 329 |
| 219 | 3300006048 | Ga0075363_100006782 | Ga0075363_1000067828 | 329 |
| 220 | 3300006048 | Ga0075363_100013376 | Ga0075363_1000133763 | 329 |
| 221 | 3300006048 | Ga0075363_100017787 | Ga0075363_1000177873 | 329 |
| 222 | 3300006048 | Ga0075363_100020887 | Ga0075363_1000208873 | 329 |
| 223 | 3300006048 | Ga0075363_100024049 | Ga0075363_1000240494 | 329 |
| 224 | 3300006048 | Ga0075363_100092846 | Ga0075363_1000928462 | 329 |
| 225 | 3300006048 | Ga0075363_100106996 | Ga0075363_1001069962 | 329 |
| 226 | 3300006051 | Ga0075364_10000391 | Ga0075364_1000039113 | 329 |
| 227 | 3300006051 | Ga0075364_10001597 | Ga0075364_1000159710 | 329 |
| 228 | 3300006051 | Ga0075364_10014676 | Ga0075364_100146764 | 329 |
| 229 | 3300006051 | Ga0075364_10015074 | Ga0075364_100150744 | 329 |
| 230 | 3300006051 | Ga0075364_10021521 | Ga0075364_100215215 | 329 |
| 231 | 3300006175 | Ga0070712_100001270 | Ga0070712_1000012708 | 329 |
| 232 | 3300006175 | Ga0070712_100009279 | Ga0070712_1000092795 | 329 |
| 233 | 3300006177 | Ga0075362_10009407 | Ga0075362_100094072 | 329 |
| 234 | 3300006177 | Ga0075362_10070177 | Ga0075362_100701772 | 329 |
| 235 | 3300006178 | Ga0075367_10015394 | Ga0075367_100153943 | 329 |
| 236 | 3300006178 | Ga0075367_10189036 | Ga0075367_101890361 | 329 |
| 237 | 3300006178 | Ga0075367_10244339 | Ga0075367_102443392 | 329 |
| 238 | 3300006186 | Ga0075369_10050875 | Ga0075369_100508752 | 329 |
| 239 | 3300006195 | Ga0075366_10085130 | Ga0075366_100851302 | 329 |
| 240 | 3300006237 | Ga0097621_100258425 | Ga0097621_1002584252 | 329 |
| 241 | 3300006353 | Ga0075370_10000744 | Ga0075370_100007446 | 329 |
| 242 | 3300006353 | Ga0075370_10001636 | Ga0075370_100016365 | 329 |
| 243 | 3300006353 | Ga0075370_10010380 | Ga0075370_100103803 | 329 |
| 244 | 3300006353 | Ga0075370_10010428 | Ga0075370_100104282 | 329 |
| 245 | 3300006358 | Ga0068871_100216498 | Ga0068871_1002164982 | 329 |
| 246 | 3300006846 | Ga0075430_100032892 | Ga0075430_1000328922 | 329 |
| 247 | 3300006847 | Ga0075431_100145936 | Ga0075431_1001459363 | 329 |
| 248 | 3300006881 | Ga0068865_100046063 | Ga0068865_1000460632 | 329 |
| 249 | 3300006931 | Ga0097620_100000276 | Ga0097620_10000027647 | 329 |
| 250 | 3300006931 | Ga0097620_100025628 | Ga0097620_1000256283 | 329 |
| 251 | 3300009098 | Ga0105245_10010633 | Ga0105245_100106332 | 329 |
| 252 | 3300009098 | Ga0105245_10031418 | Ga0105245_100314187 | 329 |
| 253 | 3300009147 | Ga0114129_10644922 | Ga0114129_106449222 | 329 |
| 254 | 3300009148 | Ga0105243_10009400 | Ga0105243_100094006 | 329 |
| 255 | 3300009148 | Ga0105243_10059113 | Ga0105243_100591133 | 329 |
| 256 | 3300009176 | Ga0105242_10003225 | Ga0105242_100032255 | 329 |
| 257 | 3300009177 | Ga0105248_10014990 | Ga0105248_100149903 | 329 |
| 258 | 3300009553 | Ga0105249_10024146 | Ga0105249_100241466 | 329 |
| 259 | 3300009553 | Ga0105249_10104263 | Ga0105249_101042633 | 329 |
| 260 | 3300010375 | Ga0105239_10005314 | Ga0105239_1000531410 | 329 |
| 261 | 3300010375 | Ga0105239_10167154 | Ga0105239_101671543 | 329 |
| 262 | 3300011119 | Ga0105246_10137790 | Ga0105246_101377902 | 329 |
| 263 | 3300013105 | Ga0157369_10127271 | Ga0157369_101272713 | 329 |
| 264 | 3300013297 | Ga0157378_10005026 | Ga0157378_100050265 | 329 |
| 265 | 3300013306 | Ga0163162_10010099 | Ga0163162_100100991 | 329 |
| 266 | 3300013306 | Ga0163162_10040972 | Ga0163162_100409726 | 329 |
| 267 | 3300013306 | Ga0163162_10087660 | Ga0163162_100876603 | 329 |
| 268 | 3300013306 | Ga0163162_10252945 | Ga0163162_102529452 | 329 |
| 269 | 3300013307 | Ga0157372_10000875 | Ga0157372_100008752 | 329 |
| 270 | 3300013308 | Ga0157375_10010499 | Ga0157375_100104992 | 329 |
| 271 | 3300013308 | Ga0157375_10030659 | Ga0157375_100306593 | 329 |
| 272 | 3300014325 | Ga0163163_10163826 | Ga0163163_101638263 | 329 |
| 273 | 3300014497 | Ga0182008_10116848 | Ga0182008_101168482 | 329 |
| 274 | 3300014969 | Ga0157376_10048523 | Ga0157376_100485232 | 329 |
| 275 | 3300017792 | Ga0163161_10001293 | Ga0163161_100012934 | 329 |
| 276 | 3300017792 | Ga0163161_10108683 | Ga0163161_101086833 | 329 |
| 277 | 3300025898 | Ga0207692_10065706 | Ga0207692_100657062 | 329 |
| 278 | 3300025899 | Ga0207642_10003076 | Ga0207642_100030762 | 329 |
| 279 | 3300025899 | Ga0207642_10028214 | Ga0207642_100282142 | 329 |
| 280 | 3300025899 | Ga0207642_10163134 | Ga0207642_101631341 | 329 |
| 281 | 3300025900 | Ga0207710_10000046 | Ga0207710_1000004646 | 329 |
| 282 | 3300025900 | Ga0207710_10003445 | Ga0207710_100034453 | 329 |
| 283 | 3300025900 | Ga0207710_10079113 | Ga0207710_100791132 | 329 |
| 284 | 3300025901 | Ga0207688_10000623 | Ga0207688_1000062314 | 329 |
| 285 | 3300025901 | Ga0207688_10000910 | Ga0207688_1000091011 | 329 |
| 286 | 3300025906 | Ga0207699_10036450 | Ga0207699_100364503 | 329 |
| 287 | 3300025906 | Ga0207699_10102458 | Ga0207699_101024582 | 329 |
| 288 | 3300025915 | Ga0207693_10000614 | Ga0207693_1000061423 | 329 |
| 289 | 3300025916 | Ga0207663_10002572 | Ga0207663_100025724 | 329 |
| 290 | 3300025923 | Ga0207681_10000341 | Ga0207681_1000034124 | 329 |
| 291 | 3300025924 | Ga0207694_10354272 | Ga0207694_103542722 | 329 |
| 292 | 3300025925 | Ga0207650_10128705 | Ga0207650_101287053 | 329 |
| 293 | 3300025927 | Ga0207687_10001777 | Ga0207687_100017772 | 329 |
| 294 | 3300025927 | Ga0207687_10011562 | Ga0207687_100115627 | 329 |
| 295 | 3300025931 | Ga0207644_10414353 | Ga0207644_104143531 | 329 |
| 296 | 3300025933 | Ga0207706_10001079 | Ga0207706_1000107927 | 329 |
| 297 | 3300025934 | Ga0207686_10004045 | Ga0207686_100040451 | 329 |
| 298 | 3300025935 | Ga0207709_10045476 | Ga0207709_100454763 | 329 |
| 299 | 3300025937 | Ga0207669_10000085 | Ga0207669_1000008547 | 329 |
| 300 | 3300025937 | Ga0207669_10047229 | Ga0207669_100472293 | 329 |
| 301 | 3300025937 | Ga0207669_10056817 | Ga0207669_100568172 | 329 |
| 302 | 3300025938 | Ga0207704_10006243 | Ga0207704_100062435 | 329 |
| 303 | 3300025939 | Ga0207665_10012387 | Ga0207665_100123876 | 329 |
| 304 | 3300025939 | Ga0207665_10029462 | Ga0207665_100294624 | 329 |
| 305 | 3300025941 | Ga0207711_10000111 | Ga0207711_1000011147 | 329 |
| 306 | 3300025941 | Ga0207711_10091812 | Ga0207711_100918123 | 329 |
| 307 | 3300025942 | Ga0207689_10036744 | Ga0207689_100367443 | 329 |
| 308 | 3300025961 | Ga0207712_10000017 | Ga0207712_10000017243 | 329 |
| 309 | 3300025961 | Ga0207712_10212965 | Ga0207712_102129652 | 329 |
| 310 | 3300025961 | Ga0207712_10321587 | Ga0207712_103215872 | 329 |
| 311 | 3300025981 | Ga0207640_10010787 | Ga0207640_100107874 | 329 |
| 312 | 3300025986 | Ga0207658_10000612 | Ga0207658_1000061217 | 329 |
| 313 | 3300025986 | Ga0207658_10027811 | Ga0207658_100278114 | 329 |
| 314 | 3300025986 | Ga0207658_10103610 | Ga0207658_101036101 | 329 |
| 315 | 3300026023 | Ga0207677_10065449 | Ga0207677_100654492 | 329 |
| 316 | 3300026023 | Ga0207677_10212655 | Ga0207677_102126552 | 329 |
| 317 | 3300026035 | Ga0207703_10002482 | Ga0207703_1000248215 | 329 |
| 318 | 3300026035 | Ga0207703_10072731 | Ga0207703_100727313 | 329 |
| 319 | 3300026035 | Ga0207703_10165955 | Ga0207703_101659552 | 329 |
| 320 | 3300026041 | Ga0207639_10149045 | Ga0207639_101490452 | 329 |
| 321 | 3300026067 | Ga0207678_10044033 | Ga0207678_100440335 | 329 |
| 322 | 3300026075 | Ga0207708_10000329 | Ga0207708_1000032934 | 329 |
| 323 | 3300026088 | Ga0207641_10000378 | Ga0207641_1000037824 | 329 |
| 324 | 3300026088 | Ga0207641_10019974 | Ga0207641_100199747 | 329 |
| 325 | 3300026088 | Ga0207641_10034558 | Ga0207641_100345583 | 329 |
| 326 | 3300026089 | Ga0207648_10000112 | Ga0207648_1000011255 | 329 |
| 327 | 3300026089 | Ga0207648_10166049 | Ga0207648_101660492 | 329 |
| 328 | 3300026118 | Ga0207675_100000117 | Ga0207675_10000011759 | 329 |
| 329 | 3300026121 | Ga0207683_10000451 | Ga0207683_100004514 | 329 |
| 330 | 3300026121 | Ga0207683_10232737 | Ga0207683_102327372 | 329 |
| 331 | 3300028379 | Ga0268266_10019511 | Ga0268266_100195112 | 329 |
| 332 | 3300028379 | Ga0268266_10222589 | Ga0268266_102225892 | 329 |
| 333 | 3300028379 | Ga0268266_10272934 | Ga0268266_102729342 | 329 |
| 334 | 3300028380 | Ga0268265_10000067 | Ga0268265_1000006749 | 329 |
| 335 | 3300028380 | Ga0268265_10019465 | Ga0268265_100194652 | 329 |
| 336 | 3300028381 | Ga0268264_10000146 | Ga0268264_10000146102 | 329 |
| 337 | 3300028381 | Ga0268264_10008289 | Ga0268264_100082894 | 329 |
| 338 | 3300028381 | Ga0268264_10263709 | Ga0268264_102637092 | 329 |
| 339 | 3300031731 | Ga0307405_10089587 | Ga0307405_100895872 | 329 |
| 340 | 3300031824 | Ga0307413_10076278 | Ga0307413_100762782 | 329 |
| 341 | 3300031852 | Ga0307410_10168927 | Ga0307410_101689272 | 329 |
| 342 | 3300031901 | Ga0307406_10027007 | Ga0307406_100270073 | 329 |
| 343 | 3300031901 | Ga0307406_10087310 | Ga0307406_100873102 | 329 |
| 344 | 3300031911 | Ga0307412_10327681 | Ga0307412_103276812 | 329 |
| 345 | 3300031995 | Ga0307409_100060920 | Ga0307409_1000609201 | 329 |
| 346 | 3300032005 | Ga0307411_10259174 | Ga0307411_102591742 | 329 |
| 347 | 3300032126 | Ga0307415_100192116 | Ga0307415_1001921162 | 329 |
| 348 | 3300035691 | Ga0373931_0025686 | Ga0373931_0025686_285_1274 | 329 |
| 349 | 3300039437 | Ga0436365_0957112 | Ga0436365_0957112_3778_4767 | 329 |
| 350 | 3300039437 | Ga0436365_1737435 | Ga0436365_1737435_3514_4503 | 329 |
| 351 | 3300041410 | Ga0439461_0004719 | Ga0439461_0004719_1231_2223 | 329 |
| 352 | 3300041413 | Ga0439465_0002060 | Ga0439465_0002060_5157_6149 | 329 |
| 353 | 3300041997 | Ga0439431_0003398 | Ga0439431_0003398_981_1973 | 329 |
| 354 | 3300042435 | Ga0439434_0006002 | Ga0439434_0006002_1593_2585 | 329 |
| 355 | 3300044658 | Ga0466972_0017376 | Ga0466972_0017376_525_1514 | 329 |
| 356 | 3300044658 | Ga0466972_0049154 | Ga0466972_0049154_756_1745 | 329 |
| 357 | 3300044684 | Ga0466966_0022227 | Ga0466966_0022227_1252_2241 | 329 |
| 358 | 3300044735 | Ga0466968_0043633 | Ga0466968_0043633_731_1720 | 329 |
| 359 | 3300044842 | Ga0466957_0024254 | Ga0466957_0024254_652_1650 | 329 |
| 360 | 3300045049 | Ga0466959_0160773 | Ga0466959_0160773_147_1136 | 329 |
| 361 | 3300045836 | Ga0466958_0001254 | Ga0466958_0001254_5493_6482 | 329 |
| 362 | 3300045836 | Ga0466958_0049201 | Ga0466958_0049201_36_1025 | 329 |
| 363 | 3300045976 | Ga0466967_0007332 | Ga0466967_0007332_3304_4302 | 329 |
| 364 | 3300045976 | Ga0466967_0017251 | Ga0466967_0017251_3866_4855 | 329 |
| 365 | 3300046459 | Ga0495629_0030780 | Ga0495629_0030780_1605_2594 | 329 |
| 366 | 3300046472 | Ga0495580_0099511 | Ga0495580_0099511_858_1847 | 329 |
| 367 | 3300046473 | Ga0495582_0034087 | Ga0495582_0034087_975_1964 | 329 |
| 368 | 3300046499 | Ga0495594_0086105 | Ga0495594_0086105_637_1626 | 329 |
| 369 | 3300046690 | Ga0495624_0079336 | Ga0495624_0079336_267_1256 | 329 |
| 370 | 3300047472 | Ga0495686_0037954 | Ga0495686_0037954_1925_2917 | 329 |
| 371 | 3300048903 | Ga0496100_0000395 | Ga0496100_0000395_9330_10322 | 329 |
| 372 | 3300048903 | Ga0496100_0030130 | Ga0496100_0030130_1853_2842 | 329 |
| 373 | 3300048903 | Ga0496100_0293424 | Ga0496100_0293424_177_1172 | 329 |
| 374 | 3300048904 | Ga0496101_0001579 | Ga0496101_0001579_26_1018 | 329 |
| 375 | 3300048904 | Ga0496101_0004109 | Ga0496101_0004109_3604_4593 | 329 |
| 376 | 3300048905 | Ga0496102_0010611 | Ga0496102_0010611_2246_3235 | 329 |
| 377 | 3300048905 | Ga0496102_0130211 | Ga0496102_0130211_717_1706 | 329 |
| 378 | 3300048905 | Ga0496102_0275987 | Ga0496102_0275987_269_1258 | 329 |
| 379 | 3300048906 | Ga0496103_0003795 | Ga0496103_0003795_3642_4631 | 329 |
| 380 | 3300048908 | Ga0496105_0031605 | Ga0496105_0031605_2037_3029 | 329 |
| 381 | 3300048908 | Ga0496105_0125688 | Ga0496105_0125688_436_1425 | 329 |
| 382 | 3300048909 | Ga0496106_0002405 | Ga0496106_0002405_510_1502 | 329 |
| 383 | 3300048909 | Ga0496106_0006699 | Ga0496106_0006699_4266_5255 | 329 |
| 384 | 3300048909 | Ga0496106_0084182 | Ga0496106_0084182_1231_2220 | 329 |
| 385 | 3300048910 | Ga0496107_0004395 | Ga0496107_0004395_5304_6293 | 329 |
| 386 | 3300048911 | Ga0496108_0002116 | Ga0496108_0002116_7422_8411 | 329 |
| 387 | 3300048911 | Ga0496108_0044032 | Ga0496108_0044032_711_1700 | 329 |
| 388 | 3300048911 | Ga0496108_0147461 | Ga0496108_0147461_321_1310 | 329 |
| 389 | 3300048912 | Ga0496109_0007462 | Ga0496109_0007462_4768_5757 | 329 |
| 390 | 3300048913 | Ga0496110_0028720 | Ga0496110_0028720_1144_2133 | 329 |
| 391 | 3300048913 | Ga0496110_0459846 | Ga0496110_0459846_118_1107 | 329 |
| 392 | 3300048915 | Ga0496112_0004365 | Ga0496112_0004365_4169_5158 | 329 |
| 393 | 3300048915 | Ga0496112_0038710 | Ga0496112_0038710_1623_2618 | 329 |
| 394 | 3300048915 | Ga0496112_0133336 | Ga0496112_0133336_1429_2418 | 329 |
| 395 | 3300048916 | Ga0496113_0002563 | Ga0496113_0002563_73_1068 | 329 |
| 396 | 3300048916 | Ga0496113_0179922 | Ga0496113_0179922_51_1040 | 329 |
| 397 | 3300048917 | Ga0496114_0000629 | Ga0496114_0000629_10104_11096 | 329 |
| 398 | 3300048917 | Ga0496114_0002083 | Ga0496114_0002083_6763_7752 | 329 |
| 399 | 3300048918 | Ga0496115_0000824 | Ga0496115_0000824_13107_14099 | 329 |
| 400 | 3300048918 | Ga0496115_0001294 | Ga0496115_0001294_6309_7298 | 329 |
| 401 | 3300048929 | Ga0496126_0008009 | Ga0496126_0008009_7490_8488 | 329 |
| 402 | 3300049570 | Ga0501033_0018634 | Ga0501033_0018634_354_1343 | 329 |
| 403 | 3300049571 | Ga0501034_0066271 | Ga0501034_0066271_124_1113 | 329 |
| 404 | 3300049571 | Ga0501034_0194650 | Ga0501034_0194650_669_1658 | 329 |
| 405 | 3300049586 | Ga0501070_0111388 | Ga0501070_0111388_524_1513 | 329 |
| 406 | 3300049822 | Ga0501035_0000753 | Ga0501035_0000753_25943_26932 | 329 |
| 407 | 3300050489 | nmdc:mga03683_40485_c1 | nmdc:mga03683_40485_c1_647_1636 | 329 |
| 408 | 3300050490 | nmdc:mga03n38_10861_c1 | nmdc:mga03n38_10861_c1_762_1751 | 329 |
| 409 | 3300050490 | nmdc:mga03n38_4468_c1 | nmdc:mga03n38_4468_c1_493_1482 | 329 |
| 410 | 3300050490 | nmdc:mga03n38_5303_c1 | nmdc:mga03n38_5303_c1_1136_2125 | 329 |
| 411 | 3300050490 | nmdc:mga03n38_68129_c1 | nmdc:mga03n38_68129_c1_564_1553 | 329 |
| 412 | 3300050490 | nmdc:mga03n38_9923_c1 | nmdc:mga03n38_9923_c1_2480_3469 | 329 |
| 413 | 3300050491 | nmdc:mga00v17_1485_c1 | nmdc:mga00v17_1485_c1_3484_4473 | 329 |
| 414 | 3300050491 | nmdc:mga00v17_31066_c1 | nmdc:mga00v17_31066_c1_305_1294 | 329 |
| 415 | 3300050491 | nmdc:mga00v17_3556_c1 | nmdc:mga00v17_3556_c1_461_1456 | 329 |
| 416 | 3300050491 | nmdc:mga00v17_36857_c1 | nmdc:mga00v17_36857_c1_1475_2464 | 329 |
| 417 | 3300050491 | nmdc:mga00v17_4942_c1 | nmdc:mga00v17_4942_c1_4237_5226 | 329 |
| 418 | 3300050491 | nmdc:mga00v17_9836_c1 | nmdc:mga00v17_9836_c1_2132_3121 | 329 |
| 419 | 3300050492 | nmdc:mga0yw44_112976_c1 | nmdc:mga0yw44_112976_c1_720_1718 | 329 |
| 420 | 3300050492 | nmdc:mga0yw44_297012_c1 | nmdc:mga0yw44_297012_c1_16_1005 | 329 |
| 421 | 3300050492 | nmdc:mga0yw44_33988_c1 | nmdc:mga0yw44_33988_c1_1882_2871 | 329 |
| 422 | 3300050492 | nmdc:mga0yw44_5173_c1 | nmdc:mga0yw44_5173_c1_788_1777 | 329 |
| 423 | 3300050494 | nmdc:mga06z11_180244_c1 | nmdc:mga06z11_180244_c1_116_1105 | 329 |
| 424 | 3300050494 | nmdc:mga06z11_18125_c1 | nmdc:mga06z11_18125_c1_227_1216 | 329 |
| 425 | 3300050496 | nmdc:mga07m45_813_c2 | nmdc:mga07m45_813_c2_2498_3487 | 329 |
| 426 | 3300050496 | nmdc:mga07m45_8384_c1 | nmdc:mga07m45_8384_c1_1107_2096 | 329 |
| 427 | 3300050507 | nmdc:mga05p37_374819_c1 | nmdc:mga05p37_374819_c1_247_1236 | 329 |
| 428 | 3300050509 | nmdc:mga0qj67_27780_c1 | nmdc:mga0qj67_27780_c1_3077_4069 | 329 |
| 429 | 3300050510 | nmdc:mga06r32_29577_c1 | nmdc:mga06r32_29577_c1_1086_2078 | 329 |
| 430 | 3300050516 | nmdc:mga0sz30_24898_c1 | nmdc:mga0sz30_24898_c1_412_1410 | 329 |
| 431 | 3300050516 | nmdc:mga0sz30_385_c1 | nmdc:mga0sz30_385_c1_6492_7481 | 329 |
| 432 | 3300053080 | Ga0500635_0007142 | Ga0500635_0007142_677_1675 | 329 |
| 433 | 3300053087 | Ga0500643_024608 | Ga0500643_024608_89_1087 | 329 |
| 434 | 3300053087 | Ga0500643_033109 | Ga0500643_033109_406_1398 | 329 |
| 435 | 3300053109 | Ga0500569_036683 | Ga0500569_036683_26_1015 | 329 |
| 436 | 3300053131 | Ga0500652_046702 | Ga0500652_046702_281_1279 | 329 |
| 437 | 3300053153 | Ga0500616_0072491 | Ga0500616_0072491_462_1451 | 329 |
| 438 | 3300053730 | Ga0500645_000007 | Ga0500645_000007_49631_50629 | 329 |
| 439 | 3300053730 | Ga0500645_042795 | Ga0500645_042795_169_1167 | 329 |
| 440 | 3300053730 | Ga0500645_057143 | Ga0500645_057143_66_1064 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ibz-assembly1.cif.gz_D | crystal structure of a novel cyclase (pfam04199). | 0.7944 | 14 | 329 |
| 8hmo-assembly3.cif.gz_E | crystal structure of metal-dependent hydrolase complexed with manganese from bacillus smithii | 0.7928 | 157 | 328 |
| 5ibz-assembly1.cif.gz_D | crystal structure of a novel cyclase (pfam04199). | 0.7893 | 14 | 329 |
| 5ibz-assembly1.cif.gz_A | crystal structure of a novel cyclase (pfam04199). | 0.7883 | 11 | 329 |
| 1r61-assembly1.cif.gz_A | the structure of predicted metal-dependent hydrolase from bacillus stearothermophilus | 0.7833 | 166 | 327 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5nmpC00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7881 | 156 | 327 | 3.50.30.50 |
| af_Q2G123_4_245_3.50.30.50 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.788 | 157 | 328 | 3.50.30.50 |
| af_C4JAI3_56_274_3.50.30.50 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7557 | 150 | 328 | 3.50.30.50 |
| 4co9B00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7481 | 157 | 327 | 3.50.30.50 |
| 3krvB00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase | 0.7223 | 166 | 327 | 3.50.30.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G1I3H4-F1-model_v4 | Cyclase family protein | 0.978 | 177 | 329 |
GO:0004061
GO:0019441 |
| AF-X8C715-F1-model_v4 | deleted | 0.9766 | 205 | 329 |
|
| AF-X8C715-F1-model_v4 | deleted | 0.969 | 205 | 329 |
|
| AF-A0A7G1I3H4-F1-model_v4 | Cyclase family protein | 0.9655 | 177 | 329 |
GO:0004061
GO:0019441 |
| AF-X8A381-F1-model_v4 | deleted | 0.9585 | 119 | 329 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar