F444424

General Info

Members Datasets Scaffolds Average Seq Length
440 244 421 328

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10373992|Ga0157375_103739922
Length 353
Sequence MSTTPAAASGTRRTPTERPDELDRTDPARHVAESAEAFRNWGRWGEDDRLGTLNFIGDAERARAATLVRRGASFSLSQPFDMNGPQQGWRRRTNPVHTMLDTGTDAAAGTQGFPHGIGGADDVVAMPLQCSTQWDGLGHIFDRGMAWNGRPAGSVVTSDGDLVTGIEHAASAIVGRGVLLDLGRFLRPEPTDDDADNGAVGELPDGYAITTAELEACISAQGATSAVGRGDLVLVRTGRYARALREGWNGYAGGPSAGLSFTTAGWLHRTEIAAIATDTWGFEVRPNEFDVPAFQPLHQVVIPNLGLTIGEMWDLDELGDVCAQTRRYHFFLSAPPLPITGAVGSPINPVAIL

Samples

Sample ID Description Type Environment
1 2643221575 Microbacterium sp. Root61 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
6 2808606372 Agromyces sp. 23-23 Isolate Unclassified
7 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
8 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
9 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
10 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
11 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
12 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
13 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
14 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
15 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
16 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
17 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
18 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
19 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
235 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 0
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.59
Nodule 0
Rhizoplane 9.32
Rhizosphere 66.82
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002490 3300001977 Bacteria 2934
2 JGI24744J21845_10002573 3300002077 Bacteria 3704
3 JGI24744J21845_10003112 3300002077 Bacteria 3401
4 JGI24034J26672_10013465 3300002239 Bacteria 1241
5 Ga0065714_10081064 3300005288 Bacteria 2399
6 Ga0068869_100015510 3300005334 Bacteria 5114
7 Ga0068869_100069444 3300005334 Bacteria 2605
8 Ga0070682_100081387 3300005337 Bacteria 2096
9 Ga0068868_100052337 3300005338 Bacteria 3214
10 Ga0068868_100306585 3300005338 Bacteria 1350
11 Ga0070691_10099316 3300005341 Bacteria 1444
12 Ga0070668_100000415 3300005347 Bacteria 28362
13 Ga0070668_100003680 3300005347 Bacteria 11320
14 Ga0070668_100096244 3300005347 Bacteria 2340
15 Ga0070668_100125449 3300005347 Bacteria 2056
16 Ga0070668_100139978 3300005347 Bacteria 1949
17 Ga0070668_100335727 3300005347 Bacteria 1276
18 Ga0070669_100001239 3300005353 Bacteria 18500
19 Ga0070669_100067660 3300005353 Bacteria 2635
20 Ga0070675_100098553 3300005354 Bacteria 2459
21 Ga0070674_100130564 3300005356 Bacteria 1872
22 Ga0070673_100377686 3300005364 Bacteria 1263
23 Ga0070688_100062020 3300005365 Bacteria 2366
24 Ga0070667_100000679 3300005367 Bacteria 32958
25 Ga0070667_100006205 3300005367 Bacteria 9944
26 Ga0070667_100054985 3300005367 Bacteria 3361
27 Ga0070667_100084903 3300005367 Bacteria 2714
28 Ga0070709_10012970 3300005434 Bacteria 4675
29 Ga0070714_100037059 3300005435 Bacteria 4096
30 Ga0070714_100132080 3300005435 Bacteria 2232
31 Ga0070714_100200052 3300005435 Bacteria 1827
32 Ga0070710_10006167 3300005437 Bacteria 5737
33 Ga0070701_10000802 3300005438 Bacteria 11224
34 Ga0070711_100002361 3300005439 Bacteria 10733
35 Ga0070663_100041173 3300005455 Bacteria 3238
36 Ga0070663_100223296 3300005455 Bacteria 1480
37 Ga0070678_100002715 3300005456 Bacteria 9767
38 Ga0070678_100062580 3300005456 Bacteria 2748
39 Ga0070662_100011550 3300005457 Bacteria 5827
40 Ga0068867_100003221 3300005459 Bacteria 11509
41 Ga0068867_100036364 3300005459 Bacteria 3575
42 Ga0070672_100090876 3300005543 Bacteria 2463
43 Ga0070695_100022325 3300005545 Bacteria 3882
44 Ga0070696_100066499 3300005546 Bacteria 2528
45 Ga0070693_100034349 3300005547 Bacteria 2806
46 Ga0070665_100001757 3300005548 Bacteria 24788
47 Ga0070665_100008312 3300005548 Bacteria 10498
48 Ga0070665_100063964 3300005548 Bacteria 3689
49 Ga0070665_100087058 3300005548 Bacteria 3129
50 Ga0070704_100000443 3300005549 Bacteria 19456
51 Ga0068855_100104991 3300005563 Bacteria 3249
52 Ga0068854_100000515 3300005578 Bacteria 23453
53 Ga0070702_100023924 3300005615 Bacteria 3252
54 Ga0068852_100157896 3300005616 Bacteria 2115
55 Ga0068859_100000276 3300005617 Bacteria 51118
56 Ga0068859_100025626 3300005617 Bacteria 5915
57 Ga0068859_100085108 3300005617 Bacteria 3207
58 Ga0068866_10000609 3300005718 Bacteria 16358
59 Ga0068861_100000307 3300005719 Bacteria 27379
60 Ga0068861_100145257 3300005719 Bacteria 1941
61 Ga0068861_100196838 3300005719 Bacteria 1689
62 Ga0068863_100000768 3300005841 Bacteria 32211
63 Ga0068863_100000835 3300005841 Bacteria 30885
64 Ga0068863_100020245 3300005841 Bacteria 6364
65 Ga0068863_100029468 3300005841 Bacteria 5239
66 Ga0068863_100110335 3300005841 Bacteria 2620
67 Ga0068858_100000440 3300005842 Bacteria 43437
68 Ga0068858_100008729 3300005842 Bacteria 9731
69 Ga0068860_100000232 3300005843 Bacteria 85501
70 Ga0068860_100009056 3300005843 Bacteria 9907
71 Ga0068860_100025102 3300005843 Bacteria 5751
72 Ga0068862_100000055 3300005844 Bacteria 142386
73 Ga0068862_100027936 3300005844 Bacteria 4751
74 Ga0068862_100045415 3300005844 Bacteria 3749
75 Ga0081538_10113529 3300005981 Bacteria 1323
76 Ga0075365_10005734 3300006038 Bacteria 6738
77 Ga0075365_10025315 3300006038 Bacteria 3755
78 Ga0075365_10036037 3300006038 Bacteria 3204
79 Ga0075365_10094529 3300006038 Bacteria 2040
80 Ga0075368_10018698 3300006042 Bacteria 2607
81 Ga0075363_100006782 3300006048 Bacteria 5229
82 Ga0075363_100013376 3300006048 Bacteria 3975
83 Ga0075363_100017787 3300006048 Bacteria 3531
84 Ga0075363_100020887 3300006048 Bacteria 3290
85 Ga0075363_100024049 3300006048 Bacteria 3094
86 Ga0075363_100092846 3300006048 Bacteria 1663
87 Ga0075363_100106996 3300006048 Bacteria 1552
88 Ga0075364_10000391 3300006051 Bacteria 21816
89 Ga0075364_10001597 3300006051 Bacteria 12392
90 Ga0075364_10014676 3300006051 Bacteria 4846
91 Ga0075364_10015074 3300006051 Bacteria 4786
92 Ga0075364_10015374 3300006051 Bacteria 4745
93 Ga0075364_10021521 3300006051 Bacteria 4065
94 Ga0070712_100001270 3300006175 Bacteria 15233
95 Ga0070712_100009279 3300006175 Bacteria 6198
96 Ga0075362_10009407 3300006177 Bacteria 3780
97 Ga0075362_10070177 3300006177 Bacteria 1599
98 Ga0075367_10015394 3300006178 Bacteria 4156
99 Ga0075367_10189036 3300006178 Bacteria 1285
100 Ga0075367_10244339 3300006178 Bacteria 1125
101 Ga0075369_10050875 3300006186 Bacteria 1793
102 Ga0075366_10085130 3300006195 Bacteria 1891
103 Ga0097621_100258425 3300006237 Bacteria 1527
104 Ga0075370_10000744 3300006353 Bacteria 13002
105 Ga0075370_10001636 3300006353 Bacteria 9880
106 Ga0075370_10010380 3300006353 Bacteria 4869
107 Ga0075370_10010428 3300006353 Bacteria 4859
108 Ga0068871_100216498 3300006358 Bacteria 1658
109 Ga0075430_100032892 3300006846 Bacteria 4401
110 Ga0075431_100145936 3300006847 Bacteria 2438
111 Ga0068865_100046063 3300006881 Bacteria 2991
112 Ga0097620_100000276 3300006931 Bacteria 51118
113 Ga0097620_100025628 3300006931 Bacteria 5915
114 Ga0097620_100085106 3300006931 Bacteria 3207
115 Ga0105244_10000295 3300009036 Bacteria 48840
116 Ga0105245_10010633 3300009098 Bacteria 8007
117 Ga0105245_10031418 3300009098 Bacteria 4699
118 Ga0105247_10000029 3300009101 Bacteria 198763
119 Ga0114129_10644922 3300009147 Bacteria 1367
120 Ga0105243_10005029 3300009148 Bacteria 10371
121 Ga0105243_10009400 3300009148 Bacteria 7450
122 Ga0105243_10059113 3300009148 Bacteria 3058
123 Ga0105242_10003225 3300009176 Bacteria 12717
124 Ga0105248_10000136 3300009177 Bacteria 85507
125 Ga0105248_10014990 3300009177 Bacteria 8533
126 Ga0105248_10023798 3300009177 Bacteria 6808
127 Ga0105248_10094825 3300009177 Bacteria 3360
128 Ga0105249_10000077 3300009553 Bacteria 141905
129 Ga0105249_10024146 3300009553 Bacteria 5462
130 Ga0105249_10104263 3300009553 Bacteria 2672
131 Ga0105249_10339393 3300009553 Bacteria 1519
132 Ga0105239_10005314 3300010375 Bacteria 15120
133 Ga0105239_10167154 3300010375 Bacteria 2460
134 Ga0105246_10137790 3300011119 Bacteria 1831
135 Ga0157369_10127271 3300013105 Bacteria 2700
136 Ga0157378_10005026 3300013297 Bacteria 11608
137 Ga0163162_10010099 3300013306 Bacteria 9178
138 Ga0163162_10040972 3300013306 Bacteria 4633
139 Ga0163162_10087660 3300013306 Bacteria 3191
140 Ga0163162_10252945 3300013306 Bacteria 1893
141 Ga0163162_10298634 3300013306 Bacteria 1742
142 Ga0157372_10000875 3300013307 Bacteria 32716
143 Ga0157375_10010499 3300013308 Bacteria 8153
144 Ga0157375_10030659 3300013308 Bacteria 5073
145 Ga0157375_10373992 3300013308 Bacteria 1591
146 Ga0163163_10006703 3300014325 Bacteria 10092
147 Ga0163163_10163826 3300014325 Bacteria 2269
148 Ga0157380_10023769 3300014326 Bacteria 4628
149 Ga0182008_10116848 3300014497 Bacteria 1324
150 Ga0157379_10208952 3300014968 Bacteria 1766
151 Ga0157376_10048523 3300014969 Bacteria 3511
152 Ga0163161_10001293 3300017792 Bacteria 18669
153 Ga0163161_10108683 3300017792 Bacteria 2071
154 Ga0163161_10357989 3300017792 Bacteria 1162
155 Ga0213876_10069535 3300021384 Bacteria 1860
156 Ga0209672_100011 3300025228 Bacteria 856297
157 Ga0209147_100675 3300025229 Bacteria 17592
158 Ga0209148_1000132 3300025254 Bacteria 171529
159 Ga0209455_1000122 3300025272 Bacteria 170954
160 Ga0207655_1000526 3300025728 Bacteria 48861
161 Ga0207692_10065706 3300025898 Bacteria 1893
162 Ga0207642_10003076 3300025899 Bacteria 5227
163 Ga0207642_10028214 3300025899 Bacteria 2308
164 Ga0207642_10163134 3300025899 Bacteria 1199
165 Ga0207710_10000046 3300025900 Bacteria 198754
166 Ga0207710_10003445 3300025900 Bacteria 7053
167 Ga0207710_10079113 3300025900 Bacteria 1522
168 Ga0207688_10000623 3300025901 Bacteria 17410
169 Ga0207688_10000910 3300025901 Bacteria 14940
170 Ga0207647_10048853 3300025904 Bacteria 2626
171 Ga0207699_10036450 3300025906 Bacteria 2804
172 Ga0207699_10102458 3300025906 Bacteria 1819
173 Ga0207693_10000614 3300025915 Bacteria 31922
174 Ga0207663_10002572 3300025916 Bacteria 8730
175 Ga0207681_10000341 3300025923 Bacteria 33602
176 Ga0207694_10354272 3300025924 Bacteria 1215
177 Ga0207650_10128705 3300025925 Bacteria 1979
178 Ga0207659_10035327 3300025926 Bacteria 3454
179 Ga0207687_10001777 3300025927 Bacteria 14824
180 Ga0207687_10011562 3300025927 Bacteria 5770
181 Ga0207644_10414353 3300025931 Bacteria 1103
182 Ga0207706_10001079 3300025933 Bacteria 27701
183 Ga0207686_10004045 3300025934 Bacteria 7870
184 Ga0207709_10002916 3300025935 Bacteria 10440
185 Ga0207709_10045476 3300025935 Bacteria 2659
186 Ga0207669_10000085 3300025937 Bacteria 47505
187 Ga0207669_10047229 3300025937 Bacteria 2549
188 Ga0207669_10056817 3300025937 Bacteria 2379
189 Ga0207704_10006243 3300025938 Bacteria 5541
190 Ga0207665_10012387 3300025939 Bacteria 5602
191 Ga0207665_10029462 3300025939 Bacteria 3628
192 Ga0207711_10000111 3300025941 Bacteria 85466
193 Ga0207711_10091812 3300025941 Bacteria 2671
194 Ga0207711_10097372 3300025941 Bacteria 2597
195 Ga0207689_10036744 3300025942 Bacteria 4065
196 Ga0207689_10264308 3300025942 Bacteria 1424
197 Ga0207712_10000017 3300025961 Bacteria 337943
198 Ga0207712_10212965 3300025961 Bacteria 1540
199 Ga0207712_10321587 3300025961 Bacteria 1277
200 Ga0207668_10065680 3300025972 Bacteria 2569
201 Ga0207668_10242181 3300025972 Bacteria 1460
202 Ga0207640_10010787 3300025981 Bacteria 5156
203 Ga0207658_10000612 3300025986 Bacteria 31708
204 Ga0207658_10027811 3300025986 Bacteria 3977
205 Ga0207658_10103610 3300025986 Bacteria 2234
206 Ga0207677_10065449 3300026023 Bacteria 2536
207 Ga0207677_10212655 3300026023 Bacteria 1545
208 Ga0207703_10002482 3300026035 Bacteria 15994
209 Ga0207703_10072731 3300026035 Bacteria 2843
210 Ga0207703_10165955 3300026035 Bacteria 1938
211 Ga0207639_10149045 3300026041 Bacteria 1957
212 Ga0207678_10044033 3300026067 Bacteria 3862
213 Ga0207708_10000329 3300026075 Bacteria 37329
214 Ga0207641_10000378 3300026088 Bacteria 53027
215 Ga0207641_10010420 3300026088 Bacteria 7639
216 Ga0207641_10019974 3300026088 Bacteria 5499
217 Ga0207641_10034558 3300026088 Bacteria 4206
218 Ga0207648_10000112 3300026089 Bacteria 78746
219 Ga0207648_10166049 3300026089 Bacteria 1951
220 Ga0207675_100000117 3300026118 Bacteria 64829
221 Ga0207675_100046569 3300026118 Bacteria 4052
222 Ga0207675_100085380 3300026118 Bacteria 2962
223 Ga0207683_10000451 3300026121 Bacteria 38077
224 Ga0207683_10232737 3300026121 Bacteria 1680
225 Ga0268266_10001547 3300028379 Bacteria 26936
226 Ga0268266_10019511 3300028379 Bacteria 5777
227 Ga0268266_10222589 3300028379 Bacteria 1735
228 Ga0268266_10272934 3300028379 Bacteria 1570
229 Ga0268265_10000067 3300028380 Bacteria 142389
230 Ga0268265_10019465 3300028380 Bacteria 4719
231 Ga0268265_10031249 3300028380 Bacteria 3844
232 Ga0268264_10000146 3300028381 Bacteria 165733
233 Ga0268264_10008289 3300028381 Bacteria 8635
234 Ga0268264_10263709 3300028381 Bacteria 1606
235 Ga0307405_10089587 3300031731 Bacteria 2033
236 Ga0307413_10076278 3300031824 Bacteria 2130
237 Ga0307413_10315439 3300031824 Bacteria 1192
238 Ga0307410_10168927 3300031852 Bacteria 1646
239 Ga0307410_10210417 3300031852 Bacteria 1490
240 Ga0307406_10027007 3300031901 Bacteria 3454
241 Ga0307406_10087310 3300031901 Bacteria 2090
242 Ga0307412_10327681 3300031911 Bacteria 1221
243 Ga0307409_100060920 3300031995 Bacteria 2946
244 Ga0307411_10259174 3300032005 Bacteria 1372
245 Ga0307415_100192116 3300032126 Bacteria 1612
246 Ga0373931_0025686 3300035691 Bacteria 2992
247 Ga0316584_0040394 3300036712 Bacteria 3475
248 Ga0395898_0304093 3300037466 Bacteria 1521
249 Ga0436364_0370259 3300037853 Bacteria 2780
250 Ga0436364_1272522 3300037853 Bacteria 142026
251 Ga0436365_0957112 3300039437 Bacteria 4970
252 Ga0436365_1737435 3300039437 Bacteria 6167
253 Ga0436365_1935781 3300039437 Bacteria 4460
254 Ga0436363_0716906 3300039450 Bacteria 1900
255 Ga0439461_0004719 3300041410 Bacteria 2290
256 Ga0439466_0014050 3300041411 Bacteria 2922
257 Ga0439465_0002060 3300041413 Bacteria 6590
258 Ga0439465_0062623 3300041413 Bacteria 1234
259 Ga0451841_0596037 3300041498 Bacteria 1152
260 Ga0439431_0002571 3300041997 Bacteria 4007
261 Ga0439431_0003398 3300041997 Bacteria 3504
262 Ga0439431_0013996 3300041997 Bacteria 1856
263 Ga0439445_0012670 3300042004 Bacteria 2030
264 Ga0439449_0002073 3300042007 Bacteria 7886
265 Ga0439434_0006002 3300042435 Bacteria 3545
266 Ga0439434_0008882 3300042435 Bacteria 2952
267 Ga0466969_0043786 3300044656 Bacteria 2229
268 Ga0466969_0049308 3300044656 Bacteria 2078
269 Ga0466972_0017376 3300044658 Bacteria 3601
270 Ga0466972_0030024 3300044658 Bacteria 2676
271 Ga0466972_0049154 3300044658 Bacteria 2037
272 Ga0466965_0050907 3300044683 Bacteria 2054
273 Ga0466966_0000885 3300044684 Bacteria 19103
274 Ga0466966_0004648 3300044684 Bacteria 9043
275 Ga0466966_0022227 3300044684 Bacteria 4164
276 Ga0466961_0000876 3300044693 Bacteria 18697
277 Ga0466961_0097068 3300044693 Bacteria 1858
278 Ga0466963_0005101 3300044694 Bacteria 7672
279 Ga0466964_0000712 3300044706 Bacteria 10755
280 Ga0466971_0000938 3300044719 Bacteria 11979
281 Ga0466968_0001343 3300044735 Bacteria 8770
282 Ga0466968_0043633 3300044735 Bacteria 1899
283 Ga0466970_0000909 3300044765 Bacteria 14310
284 Ga0466970_0144171 3300044765 Bacteria 1313
285 Ga0466957_0002992 3300044842 Bacteria 9178
286 Ga0466957_0006134 3300044842 Bacteria 6783
287 Ga0466957_0024254 3300044842 Bacteria 3589
288 Ga0466960_0000447 3300044901 Bacteria 14126
289 Ga0466960_0001027 3300044901 Bacteria 9982
290 Ga0466959_0000921 3300045049 Bacteria 17440
291 Ga0466959_0003579 3300045049 Bacteria 10230
292 Ga0466959_0032455 3300045049 Bacteria 3865
293 Ga0466959_0160773 3300045049 Bacteria 1579
294 Ga0466958_0000144 3300045836 Bacteria 24551
295 Ga0466958_0001254 3300045836 Bacteria 11889
296 Ga0466958_0049201 3300045836 Bacteria 2550
297 Ga0466967_0004058 3300045976 Bacteria 9769
298 Ga0466967_0007332 3300045976 Bacteria 7943
299 Ga0466967_0017251 3300045976 Bacteria 5725
300 Ga0466967_0026988 3300045976 Bacteria 4768
301 Ga0495629_0030780 3300046459 Bacteria 3802
302 Ga0495638_0002021 3300046460 Bacteria 17284
303 Ga0495580_0099511 3300046472 Bacteria 2023
304 Ga0495582_0034087 3300046473 Bacteria 2799
305 Ga0495594_0086105 3300046499 Bacteria 1758
306 Ga0495618_0029537 3300046514 Bacteria 3421
307 Ga0495628_0001491 3300046516 Bacteria 21439
308 Ga0495634_0045386 3300046642 Bacteria 2971
309 Ga0495624_0079336 3300046690 Bacteria 2036
310 Ga0495672_0101390 3300047320 Bacteria 1560
311 Ga0495686_0037954 3300047472 Bacteria 3084
312 Ga0496100_0000395 3300048903 Bacteria 21117
313 Ga0496100_0009529 3300048903 Bacteria 5458
314 Ga0496100_0030130 3300048903 Bacteria 3363
315 Ga0496100_0293424 3300048903 Bacteria 1215
316 Ga0496101_0001579 3300048904 Bacteria 13661
317 Ga0496101_0004109 3300048904 Bacteria 9110
318 Ga0496101_0038834 3300048904 Bacteria 3383
319 Ga0496102_0000268 3300048905 Bacteria 66717
320 Ga0496102_0010611 3300048905 Bacteria 7936
321 Ga0496102_0032601 3300048905 Bacteria 4680
322 Ga0496102_0064615 3300048905 Bacteria 3352
323 Ga0496102_0130211 3300048905 Bacteria 2354
324 Ga0496102_0275987 3300048905 Bacteria 1584
325 Ga0496103_0000237 3300048906 Bacteria 53762
326 Ga0496103_0003795 3300048906 Bacteria 9195
327 Ga0496103_0175141 3300048906 Bacteria 1378
328 Ga0496105_0031605 3300048908 Bacteria 4340
329 Ga0496105_0125688 3300048908 Bacteria 2114
330 Ga0496105_0295269 3300048908 Bacteria 1304
331 Ga0496106_0002405 3300048909 Bacteria 13942
332 Ga0496106_0006699 3300048909 Bacteria 8531
333 Ga0496106_0084182 3300048909 Bacteria 2447
334 Ga0496106_0214460 3300048909 Bacteria 1534
335 Ga0496107_0004395 3300048910 Bacteria 9548
336 Ga0496108_0002116 3300048911 Bacteria 15905
337 Ga0496108_0044032 3300048911 Bacteria 3727
338 Ga0496108_0147461 3300048911 Bacteria 2029
339 Ga0496109_0007462 3300048912 Bacteria 9260
340 Ga0496110_0028720 3300048913 Bacteria 4780
341 Ga0496110_0253029 3300048913 Bacteria 1603
342 Ga0496110_0459846 3300048913 Bacteria 1160
343 Ga0496112_0004365 3300048915 Bacteria 11964
344 Ga0496112_0038710 3300048915 Bacteria 4658
345 Ga0496112_0133336 3300048915 Bacteria 2455
346 Ga0496113_0002563 3300048916 Bacteria 10615
347 Ga0496113_0097022 3300048916 Bacteria 2280
348 Ga0496113_0179922 3300048916 Bacteria 1676
349 Ga0496114_0000629 3300048917 Bacteria 26088
350 Ga0496114_0002083 3300048917 Bacteria 15214
351 Ga0496115_0000824 3300048918 Bacteria 22725
352 Ga0496115_0001294 3300048918 Bacteria 17870
353 Ga0496116_0007423 3300048919 Bacteria 9729
354 Ga0496117_0001548 3300048920 Bacteria 32660
355 Ga0496118_0001284 3300048921 Bacteria 38348
356 Ga0496119_0010884 3300048922 Bacteria 7602
357 Ga0496121_0003814 3300048924 Bacteria 21004
358 Ga0496122_0014952 3300048925 Bacteria 7463
359 Ga0496123_0004488 3300048926 Bacteria 14627
360 Ga0496125_0008684 3300048928 Bacteria 10582
361 Ga0496126_0004792 3300048929 Bacteria 15900
362 Ga0496126_0008009 3300048929 Bacteria 11469
363 Ga0501032_0002313 3300049569 Bacteria 14948
364 Ga0501033_0018634 3300049570 Bacteria 5246
365 Ga0501034_0006673 3300049571 Bacteria 12378
366 Ga0501034_0066271 3300049571 Bacteria 3624
367 Ga0501034_0194650 3300049571 Bacteria 1988
368 Ga0501037_0001502 3300049573 Bacteria 17059
369 Ga0501038_0001711 3300049574 Bacteria 20376
370 Ga0501039_0000526 3300049575 Bacteria 27681
371 Ga0501043_0000633 3300049579 Bacteria 31114
372 Ga0501070_0000448 3300049586 Bacteria 37506
373 Ga0501070_0111388 3300049586 Bacteria 2262
374 Ga0501035_0000753 3300049822 Bacteria 34892
375 Ga0501035_0020975 3300049822 Bacteria 6005
376 Ga0501044_0031803 3300049823 Bacteria 5550
377 nmdc:mga03683_40485_c1 3300050489 Bacteria 1911
378 nmdc:mga03n38_10861_c1 3300050490 Bacteria 3369
379 nmdc:mga03n38_4468_c1 3300050490 Bacteria 4641
380 nmdc:mga03n38_5303_c1 3300050490 Bacteria 4376
381 nmdc:mga03n38_68129_c1 3300050490 Bacteria 1640
382 nmdc:mga03n38_9923_c1 3300050490 Bacteria 3484
383 nmdc:mga00v17_1485_c1 3300050491 Bacteria 12272
384 nmdc:mga00v17_148873_c1 3300050491 Bacteria 1503
385 nmdc:mga00v17_31066_c1 3300050491 Bacteria 3147
386 nmdc:mga00v17_3556_c1 3300050491 Bacteria 8051
387 nmdc:mga00v17_36857_c1 3300050491 Bacteria 2917
388 nmdc:mga00v17_47360_c1 3300050491 Bacteria 2604
389 nmdc:mga00v17_4942_c1 3300050491 Bacteria 6991
390 nmdc:mga00v17_9836_c1 3300050491 Bacteria 5196
391 nmdc:mga0yw44_112976_c1 3300050492 Bacteria 1742
392 nmdc:mga0yw44_24643_c1 3300050492 Bacteria 3408
393 nmdc:mga0yw44_297012_c1 3300050492 Bacteria 1082
394 nmdc:mga0yw44_33988_c1 3300050492 Bacteria 2984
395 nmdc:mga0yw44_39948_c1 3300050492 Bacteria 2784
396 nmdc:mga0yw44_5173_c1 3300050492 Bacteria 6112
397 nmdc:mga06z11_123951_c1 3300050494 Bacteria 1444
398 nmdc:mga06z11_180244_c1 3300050494 Bacteria 1218
399 nmdc:mga06z11_18125_c1 3300050494 Bacteria 3210
400 nmdc:mga07m45_813_c2 3300050496 Bacteria 12202
401 nmdc:mga07m45_8384_c1 3300050496 Bacteria 5312
402 nmdc:mga05p37_374819_c1 3300050507 Bacteria 1669
403 nmdc:mga0qj67_27780_c1 3300050509 Bacteria 4387
404 nmdc:mga06r32_29577_c1 3300050510 Bacteria 2554
405 nmdc:mga0sz30_24898_c1 3300050516 Bacteria 2445
406 nmdc:mga0sz30_385_c1 3300050516 Bacteria 16818
407 Ga0495601_0000697 3300053077 Bacteria 18051
408 Ga0500635_0007142 3300053080 Bacteria 3018
409 Ga0500643_024608 3300053087 Bacteria 1909
410 Ga0500643_033109 3300053087 Bacteria 1564
411 Ga0500556_0012086 3300053104 Bacteria 2570
412 Ga0500569_036683 3300053109 Bacteria 1413
413 Ga0500652_046702 3300053131 Bacteria 1758
414 Ga0500559_0001028 3300053136 Bacteria 17105
415 Ga0500604_0023688 3300053151 Bacteria 1753
416 Ga0500616_0003873 3300053153 Bacteria 11012
417 Ga0500616_0072491 3300053153 Bacteria 1751
418 Ga0500645_000007 3300053730 Bacteria 233700
419 Ga0500645_042795 3300053730 Bacteria 1335
420 Ga0500645_057143 3300053730 Bacteria 1131
421 Ga0466962_0000712 3300061719 Bacteria 14819

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10210417 Ga0307410_102104172 263
2 3300037853 Ga0436364_0370259 Ga0436364_0370259_24_959 276
3 3300025904 Ga0207647_10048853 Ga0207647_100488532 289
4 3300005548 Ga0070665_100001757 Ga0070665_10000175711 290
5 3300005617 Ga0068859_100085108 Ga0068859_1000851082 290
6 3300005841 Ga0068863_100000835 Ga0068863_10000083516 290
7 3300006931 Ga0097620_100085106 Ga0097620_1000851062 290
8 3300026088 Ga0207641_10010420 Ga0207641_100104203 290
9 3300028379 Ga0268266_10001547 Ga0268266_1000154714 290
10 3300046514 Ga0495618_0029537 Ga0495618_0029537_523_1482 290
11 3300046516 Ga0495628_0001491 Ga0495628_0001491_12009_12968 290
12 3300046642 Ga0495634_0045386 Ga0495634_0045386_1640_2599 290
13 3300048905 Ga0496102_0032601 Ga0496102_0032601_1344_2360 290
14 3300048906 Ga0496103_0175141 Ga0496103_0175141_223_1239 290
15 3300053077 Ga0495601_0000697 Ga0495601_0000697_10037_10996 290
16 3300025228 Ga0209672_100011 Ga0209672_10001114 294
17 3300025229 Ga0209147_100675 Ga0209147_10067510 294
18 3300025254 Ga0209148_1000132 Ga0209148_1000132148 294
19 3300025272 Ga0209455_1000122 Ga0209455_100012214 294
20 3300048908 Ga0496105_0295269 Ga0496105_0295269_54_1010 297
21 3300049822 Ga0501035_0020975 Ga0501035_0020975_3521_4531 299
22 3300009177 Ga0105248_10023798 Ga0105248_100237985 303
23 3300021384 Ga0213876_10069535 Ga0213876_100695352 303
24 3300039437 Ga0436365_1935781 Ga0436365_1935781_2007_2963 303
25 3300039450 Ga0436363_0716906 Ga0436363_0716906_316_1272 303
26 3300005347 Ga0070668_100335727 Ga0070668_1003357272 306
27 3300025941 Ga0207711_10097372 Ga0207711_100973723 306
28 3300041498 Ga0451841_0596037 Ga0451841_0596037_129_1121 306
29 3300042007 Ga0439449_0002073 Ga0439449_0002073_976_2004 306
30 iso_pu_bacteria 2808606375 2808915949 306
31 3300005288 Ga0065714_10081064 Ga0065714_100810642 307
32 3300006038 Ga0075365_10094529 Ga0075365_100945292 307
33 3300006051 Ga0075364_10015374 Ga0075364_100153743 307
34 3300009036 Ga0105244_10000295 Ga0105244_1000029517 307
35 3300009148 Ga0105243_10005029 Ga0105243_100050294 307
36 3300025728 Ga0207655_1000526 Ga0207655_100052634 307
37 3300025935 Ga0207709_10002916 Ga0207709_100029164 307
38 3300037466 Ga0395898_0304093 Ga0395898_0304093_272_1234 307
39 3300044656 Ga0466969_0049308 Ga0466969_0049308_960_1916 307
40 3300044684 Ga0466966_0000885 Ga0466966_0000885_14651_15607 307
41 3300044693 Ga0466961_0000876 Ga0466961_0000876_3592_4548 307
42 3300044694 Ga0466963_0005101 Ga0466963_0005101_5086_6042 307
43 3300044706 Ga0466964_0000712 Ga0466964_0000712_4027_4983 307
44 3300044719 Ga0466971_0000938 Ga0466971_0000938_884_1840 307
45 3300044765 Ga0466970_0000909 Ga0466970_0000909_3724_4680 307
46 3300044842 Ga0466957_0006134 Ga0466957_0006134_3724_4680 307
47 3300045049 Ga0466959_0000921 Ga0466959_0000921_8551_9507 307
48 3300045836 Ga0466958_0000144 Ga0466958_0000144_15662_16618 307
49 3300045976 Ga0466967_0026988 Ga0466967_0026988_204_1160 307
50 3300048913 Ga0496110_0253029 Ga0496110_0253029_195_1172 307
51 3300050492 nmdc:mga0yw44_24643_c1 nmdc:mga0yw44_24643_c1_1027_2019 307
52 3300050492 nmdc:mga0yw44_39948_c1 nmdc:mga0yw44_39948_c1_42_1019 307
53 3300050494 nmdc:mga06z11_123951_c1 nmdc:mga06z11_123951_c1_322_1314 307
54 3300061719 Ga0466962_0000712 Ga0466962_0000712_10140_11096 307
55 iso_pu_bacteria 2643221575 2643886825 307
56 iso_pu_bacteria 2773857763 2774397747 307
57 iso_pu_bacteria 2811994872 2812324955 307
58 iso_pu_bacteria 2821268502 2821271488 307
59 iso_pu_bacteria 2870628048 2870629065 307
60 iso_pu_bacteria 2946080515 2946082103 307
61 iso_pu_bacteria 2974294766 2974295694 307
62 iso_pu_bacteria 2977264416 2977264809 307
63 iso_pu_bacteria 8016254467 8016255910 307
64 3300053136 Ga0500559_0001028 Ga0500559_0001028_15906_16928 308
65 3300005347 Ga0070668_100125449 Ga0070668_1001254492 309
66 3300005354 Ga0070675_100098553 Ga0070675_1000985532 309
67 3300005455 Ga0070663_100223296 Ga0070663_1002232962 309
68 3300005719 Ga0068861_100145257 Ga0068861_1001452572 309
69 3300005844 Ga0068862_100045415 Ga0068862_1000454152 309
70 3300014326 Ga0157380_10023769 Ga0157380_100237692 309
71 3300017792 Ga0163161_10357989 Ga0163161_103579891 309
72 3300025926 Ga0207659_10035327 Ga0207659_100353273 309
73 3300025942 Ga0207689_10264308 Ga0207689_102643082 309
74 3300025972 Ga0207668_10065680 Ga0207668_100656803 309
75 3300026118 Ga0207675_100085380 Ga0207675_1000853802 309
76 3300028380 Ga0268265_10031249 Ga0268265_100312492 309
77 3300031824 Ga0307413_10315439 Ga0307413_103154392 309
78 3300048905 Ga0496102_0064615 Ga0496102_0064615_683_1696 309
79 3300048916 Ga0496113_0097022 Ga0496113_0097022_699_1712 309
80 iso_pu_bacteria 2808606372 2808903568 309
81 iso_pu_bacteria 2919443155 2919446689 309
82 3300005435 Ga0070714_100037059 Ga0070714_1000370593 310
83 3300013308 Ga0157375_10373992 Ga0157375_103739922 310
84 iso_pu_bacteria 2895660088 2895660331 310
85 3300044656 Ga0466969_0043786 Ga0466969_0043786_1087_2118 311
86 3300044684 Ga0466966_0004648 Ga0466966_0004648_4527_5558 311
87 3300045049 Ga0466959_0003579 Ga0466959_0003579_4525_5556 311
88 3300009553 Ga0105249_10339393 Ga0105249_103393931 312
89 3300026118 Ga0207675_100046569 Ga0207675_1000465695 312
90 3300050491 nmdc:mga00v17_148873_c1 nmdc:mga00v17_148873_c1_103_1074 321
91 iso_pu_bacteria 2902799365 2902800112 322
92 iso_pu_bacteria 2902810491 2902811988 322
93 iso_pu_bacteria 2929212328 2929216824 322
94 iso_pu_bacteria 2643221715 2644635930 325
95 3300005347 Ga0070668_100000415 Ga0070668_10000041520 326
96 3300005353 Ga0070669_100001239 Ga0070669_1000012393 326
97 3300005367 Ga0070667_100000679 Ga0070667_10000067916 326
98 3300009101 Ga0105247_10000029 Ga0105247_10000029157 326
99 3300009177 Ga0105248_10000136 Ga0105248_1000013643 326
100 3300009177 Ga0105248_10094825 Ga0105248_100948252 326
101 3300009553 Ga0105249_10000077 Ga0105249_1000007747 326
102 3300013306 Ga0163162_10298634 Ga0163162_102986342 326
103 3300014325 Ga0163163_10006703 Ga0163163_100067034 326
104 3300014968 Ga0157379_10208952 Ga0157379_102089522 326
105 3300025972 Ga0207668_10242181 Ga0207668_102421811 326
106 3300036712 Ga0316584_0040394 Ga0316584_0040394_1832_2812 326
107 3300041411 Ga0439466_0014050 Ga0439466_0014050_1580_2560 326
108 3300041413 Ga0439465_0062623 Ga0439465_0062623_63_1043 326
109 3300041997 Ga0439431_0002571 Ga0439431_0002571_450_1436 326
110 3300041997 Ga0439431_0013996 Ga0439431_0013996_437_1417 326
111 3300042004 Ga0439445_0012670 Ga0439445_0012670_528_1514 326
112 3300042435 Ga0439434_0008882 Ga0439434_0008882_704_1690 326
113 3300044658 Ga0466972_0030024 Ga0466972_0030024_1060_2040 326
114 3300044683 Ga0466965_0050907 Ga0466965_0050907_207_1193 326
115 3300044693 Ga0466961_0097068 Ga0466961_0097068_150_1130 326
116 3300044735 Ga0466968_0001343 Ga0466968_0001343_1223_2209 326
117 3300044765 Ga0466970_0144171 Ga0466970_0144171_258_1244 326
118 3300044842 Ga0466957_0002992 Ga0466957_0002992_7531_8517 326
119 3300044901 Ga0466960_0000447 Ga0466960_0000447_391_1377 326
120 3300044901 Ga0466960_0001027 Ga0466960_0001027_4469_5455 326
121 3300045049 Ga0466959_0032455 Ga0466959_0032455_2709_3689 326
122 3300045976 Ga0466967_0004058 Ga0466967_0004058_7454_8440 326
123 3300046460 Ga0495638_0002021 Ga0495638_0002021_1757_2740 326
124 3300047320 Ga0495672_0101390 Ga0495672_0101390_49_1029 326
125 3300048903 Ga0496100_0009529 Ga0496100_0009529_1726_2709 326
126 3300048904 Ga0496101_0038834 Ga0496101_0038834_2088_3071 326
127 3300048905 Ga0496102_0000268 Ga0496102_0000268_23451_24434 326
128 3300048906 Ga0496103_0000237 Ga0496103_0000237_26149_27132 326
129 3300048909 Ga0496106_0214460 Ga0496106_0214460_525_1508 326
130 3300048919 Ga0496116_0007423 Ga0496116_0007423_5296_6279 326
131 3300048920 Ga0496117_0001548 Ga0496117_0001548_3873_4856 326
132 3300048921 Ga0496118_0001284 Ga0496118_0001284_27533_28516 326
133 3300048922 Ga0496119_0010884 Ga0496119_0010884_4304_5287 326
134 3300048924 Ga0496121_0003814 Ga0496121_0003814_5744_6727 326
135 3300048925 Ga0496122_0014952 Ga0496122_0014952_5632_6618 326
136 3300048926 Ga0496123_0004488 Ga0496123_0004488_4316_5302 326
137 3300048928 Ga0496125_0008684 Ga0496125_0008684_8627_9610 326
138 3300048929 Ga0496126_0004792 Ga0496126_0004792_10027_11013 326
139 3300049569 Ga0501032_0002313 Ga0501032_0002313_2725_3705 326
140 3300049571 Ga0501034_0006673 Ga0501034_0006673_11231_12211 326
141 3300049573 Ga0501037_0001502 Ga0501037_0001502_13078_14058 326
142 3300049574 Ga0501038_0001711 Ga0501038_0001711_7799_8779 326
143 3300049575 Ga0501039_0000526 Ga0501039_0000526_15330_16310 326
144 3300049579 Ga0501043_0000633 Ga0501043_0000633_16868_17848 326
145 3300049586 Ga0501070_0000448 Ga0501070_0000448_15444_16424 326
146 3300049823 Ga0501044_0031803 Ga0501044_0031803_206_1186 326
147 3300050491 nmdc:mga00v17_47360_c1 nmdc:mga00v17_47360_c1_81_1067 326
148 3300053104 Ga0500556_0012086 Ga0500556_0012086_112_1095 326
149 3300053151 Ga0500604_0023688 Ga0500604_0023688_187_1170 326
150 3300053153 Ga0500616_0003873 Ga0500616_0003873_1898_2881 326
151 3300037853 Ga0436364_1272522 Ga0436364_1272522_125654_126652 328
152 iso_pu_bacteria 2738541274 2738705768 328
153 iso_pu_bacteria 2738543028 2739330258 328
154 3300001977 JGI24746J21847_1002490 JGI24746J21847_10024902 329
155 3300002077 JGI24744J21845_10002573 JGI24744J21845_100025733 329
156 3300002077 JGI24744J21845_10003112 JGI24744J21845_100031122 329
157 3300002239 JGI24034J26672_10013465 JGI24034J26672_100134651 329
158 3300005334 Ga0068869_100015510 Ga0068869_1000155103 329
159 3300005334 Ga0068869_100069444 Ga0068869_1000694443 329
160 3300005337 Ga0070682_100081387 Ga0070682_1000813872 329
161 3300005338 Ga0068868_100052337 Ga0068868_1000523373 329
162 3300005338 Ga0068868_100306585 Ga0068868_1003065852 329
163 3300005341 Ga0070691_10099316 Ga0070691_100993161 329
164 3300005347 Ga0070668_100003680 Ga0070668_1000036802 329
165 3300005347 Ga0070668_100096244 Ga0070668_1000962442 329
166 3300005347 Ga0070668_100139978 Ga0070668_1001399782 329
167 3300005353 Ga0070669_100067660 Ga0070669_1000676603 329
168 3300005356 Ga0070674_100130564 Ga0070674_1001305641 329
169 3300005364 Ga0070673_100377686 Ga0070673_1003776861 329
170 3300005365 Ga0070688_100062020 Ga0070688_1000620202 329
171 3300005367 Ga0070667_100006205 Ga0070667_1000062053 329
172 3300005367 Ga0070667_100054985 Ga0070667_1000549853 329
173 3300005367 Ga0070667_100084903 Ga0070667_1000849034 329
174 3300005434 Ga0070709_10012970 Ga0070709_100129706 329
175 3300005435 Ga0070714_100132080 Ga0070714_1001320802 329
176 3300005435 Ga0070714_100200052 Ga0070714_1002000522 329
177 3300005437 Ga0070710_10006167 Ga0070710_100061675 329
178 3300005438 Ga0070701_10000802 Ga0070701_100008022 329
179 3300005439 Ga0070711_100002361 Ga0070711_1000023619 329
180 3300005455 Ga0070663_100041173 Ga0070663_1000411731 329
181 3300005456 Ga0070678_100002715 Ga0070678_1000027155 329
182 3300005456 Ga0070678_100062580 Ga0070678_1000625803 329
183 3300005457 Ga0070662_100011550 Ga0070662_1000115504 329
184 3300005459 Ga0068867_100003221 Ga0068867_1000032217 329
185 3300005459 Ga0068867_100036364 Ga0068867_1000363643 329
186 3300005543 Ga0070672_100090876 Ga0070672_1000908762 329
187 3300005545 Ga0070695_100022325 Ga0070695_1000223252 329
188 3300005546 Ga0070696_100066499 Ga0070696_1000664993 329
189 3300005547 Ga0070693_100034349 Ga0070693_1000343492 329
190 3300005548 Ga0070665_100008312 Ga0070665_1000083123 329
191 3300005548 Ga0070665_100063964 Ga0070665_1000639643 329
192 3300005548 Ga0070665_100087058 Ga0070665_1000870583 329
193 3300005549 Ga0070704_100000443 Ga0070704_10000044317 329
194 3300005563 Ga0068855_100104991 Ga0068855_1001049914 329
195 3300005578 Ga0068854_100000515 Ga0068854_1000005155 329
196 3300005615 Ga0070702_100023924 Ga0070702_1000239243 329
197 3300005616 Ga0068852_100157896 Ga0068852_1001578963 329
198 3300005617 Ga0068859_100000276 Ga0068859_10000027647 329
199 3300005617 Ga0068859_100025626 Ga0068859_1000256265 329
200 3300005718 Ga0068866_10000609 Ga0068866_100006093 329
201 3300005719 Ga0068861_100000307 Ga0068861_1000003075 329
202 3300005719 Ga0068861_100196838 Ga0068861_1001968382 329
203 3300005841 Ga0068863_100000768 Ga0068863_1000007682 329
204 3300005841 Ga0068863_100020245 Ga0068863_1000202454 329
205 3300005841 Ga0068863_100029468 Ga0068863_1000294683 329
206 3300005841 Ga0068863_100110335 Ga0068863_1001103353 329
207 3300005842 Ga0068858_100000440 Ga0068858_1000004408 329
208 3300005842 Ga0068858_100008729 Ga0068858_1000087294 329
209 3300005843 Ga0068860_100000232 Ga0068860_10000023243 329
210 3300005843 Ga0068860_100009056 Ga0068860_1000090563 329
211 3300005843 Ga0068860_100025102 Ga0068860_1000251024 329
212 3300005844 Ga0068862_100000055 Ga0068862_10000005549 329
213 3300005844 Ga0068862_100027936 Ga0068862_1000279364 329
214 3300005981 Ga0081538_10113529 Ga0081538_101135292 329
215 3300006038 Ga0075365_10005734 Ga0075365_100057342 329
216 3300006038 Ga0075365_10025315 Ga0075365_100253155 329
217 3300006038 Ga0075365_10036037 Ga0075365_100360373 329
218 3300006042 Ga0075368_10018698 Ga0075368_100186983 329
219 3300006048 Ga0075363_100006782 Ga0075363_1000067828 329
220 3300006048 Ga0075363_100013376 Ga0075363_1000133763 329
221 3300006048 Ga0075363_100017787 Ga0075363_1000177873 329
222 3300006048 Ga0075363_100020887 Ga0075363_1000208873 329
223 3300006048 Ga0075363_100024049 Ga0075363_1000240494 329
224 3300006048 Ga0075363_100092846 Ga0075363_1000928462 329
225 3300006048 Ga0075363_100106996 Ga0075363_1001069962 329
226 3300006051 Ga0075364_10000391 Ga0075364_1000039113 329
227 3300006051 Ga0075364_10001597 Ga0075364_1000159710 329
228 3300006051 Ga0075364_10014676 Ga0075364_100146764 329
229 3300006051 Ga0075364_10015074 Ga0075364_100150744 329
230 3300006051 Ga0075364_10021521 Ga0075364_100215215 329
231 3300006175 Ga0070712_100001270 Ga0070712_1000012708 329
232 3300006175 Ga0070712_100009279 Ga0070712_1000092795 329
233 3300006177 Ga0075362_10009407 Ga0075362_100094072 329
234 3300006177 Ga0075362_10070177 Ga0075362_100701772 329
235 3300006178 Ga0075367_10015394 Ga0075367_100153943 329
236 3300006178 Ga0075367_10189036 Ga0075367_101890361 329
237 3300006178 Ga0075367_10244339 Ga0075367_102443392 329
238 3300006186 Ga0075369_10050875 Ga0075369_100508752 329
239 3300006195 Ga0075366_10085130 Ga0075366_100851302 329
240 3300006237 Ga0097621_100258425 Ga0097621_1002584252 329
241 3300006353 Ga0075370_10000744 Ga0075370_100007446 329
242 3300006353 Ga0075370_10001636 Ga0075370_100016365 329
243 3300006353 Ga0075370_10010380 Ga0075370_100103803 329
244 3300006353 Ga0075370_10010428 Ga0075370_100104282 329
245 3300006358 Ga0068871_100216498 Ga0068871_1002164982 329
246 3300006846 Ga0075430_100032892 Ga0075430_1000328922 329
247 3300006847 Ga0075431_100145936 Ga0075431_1001459363 329
248 3300006881 Ga0068865_100046063 Ga0068865_1000460632 329
249 3300006931 Ga0097620_100000276 Ga0097620_10000027647 329
250 3300006931 Ga0097620_100025628 Ga0097620_1000256283 329
251 3300009098 Ga0105245_10010633 Ga0105245_100106332 329
252 3300009098 Ga0105245_10031418 Ga0105245_100314187 329
253 3300009147 Ga0114129_10644922 Ga0114129_106449222 329
254 3300009148 Ga0105243_10009400 Ga0105243_100094006 329
255 3300009148 Ga0105243_10059113 Ga0105243_100591133 329
256 3300009176 Ga0105242_10003225 Ga0105242_100032255 329
257 3300009177 Ga0105248_10014990 Ga0105248_100149903 329
258 3300009553 Ga0105249_10024146 Ga0105249_100241466 329
259 3300009553 Ga0105249_10104263 Ga0105249_101042633 329
260 3300010375 Ga0105239_10005314 Ga0105239_1000531410 329
261 3300010375 Ga0105239_10167154 Ga0105239_101671543 329
262 3300011119 Ga0105246_10137790 Ga0105246_101377902 329
263 3300013105 Ga0157369_10127271 Ga0157369_101272713 329
264 3300013297 Ga0157378_10005026 Ga0157378_100050265 329
265 3300013306 Ga0163162_10010099 Ga0163162_100100991 329
266 3300013306 Ga0163162_10040972 Ga0163162_100409726 329
267 3300013306 Ga0163162_10087660 Ga0163162_100876603 329
268 3300013306 Ga0163162_10252945 Ga0163162_102529452 329
269 3300013307 Ga0157372_10000875 Ga0157372_100008752 329
270 3300013308 Ga0157375_10010499 Ga0157375_100104992 329
271 3300013308 Ga0157375_10030659 Ga0157375_100306593 329
272 3300014325 Ga0163163_10163826 Ga0163163_101638263 329
273 3300014497 Ga0182008_10116848 Ga0182008_101168482 329
274 3300014969 Ga0157376_10048523 Ga0157376_100485232 329
275 3300017792 Ga0163161_10001293 Ga0163161_100012934 329
276 3300017792 Ga0163161_10108683 Ga0163161_101086833 329
277 3300025898 Ga0207692_10065706 Ga0207692_100657062 329
278 3300025899 Ga0207642_10003076 Ga0207642_100030762 329
279 3300025899 Ga0207642_10028214 Ga0207642_100282142 329
280 3300025899 Ga0207642_10163134 Ga0207642_101631341 329
281 3300025900 Ga0207710_10000046 Ga0207710_1000004646 329
282 3300025900 Ga0207710_10003445 Ga0207710_100034453 329
283 3300025900 Ga0207710_10079113 Ga0207710_100791132 329
284 3300025901 Ga0207688_10000623 Ga0207688_1000062314 329
285 3300025901 Ga0207688_10000910 Ga0207688_1000091011 329
286 3300025906 Ga0207699_10036450 Ga0207699_100364503 329
287 3300025906 Ga0207699_10102458 Ga0207699_101024582 329
288 3300025915 Ga0207693_10000614 Ga0207693_1000061423 329
289 3300025916 Ga0207663_10002572 Ga0207663_100025724 329
290 3300025923 Ga0207681_10000341 Ga0207681_1000034124 329
291 3300025924 Ga0207694_10354272 Ga0207694_103542722 329
292 3300025925 Ga0207650_10128705 Ga0207650_101287053 329
293 3300025927 Ga0207687_10001777 Ga0207687_100017772 329
294 3300025927 Ga0207687_10011562 Ga0207687_100115627 329
295 3300025931 Ga0207644_10414353 Ga0207644_104143531 329
296 3300025933 Ga0207706_10001079 Ga0207706_1000107927 329
297 3300025934 Ga0207686_10004045 Ga0207686_100040451 329
298 3300025935 Ga0207709_10045476 Ga0207709_100454763 329
299 3300025937 Ga0207669_10000085 Ga0207669_1000008547 329
300 3300025937 Ga0207669_10047229 Ga0207669_100472293 329
301 3300025937 Ga0207669_10056817 Ga0207669_100568172 329
302 3300025938 Ga0207704_10006243 Ga0207704_100062435 329
303 3300025939 Ga0207665_10012387 Ga0207665_100123876 329
304 3300025939 Ga0207665_10029462 Ga0207665_100294624 329
305 3300025941 Ga0207711_10000111 Ga0207711_1000011147 329
306 3300025941 Ga0207711_10091812 Ga0207711_100918123 329
307 3300025942 Ga0207689_10036744 Ga0207689_100367443 329
308 3300025961 Ga0207712_10000017 Ga0207712_10000017243 329
309 3300025961 Ga0207712_10212965 Ga0207712_102129652 329
310 3300025961 Ga0207712_10321587 Ga0207712_103215872 329
311 3300025981 Ga0207640_10010787 Ga0207640_100107874 329
312 3300025986 Ga0207658_10000612 Ga0207658_1000061217 329
313 3300025986 Ga0207658_10027811 Ga0207658_100278114 329
314 3300025986 Ga0207658_10103610 Ga0207658_101036101 329
315 3300026023 Ga0207677_10065449 Ga0207677_100654492 329
316 3300026023 Ga0207677_10212655 Ga0207677_102126552 329
317 3300026035 Ga0207703_10002482 Ga0207703_1000248215 329
318 3300026035 Ga0207703_10072731 Ga0207703_100727313 329
319 3300026035 Ga0207703_10165955 Ga0207703_101659552 329
320 3300026041 Ga0207639_10149045 Ga0207639_101490452 329
321 3300026067 Ga0207678_10044033 Ga0207678_100440335 329
322 3300026075 Ga0207708_10000329 Ga0207708_1000032934 329
323 3300026088 Ga0207641_10000378 Ga0207641_1000037824 329
324 3300026088 Ga0207641_10019974 Ga0207641_100199747 329
325 3300026088 Ga0207641_10034558 Ga0207641_100345583 329
326 3300026089 Ga0207648_10000112 Ga0207648_1000011255 329
327 3300026089 Ga0207648_10166049 Ga0207648_101660492 329
328 3300026118 Ga0207675_100000117 Ga0207675_10000011759 329
329 3300026121 Ga0207683_10000451 Ga0207683_100004514 329
330 3300026121 Ga0207683_10232737 Ga0207683_102327372 329
331 3300028379 Ga0268266_10019511 Ga0268266_100195112 329
332 3300028379 Ga0268266_10222589 Ga0268266_102225892 329
333 3300028379 Ga0268266_10272934 Ga0268266_102729342 329
334 3300028380 Ga0268265_10000067 Ga0268265_1000006749 329
335 3300028380 Ga0268265_10019465 Ga0268265_100194652 329
336 3300028381 Ga0268264_10000146 Ga0268264_10000146102 329
337 3300028381 Ga0268264_10008289 Ga0268264_100082894 329
338 3300028381 Ga0268264_10263709 Ga0268264_102637092 329
339 3300031731 Ga0307405_10089587 Ga0307405_100895872 329
340 3300031824 Ga0307413_10076278 Ga0307413_100762782 329
341 3300031852 Ga0307410_10168927 Ga0307410_101689272 329
342 3300031901 Ga0307406_10027007 Ga0307406_100270073 329
343 3300031901 Ga0307406_10087310 Ga0307406_100873102 329
344 3300031911 Ga0307412_10327681 Ga0307412_103276812 329
345 3300031995 Ga0307409_100060920 Ga0307409_1000609201 329
346 3300032005 Ga0307411_10259174 Ga0307411_102591742 329
347 3300032126 Ga0307415_100192116 Ga0307415_1001921162 329
348 3300035691 Ga0373931_0025686 Ga0373931_0025686_285_1274 329
349 3300039437 Ga0436365_0957112 Ga0436365_0957112_3778_4767 329
350 3300039437 Ga0436365_1737435 Ga0436365_1737435_3514_4503 329
351 3300041410 Ga0439461_0004719 Ga0439461_0004719_1231_2223 329
352 3300041413 Ga0439465_0002060 Ga0439465_0002060_5157_6149 329
353 3300041997 Ga0439431_0003398 Ga0439431_0003398_981_1973 329
354 3300042435 Ga0439434_0006002 Ga0439434_0006002_1593_2585 329
355 3300044658 Ga0466972_0017376 Ga0466972_0017376_525_1514 329
356 3300044658 Ga0466972_0049154 Ga0466972_0049154_756_1745 329
357 3300044684 Ga0466966_0022227 Ga0466966_0022227_1252_2241 329
358 3300044735 Ga0466968_0043633 Ga0466968_0043633_731_1720 329
359 3300044842 Ga0466957_0024254 Ga0466957_0024254_652_1650 329
360 3300045049 Ga0466959_0160773 Ga0466959_0160773_147_1136 329
361 3300045836 Ga0466958_0001254 Ga0466958_0001254_5493_6482 329
362 3300045836 Ga0466958_0049201 Ga0466958_0049201_36_1025 329
363 3300045976 Ga0466967_0007332 Ga0466967_0007332_3304_4302 329
364 3300045976 Ga0466967_0017251 Ga0466967_0017251_3866_4855 329
365 3300046459 Ga0495629_0030780 Ga0495629_0030780_1605_2594 329
366 3300046472 Ga0495580_0099511 Ga0495580_0099511_858_1847 329
367 3300046473 Ga0495582_0034087 Ga0495582_0034087_975_1964 329
368 3300046499 Ga0495594_0086105 Ga0495594_0086105_637_1626 329
369 3300046690 Ga0495624_0079336 Ga0495624_0079336_267_1256 329
370 3300047472 Ga0495686_0037954 Ga0495686_0037954_1925_2917 329
371 3300048903 Ga0496100_0000395 Ga0496100_0000395_9330_10322 329
372 3300048903 Ga0496100_0030130 Ga0496100_0030130_1853_2842 329
373 3300048903 Ga0496100_0293424 Ga0496100_0293424_177_1172 329
374 3300048904 Ga0496101_0001579 Ga0496101_0001579_26_1018 329
375 3300048904 Ga0496101_0004109 Ga0496101_0004109_3604_4593 329
376 3300048905 Ga0496102_0010611 Ga0496102_0010611_2246_3235 329
377 3300048905 Ga0496102_0130211 Ga0496102_0130211_717_1706 329
378 3300048905 Ga0496102_0275987 Ga0496102_0275987_269_1258 329
379 3300048906 Ga0496103_0003795 Ga0496103_0003795_3642_4631 329
380 3300048908 Ga0496105_0031605 Ga0496105_0031605_2037_3029 329
381 3300048908 Ga0496105_0125688 Ga0496105_0125688_436_1425 329
382 3300048909 Ga0496106_0002405 Ga0496106_0002405_510_1502 329
383 3300048909 Ga0496106_0006699 Ga0496106_0006699_4266_5255 329
384 3300048909 Ga0496106_0084182 Ga0496106_0084182_1231_2220 329
385 3300048910 Ga0496107_0004395 Ga0496107_0004395_5304_6293 329
386 3300048911 Ga0496108_0002116 Ga0496108_0002116_7422_8411 329
387 3300048911 Ga0496108_0044032 Ga0496108_0044032_711_1700 329
388 3300048911 Ga0496108_0147461 Ga0496108_0147461_321_1310 329
389 3300048912 Ga0496109_0007462 Ga0496109_0007462_4768_5757 329
390 3300048913 Ga0496110_0028720 Ga0496110_0028720_1144_2133 329
391 3300048913 Ga0496110_0459846 Ga0496110_0459846_118_1107 329
392 3300048915 Ga0496112_0004365 Ga0496112_0004365_4169_5158 329
393 3300048915 Ga0496112_0038710 Ga0496112_0038710_1623_2618 329
394 3300048915 Ga0496112_0133336 Ga0496112_0133336_1429_2418 329
395 3300048916 Ga0496113_0002563 Ga0496113_0002563_73_1068 329
396 3300048916 Ga0496113_0179922 Ga0496113_0179922_51_1040 329
397 3300048917 Ga0496114_0000629 Ga0496114_0000629_10104_11096 329
398 3300048917 Ga0496114_0002083 Ga0496114_0002083_6763_7752 329
399 3300048918 Ga0496115_0000824 Ga0496115_0000824_13107_14099 329
400 3300048918 Ga0496115_0001294 Ga0496115_0001294_6309_7298 329
401 3300048929 Ga0496126_0008009 Ga0496126_0008009_7490_8488 329
402 3300049570 Ga0501033_0018634 Ga0501033_0018634_354_1343 329
403 3300049571 Ga0501034_0066271 Ga0501034_0066271_124_1113 329
404 3300049571 Ga0501034_0194650 Ga0501034_0194650_669_1658 329
405 3300049586 Ga0501070_0111388 Ga0501070_0111388_524_1513 329
406 3300049822 Ga0501035_0000753 Ga0501035_0000753_25943_26932 329
407 3300050489 nmdc:mga03683_40485_c1 nmdc:mga03683_40485_c1_647_1636 329
408 3300050490 nmdc:mga03n38_10861_c1 nmdc:mga03n38_10861_c1_762_1751 329
409 3300050490 nmdc:mga03n38_4468_c1 nmdc:mga03n38_4468_c1_493_1482 329
410 3300050490 nmdc:mga03n38_5303_c1 nmdc:mga03n38_5303_c1_1136_2125 329
411 3300050490 nmdc:mga03n38_68129_c1 nmdc:mga03n38_68129_c1_564_1553 329
412 3300050490 nmdc:mga03n38_9923_c1 nmdc:mga03n38_9923_c1_2480_3469 329
413 3300050491 nmdc:mga00v17_1485_c1 nmdc:mga00v17_1485_c1_3484_4473 329
414 3300050491 nmdc:mga00v17_31066_c1 nmdc:mga00v17_31066_c1_305_1294 329
415 3300050491 nmdc:mga00v17_3556_c1 nmdc:mga00v17_3556_c1_461_1456 329
416 3300050491 nmdc:mga00v17_36857_c1 nmdc:mga00v17_36857_c1_1475_2464 329
417 3300050491 nmdc:mga00v17_4942_c1 nmdc:mga00v17_4942_c1_4237_5226 329
418 3300050491 nmdc:mga00v17_9836_c1 nmdc:mga00v17_9836_c1_2132_3121 329
419 3300050492 nmdc:mga0yw44_112976_c1 nmdc:mga0yw44_112976_c1_720_1718 329
420 3300050492 nmdc:mga0yw44_297012_c1 nmdc:mga0yw44_297012_c1_16_1005 329
421 3300050492 nmdc:mga0yw44_33988_c1 nmdc:mga0yw44_33988_c1_1882_2871 329
422 3300050492 nmdc:mga0yw44_5173_c1 nmdc:mga0yw44_5173_c1_788_1777 329
423 3300050494 nmdc:mga06z11_180244_c1 nmdc:mga06z11_180244_c1_116_1105 329
424 3300050494 nmdc:mga06z11_18125_c1 nmdc:mga06z11_18125_c1_227_1216 329
425 3300050496 nmdc:mga07m45_813_c2 nmdc:mga07m45_813_c2_2498_3487 329
426 3300050496 nmdc:mga07m45_8384_c1 nmdc:mga07m45_8384_c1_1107_2096 329
427 3300050507 nmdc:mga05p37_374819_c1 nmdc:mga05p37_374819_c1_247_1236 329
428 3300050509 nmdc:mga0qj67_27780_c1 nmdc:mga0qj67_27780_c1_3077_4069 329
429 3300050510 nmdc:mga06r32_29577_c1 nmdc:mga06r32_29577_c1_1086_2078 329
430 3300050516 nmdc:mga0sz30_24898_c1 nmdc:mga0sz30_24898_c1_412_1410 329
431 3300050516 nmdc:mga0sz30_385_c1 nmdc:mga0sz30_385_c1_6492_7481 329
432 3300053080 Ga0500635_0007142 Ga0500635_0007142_677_1675 329
433 3300053087 Ga0500643_024608 Ga0500643_024608_89_1087 329
434 3300053087 Ga0500643_033109 Ga0500643_033109_406_1398 329
435 3300053109 Ga0500569_036683 Ga0500569_036683_26_1015 329
436 3300053131 Ga0500652_046702 Ga0500652_046702_281_1279 329
437 3300053153 Ga0500616_0072491 Ga0500616_0072491_462_1451 329
438 3300053730 Ga0500645_000007 Ga0500645_000007_49631_50629 329
439 3300053730 Ga0500645_042795 Ga0500645_042795_169_1167 329
440 3300053730 Ga0500645_057143 Ga0500645_057143_66_1064 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

74

284

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.7944 14 329
8hmo-assembly3.cif.gz_E crystal structure of metal-dependent hydrolase complexed with manganese from bacillus smithii 0.7928 157 328
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.7893 14 329
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.7883 11 329
1r61-assembly1.cif.gz_A the structure of predicted metal-dependent hydrolase from bacillus stearothermophilus 0.7833 166 327
ID Description Score Start End Superfamily
5nmpC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7881 156 327 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.788 157 328 3.50.30.50
af_C4JAI3_56_274_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7557 150 328 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7481 157 327 3.50.30.50
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.7223 166 327 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A7G1I3H4-F1-model_v4 Cyclase family protein 0.978 177 329 GO:0004061
GO:0019441
AF-X8C715-F1-model_v4 deleted 0.9766 205 329
AF-X8C715-F1-model_v4 deleted 0.969 205 329
AF-A0A7G1I3H4-F1-model_v4 Cyclase family protein 0.9655 177 329 GO:0004061
GO:0019441
AF-X8A381-F1-model_v4 deleted 0.9585 119 329

Feature Viewer

pLDDT pTM Quality
78.01 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map