F444442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 440 | 234 | 440 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300025923|Ga0207681_10030023|Ga0207681_100300232 |
| Length | 217 |
| Sequence | MRRSCAGRQAQRRRGRDALAPEPSTGEHYAMSEMTLDLAGNGLLAVTKDALAALRYALMRDTGHAAAAYFQEAGYAGGAALFDAFRGWLDERDALSPESLPLDEFQRLAAEFFRETGWGSLSIGTLHDTVATLDSPDWGEATPDAGMEHPCCHLSAGMFADFFGRVANAPLAVMEVECRSTGAERCRFLLGSAEVMQAVYDGMSQGQGYDEAVSGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 141 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 143 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 153 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 233 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 234 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.05 |
| Rhizosphere | 97.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10002792 | 3300005327 | Bacteria | 14509 |
| 2 | Ga0070658_10064942 | 3300005327 | Bacteria | 2978 |
| 3 | Ga0070658_10069880 | 3300005327 | Unclassified | 2874 |
| 4 | Ga0070658_10410392 | 3300005327 | Bacteria | 1164 |
| 5 | Ga0070658_11128100 | 3300005327 | Bacteria | 682 |
| 6 | Ga0070676_10036064 | 3300005328 | Unclassified | 2847 |
| 7 | Ga0070676_10340440 | 3300005328 | Bacteria | 1028 |
| 8 | Ga0070676_10420923 | 3300005328 | Unclassified | 933 |
| 9 | Ga0070676_10667461 | 3300005328 | Unclassified | 756 |
| 10 | Ga0070683_100017629 | 3300005329 | Bacteria | 6310 |
| 11 | Ga0070683_100027619 | 3300005329 | Bacteria | 5120 |
| 12 | Ga0070683_100440596 | 3300005329 | Bacteria | 1243 |
| 13 | Ga0070670_100005240 | 3300005331 | Bacteria | 10915 |
| 14 | Ga0070680_100016153 | 3300005336 | Bacteria | 5869 |
| 15 | Ga0070680_100039944 | 3300005336 | Bacteria | 3796 |
| 16 | Ga0068868_100103179 | 3300005338 | Unclassified | 2310 |
| 17 | Ga0068868_100160775 | 3300005338 | Bacteria | 1855 |
| 18 | Ga0070660_100002933 | 3300005339 | Bacteria | 11738 |
| 19 | Ga0070660_100087392 | 3300005339 | Bacteria | 2454 |
| 20 | Ga0070691_10000572 | 3300005341 | Bacteria | 14054 |
| 21 | Ga0070661_100014869 | 3300005344 | Bacteria | 5490 |
| 22 | Ga0070661_100126040 | 3300005344 | Bacteria | 1921 |
| 23 | Ga0070661_100204993 | 3300005344 | Archaea | 1508 |
| 24 | Ga0070668_100026230 | 3300005347 | Bacteria | 4420 |
| 25 | Ga0070669_100007145 | 3300005353 | Bacteria | 8025 |
| 26 | Ga0070675_100001511 | 3300005354 | Bacteria | 17176 |
| 27 | Ga0070671_100069223 | 3300005355 | Bacteria | 2943 |
| 28 | Ga0070671_100129325 | 3300005355 | Bacteria | 2127 |
| 29 | Ga0070674_100049933 | 3300005356 | Unclassified | 2879 |
| 30 | Ga0070674_100057334 | 3300005356 | Bacteria | 2704 |
| 31 | Ga0070674_100421627 | 3300005356 | Bacteria | 1095 |
| 32 | Ga0070674_100576202 | 3300005356 | Bacteria | 948 |
| 33 | Ga0070673_100305741 | 3300005364 | Bacteria | 1401 |
| 34 | Ga0070673_100696368 | 3300005364 | Bacteria | 933 |
| 35 | Ga0070673_101185715 | 3300005364 | Bacteria | 715 |
| 36 | Ga0070688_100440273 | 3300005365 | Bacteria | 972 |
| 37 | Ga0070659_100082140 | 3300005366 | Bacteria | 2574 |
| 38 | Ga0070659_100098699 | 3300005366 | Bacteria | 2349 |
| 39 | Ga0070659_100171168 | 3300005366 | Archaea | 1779 |
| 40 | Ga0070714_100023611 | 3300005435 | Bacteria | 5055 |
| 41 | Ga0070714_100025909 | 3300005435 | Bacteria | 4843 |
| 42 | Ga0070714_100181790 | 3300005435 | Bacteria | 1914 |
| 43 | Ga0070714_100246859 | 3300005435 | Unclassified | 1649 |
| 44 | Ga0070713_100004084 | 3300005436 | Bacteria | 9723 |
| 45 | Ga0070713_100166626 | 3300005436 | Unclassified | 1970 |
| 46 | Ga0070713_100840455 | 3300005436 | Bacteria | 881 |
| 47 | Ga0070710_10194801 | 3300005437 | Bacteria | 1276 |
| 48 | Ga0070678_100283375 | 3300005456 | Bacteria | 1402 |
| 49 | Ga0070678_100401493 | 3300005456 | Unclassified | 1191 |
| 50 | Ga0070662_100083023 | 3300005457 | Bacteria | 2391 |
| 51 | Ga0070662_100177858 | 3300005457 | Bacteria | 1675 |
| 52 | Ga0070662_100199273 | 3300005457 | Bacteria | 1587 |
| 53 | Ga0070681_10019316 | 3300005458 | Bacteria | 6820 |
| 54 | Ga0068867_100006965 | 3300005459 | Bacteria | 7993 |
| 55 | Ga0068867_100048370 | 3300005459 | Bacteria | 3128 |
| 56 | Ga0068867_100060017 | 3300005459 | Bacteria | 2820 |
| 57 | Ga0070698_100114663 | 3300005471 | Bacteria | 2659 |
| 58 | Ga0070699_100630436 | 3300005518 | Bacteria | 978 |
| 59 | Ga0070679_100003639 | 3300005530 | Bacteria | 14101 |
| 60 | Ga0070679_100028836 | 3300005530 | Bacteria | 5475 |
| 61 | Ga0070679_100142480 | 3300005530 | Bacteria | 2376 |
| 62 | Ga0070679_100351680 | 3300005530 | Unclassified | 1421 |
| 63 | Ga0070679_100364473 | 3300005530 | Bacteria | 1392 |
| 64 | Ga0070679_100422041 | 3300005530 | Unclassified | 1279 |
| 65 | Ga0070679_100436822 | 3300005530 | Bacteria | 1254 |
| 66 | Ga0070684_100114705 | 3300005535 | Bacteria | 2419 |
| 67 | Ga0070684_100165754 | 3300005535 | Bacteria | 2005 |
| 68 | Ga0070684_100267250 | 3300005535 | Bacteria | 1565 |
| 69 | Ga0070684_100352450 | 3300005535 | Bacteria | 1354 |
| 70 | Ga0070684_100355395 | 3300005535 | Bacteria | 1348 |
| 71 | Ga0068853_100069801 | 3300005539 | Bacteria | 3057 |
| 72 | Ga0068853_100266524 | 3300005539 | Bacteria | 1576 |
| 73 | Ga0068853_100972724 | 3300005539 | Bacteria | 817 |
| 74 | Ga0070672_100056614 | 3300005543 | Unclassified | 3076 |
| 75 | Ga0070672_100085489 | 3300005543 | Unclassified | 2535 |
| 76 | Ga0070672_100339207 | 3300005543 | Unclassified | 1280 |
| 77 | Ga0070686_100347737 | 3300005544 | Bacteria | 1113 |
| 78 | Ga0070665_100019563 | 3300005548 | Bacteria | 6797 |
| 79 | Ga0068855_101412455 | 3300005563 | Bacteria | 717 |
| 80 | Ga0070664_100023648 | 3300005564 | Bacteria | 5076 |
| 81 | Ga0070664_100024639 | 3300005564 | Unclassified | 4980 |
| 82 | Ga0070664_100989897 | 3300005564 | Bacteria | 790 |
| 83 | Ga0068857_100008104 | 3300005577 | Bacteria | 9070 |
| 84 | Ga0068857_100125654 | 3300005577 | Bacteria | 2311 |
| 85 | Ga0068856_100728868 | 3300005614 | Bacteria | 1012 |
| 86 | Ga0070702_100105405 | 3300005615 | Bacteria | 1737 |
| 87 | Ga0068852_100040845 | 3300005616 | Bacteria | 3917 |
| 88 | Ga0068852_100124009 | 3300005616 | Bacteria | 2369 |
| 89 | Ga0068852_101275358 | 3300005616 | Bacteria | 756 |
| 90 | Ga0068852_101372737 | 3300005616 | Unclassified | 728 |
| 91 | Ga0068859_100402231 | 3300005617 | Unclassified | 1465 |
| 92 | Ga0068864_100533055 | 3300005618 | Unclassified | 1133 |
| 93 | Ga0068864_101240507 | 3300005618 | Bacteria | 745 |
| 94 | Ga0068866_10013364 | 3300005718 | Bacteria | 3601 |
| 95 | Ga0068858_100066521 | 3300005842 | Bacteria | 3337 |
| 96 | Ga0068860_100136732 | 3300005843 | Bacteria | 2353 |
| 97 | Ga0068862_100000864 | 3300005844 | Bacteria | 29658 |
| 98 | Ga0070717_10074541 | 3300006028 | Bacteria | 2837 |
| 99 | Ga0070717_10220403 | 3300006028 | Bacteria | 1667 |
| 100 | Ga0070715_10049479 | 3300006163 | Bacteria | 1801 |
| 101 | Ga0070712_100035288 | 3300006175 | Bacteria | 3395 |
| 102 | Ga0097621_100813834 | 3300006237 | Bacteria | 866 |
| 103 | Ga0075428_100014623 | 3300006844 | Bacteria | 8715 |
| 104 | Ga0075430_100009108 | 3300006846 | Bacteria | 8386 |
| 105 | Ga0075430_100032116 | 3300006846 | Bacteria | 4456 |
| 106 | Ga0075431_100019180 | 3300006847 | Bacteria | 6970 |
| 107 | Ga0075431_100213425 | 3300006847 | Unclassified | 1971 |
| 108 | Ga0075431_100344300 | 3300006847 | Bacteria | 1500 |
| 109 | Ga0075434_100223861 | 3300006871 | Bacteria | 1901 |
| 110 | Ga0075429_100014668 | 3300006880 | Bacteria | 6794 |
| 111 | Ga0068865_100020282 | 3300006881 | Bacteria | 4310 |
| 112 | Ga0068865_100113206 | 3300006881 | Unclassified | 2005 |
| 113 | Ga0075436_100253641 | 3300006914 | Bacteria | 1253 |
| 114 | Ga0097620_100402259 | 3300006931 | Unclassified | 1465 |
| 115 | Ga0075435_100190540 | 3300007076 | Bacteria | 1736 |
| 116 | Ga0111539_10798339 | 3300009094 | Unclassified | 1099 |
| 117 | Ga0114129_10009098 | 3300009147 | Bacteria | 14155 |
| 118 | Ga0114129_10345736 | 3300009147 | Bacteria | 1971 |
| 119 | Ga0105243_10269236 | 3300009148 | Unclassified | 1529 |
| 120 | Ga0105243_10999592 | 3300009148 | Bacteria | 839 |
| 121 | Ga0105242_10063690 | 3300009176 | Bacteria | 3037 |
| 122 | Ga0105242_10797608 | 3300009176 | Unclassified | 934 |
| 123 | Ga0105248_10119719 | 3300009177 | Bacteria | 2969 |
| 124 | Ga0105248_10349429 | 3300009177 | Bacteria | 1665 |
| 125 | Ga0105238_10266033 | 3300009551 | Bacteria | 1695 |
| 126 | Ga0105238_10692696 | 3300009551 | Unclassified | 1031 |
| 127 | Ga0105249_10001122 | 3300009553 | Bacteria | 23841 |
| 128 | Ga0105246_10403399 | 3300011119 | Unclassified | 1136 |
| 129 | Ga0157373_10035219 | 3300013100 | Bacteria | 3595 |
| 130 | Ga0157373_10115342 | 3300013100 | Bacteria | 1888 |
| 131 | Ga0157373_10617406 | 3300013100 | Bacteria | 790 |
| 132 | Ga0157371_10166293 | 3300013102 | Bacteria | 1575 |
| 133 | Ga0157370_10625256 | 3300013104 | Unclassified | 985 |
| 134 | Ga0157369_10026908 | 3300013105 | Bacteria | 6378 |
| 135 | Ga0157369_10107034 | 3300013105 | Unclassified | 2975 |
| 136 | Ga0157369_10641374 | 3300013105 | Unclassified | 1096 |
| 137 | Ga0157369_11232378 | 3300013105 | Bacteria | 763 |
| 138 | Ga0157378_10411180 | 3300013297 | Unclassified | 1335 |
| 139 | Ga0163162_10061655 | 3300013306 | Bacteria | 3788 |
| 140 | Ga0163162_11301204 | 3300013306 | Bacteria | 826 |
| 141 | Ga0157372_10003730 | 3300013307 | Bacteria | 16362 |
| 142 | Ga0157372_10004718 | 3300013307 | Bacteria | 14483 |
| 143 | Ga0157372_10041857 | 3300013307 | Bacteria | 5065 |
| 144 | Ga0157372_10044369 | 3300013307 | Bacteria | 4926 |
| 145 | Ga0157372_10632973 | 3300013307 | Bacteria | 1246 |
| 146 | Ga0157372_10697514 | 3300013307 | Bacteria | 1181 |
| 147 | Ga0157372_10866780 | 3300013307 | Bacteria | 1048 |
| 148 | Ga0157375_10021987 | 3300013308 | Bacteria | 5863 |
| 149 | Ga0157375_10168924 | 3300013308 | Bacteria | 2334 |
| 150 | Ga0157380_10003024 | 3300014326 | Bacteria | 11459 |
| 151 | Ga0182008_10011300 | 3300014497 | Bacteria | 4756 |
| 152 | Ga0157376_10896569 | 3300014969 | Unclassified | 905 |
| 153 | Ga0157376_11194801 | 3300014969 | Bacteria | 788 |
| 154 | Ga0182007_10155597 | 3300015262 | Bacteria | 779 |
| 155 | Ga0206354_11609563 | 3300020081 | Bacteria | 1108 |
| 156 | Ga0213875_10142112 | 3300021388 | Bacteria | 1124 |
| 157 | Ga0207682_10021720 | 3300025893 | Bacteria | 2526 |
| 158 | Ga0207642_10096528 | 3300025899 | Bacteria | 1474 |
| 159 | Ga0207647_10058030 | 3300025904 | Bacteria | 2371 |
| 160 | Ga0207699_10004999 | 3300025906 | Bacteria | 6340 |
| 161 | Ga0207699_10063828 | 3300025906 | Unclassified | 2226 |
| 162 | Ga0207699_10165210 | 3300025906 | Bacteria | 1477 |
| 163 | Ga0207645_10040627 | 3300025907 | Bacteria | 2979 |
| 164 | Ga0207705_10004955 | 3300025909 | Bacteria | 9997 |
| 165 | Ga0207705_10005590 | 3300025909 | Bacteria | 9398 |
| 166 | Ga0207705_10023340 | 3300025909 | Bacteria | 4413 |
| 167 | Ga0207705_10023862 | 3300025909 | Bacteria | 4364 |
| 168 | Ga0207705_10146772 | 3300025909 | Bacteria | 1765 |
| 169 | Ga0207705_10152784 | 3300025909 | Unclassified | 1730 |
| 170 | Ga0207705_10450487 | 3300025909 | Unclassified | 998 |
| 171 | Ga0207705_10679393 | 3300025909 | Bacteria | 801 |
| 172 | Ga0207707_10011009 | 3300025912 | Bacteria | 7871 |
| 173 | Ga0207707_10034107 | 3300025912 | Bacteria | 4454 |
| 174 | Ga0207707_10124925 | 3300025912 | Bacteria | 2250 |
| 175 | Ga0207707_10382290 | 3300025912 | Bacteria | 1210 |
| 176 | Ga0207707_10435151 | 3300025912 | Bacteria | 1123 |
| 177 | Ga0207695_10038501 | 3300025913 | Bacteria | 5147 |
| 178 | Ga0207693_10018146 | 3300025915 | Bacteria | 5607 |
| 179 | Ga0207693_10029954 | 3300025915 | Bacteria | 4295 |
| 180 | Ga0207660_10014023 | 3300025917 | Bacteria | 5260 |
| 181 | Ga0207660_10017761 | 3300025917 | Bacteria | 4732 |
| 182 | Ga0207660_10092757 | 3300025917 | Bacteria | 2242 |
| 183 | Ga0207660_10183355 | 3300025917 | Bacteria | 1627 |
| 184 | Ga0207660_10753411 | 3300025917 | Bacteria | 795 |
| 185 | Ga0207657_10000690 | 3300025919 | Bacteria | 35945 |
| 186 | Ga0207657_10012848 | 3300025919 | Bacteria | 8239 |
| 187 | Ga0207657_10109280 | 3300025919 | Bacteria | 2286 |
| 188 | Ga0207649_10061369 | 3300025920 | Bacteria | 2366 |
| 189 | Ga0207649_10197713 | 3300025920 | Bacteria | 1418 |
| 190 | Ga0207652_10009462 | 3300025921 | Bacteria | 7834 |
| 191 | Ga0207652_10035504 | 3300025921 | Bacteria | 4208 |
| 192 | Ga0207652_10177548 | 3300025921 | Bacteria | 1913 |
| 193 | Ga0207652_10376769 | 3300025921 | Bacteria | 1281 |
| 194 | Ga0207652_10427163 | 3300025921 | Bacteria | 1195 |
| 195 | Ga0207652_10471558 | 3300025921 | Bacteria | 1131 |
| 196 | Ga0207681_10000870 | 3300025923 | Bacteria | 19848 |
| 197 | Ga0207681_10030023 | 3300025923 | Bacteria | 3540 |
| 198 | Ga0207694_10003117 | 3300025924 | Bacteria | 13255 |
| 199 | Ga0207694_10202406 | 3300025924 | Bacteria | 1616 |
| 200 | Ga0207659_10056666 | 3300025926 | Unclassified | 2808 |
| 201 | Ga0207659_10192276 | 3300025926 | Unclassified | 1625 |
| 202 | Ga0207700_10010549 | 3300025928 | Bacteria | 5838 |
| 203 | Ga0207700_10041101 | 3300025928 | Unclassified | 3380 |
| 204 | Ga0207664_10005409 | 3300025929 | Bacteria | 8721 |
| 205 | Ga0207664_10033654 | 3300025929 | Bacteria | 3940 |
| 206 | Ga0207664_10051023 | 3300025929 | Bacteria | 3265 |
| 207 | Ga0207644_10063231 | 3300025931 | Bacteria | 2687 |
| 208 | Ga0207644_10732218 | 3300025931 | Unclassified | 825 |
| 209 | Ga0207690_10041658 | 3300025932 | Bacteria | 3011 |
| 210 | Ga0207690_10108992 | 3300025932 | Bacteria | 1991 |
| 211 | Ga0207690_10141719 | 3300025932 | Archaea | 1772 |
| 212 | Ga0207690_10229580 | 3300025932 | Bacteria | 1424 |
| 213 | Ga0207706_10033441 | 3300025933 | Bacteria | 4577 |
| 214 | Ga0207706_10085763 | 3300025933 | Bacteria | 2769 |
| 215 | Ga0207706_10224462 | 3300025933 | Unclassified | 1644 |
| 216 | Ga0207686_10092675 | 3300025934 | Bacteria | 1998 |
| 217 | Ga0207686_10137973 | 3300025934 | Bacteria | 1682 |
| 218 | Ga0207669_10083036 | 3300025937 | Bacteria | 2059 |
| 219 | Ga0207669_10371257 | 3300025937 | Bacteria | 1112 |
| 220 | Ga0207704_10001732 | 3300025938 | Bacteria | 9772 |
| 221 | Ga0207704_10286623 | 3300025938 | Bacteria | 1254 |
| 222 | Ga0207691_10005458 | 3300025940 | Bacteria | 12277 |
| 223 | Ga0207691_10016782 | 3300025940 | Bacteria | 6948 |
| 224 | Ga0207711_10085171 | 3300025941 | Bacteria | 2769 |
| 225 | Ga0207661_10012679 | 3300025944 | Bacteria | 6136 |
| 226 | Ga0207661_10140019 | 3300025944 | Bacteria | 2081 |
| 227 | Ga0207679_10011107 | 3300025945 | Bacteria | 5814 |
| 228 | Ga0207679_10052746 | 3300025945 | Bacteria | 2984 |
| 229 | Ga0207679_10198625 | 3300025945 | Bacteria | 1674 |
| 230 | Ga0207679_10604553 | 3300025945 | Bacteria | 988 |
| 231 | Ga0207667_10428949 | 3300025949 | Bacteria | 1345 |
| 232 | Ga0207667_10907016 | 3300025949 | Bacteria | 873 |
| 233 | Ga0207712_10001107 | 3300025961 | Bacteria | 18842 |
| 234 | Ga0207658_10063649 | 3300025986 | Unclassified | 2765 |
| 235 | Ga0207703_10188771 | 3300026035 | Unclassified | 1824 |
| 236 | Ga0207639_10054682 | 3300026041 | Bacteria | 3052 |
| 237 | Ga0207639_10058703 | 3300026041 | Bacteria | 2960 |
| 238 | Ga0207639_10637955 | 3300026041 | Unclassified | 985 |
| 239 | Ga0207639_11183766 | 3300026041 | Bacteria | 717 |
| 240 | Ga0207678_10309065 | 3300026067 | Bacteria | 1359 |
| 241 | Ga0207702_11057274 | 3300026078 | Bacteria | 805 |
| 242 | Ga0207641_10330082 | 3300026088 | Bacteria | 1449 |
| 243 | Ga0207648_10020671 | 3300026089 | Bacteria | 5926 |
| 244 | Ga0207648_10114102 | 3300026089 | Bacteria | 2374 |
| 245 | Ga0207676_10056914 | 3300026095 | Bacteria | 3077 |
| 246 | Ga0207676_10261081 | 3300026095 | Bacteria | 1564 |
| 247 | Ga0207676_10520184 | 3300026095 | Bacteria | 1133 |
| 248 | Ga0207674_10006313 | 3300026116 | Bacteria | 13968 |
| 249 | Ga0207674_10187953 | 3300026116 | Bacteria | 2016 |
| 250 | Ga0207683_10410562 | 3300026121 | Unclassified | 1246 |
| 251 | Ga0207698_10053335 | 3300026142 | Bacteria | 3103 |
| 252 | Ga0207698_10126393 | 3300026142 | Bacteria | 2175 |
| 253 | Ga0207698_10262610 | 3300026142 | Bacteria | 1587 |
| 254 | Ga0268266_10031484 | 3300028379 | Bacteria | 4505 |
| 255 | Ga0268265_10004069 | 3300028380 | Bacteria | 10277 |
| 256 | Ga0268265_11444373 | 3300028380 | Unclassified | 691 |
| 257 | Ga0268264_10084341 | 3300028381 | Bacteria | 2724 |
| 258 | Ga0265332_10147274 | 3300031238 | Unclassified | 985 |
| 259 | Ga0307408_100012902 | 3300031548 | Bacteria | 5540 |
| 260 | Ga0307408_100964948 | 3300031548 | Bacteria | 784 |
| 261 | Ga0265314_10008723 | 3300031711 | Bacteria | 8666 |
| 262 | Ga0307405_10000162 | 3300031731 | Bacteria | 24577 |
| 263 | Ga0307413_10000538 | 3300031824 | Bacteria | 12594 |
| 264 | Ga0307410_10013161 | 3300031852 | Bacteria | 4815 |
| 265 | Ga0307410_10186127 | 3300031852 | Unclassified | 1576 |
| 266 | Ga0307406_10003650 | 3300031901 | Bacteria | 8382 |
| 267 | Ga0307406_10852316 | 3300031901 | Unclassified | 773 |
| 268 | Ga0307407_10001101 | 3300031903 | Bacteria | 9436 |
| 269 | Ga0307407_10230399 | 3300031903 | Bacteria | 1258 |
| 270 | Ga0307412_10003190 | 3300031911 | Bacteria | 9108 |
| 271 | Ga0307412_10251351 | 3300031911 | Bacteria | 1373 |
| 272 | Ga0307412_10850714 | 3300031911 | Unclassified | 796 |
| 273 | Ga0307409_100594887 | 3300031995 | Bacteria | 1092 |
| 274 | Ga0307409_101382539 | 3300031995 | Unclassified | 730 |
| 275 | Ga0307416_100032752 | 3300032002 | Bacteria | 3932 |
| 276 | Ga0307416_100264307 | 3300032002 | Bacteria | 1684 |
| 277 | Ga0307416_100553737 | 3300032002 | Bacteria | 1224 |
| 278 | Ga0307416_100696280 | 3300032002 | Unclassified | 1105 |
| 279 | Ga0307414_10005259 | 3300032004 | Bacteria | 7115 |
| 280 | Ga0307411_10001407 | 3300032005 | Bacteria | 9780 |
| 281 | Ga0307411_10455770 | 3300032005 | Bacteria | 1071 |
| 282 | Ga0307411_10671796 | 3300032005 | Unclassified | 899 |
| 283 | Ga0307415_100004918 | 3300032126 | Bacteria | 7020 |
| 284 | Ga0307415_100035301 | 3300032126 | Bacteria | 3265 |
| 285 | Ga0373934_0000246 | 3300035086 | Bacteria | 19441 |
| 286 | Ga0373923_0022710 | 3300035111 | Bacteria | 2462 |
| 287 | Ga0373936_0129614 | 3300035113 | Unclassified | 1083 |
| 288 | Ga0373945_0004315 | 3300035116 | Bacteria | 4518 |
| 289 | Ga0373956_0001027 | 3300035119 | Bacteria | 11515 |
| 290 | Ga0373943_0008063 | 3300035170 | Bacteria | 4725 |
| 291 | Ga0373955_0013331 | 3300035172 | Bacteria | 3973 |
| 292 | Ga0373924_0007337 | 3300035410 | Bacteria | 3978 |
| 293 | Ga0373935_0007945 | 3300035692 | Bacteria | 6362 |
| 294 | Ga0373927_0018614 | 3300035695 | Bacteria | 4561 |
| 295 | Ga0373933_0005341 | 3300035724 | Bacteria | 7001 |
| 296 | Ga0373937_0001671 | 3300036401 | Bacteria | 18648 |
| 297 | Ga0373937_0914355 | 3300036401 | Bacteria | 826 |
| 298 | Ga0373925_0000385 | 3300037068 | Bacteria | 45502 |
| 299 | Ga0373925_0343543 | 3300037068 | Unclassified | 1211 |
| 300 | Ga0395905_1038651 | 3300037471 | Unclassified | 723 |
| 301 | Ga0436364_0920498 | 3300037853 | Bacteria | 3827 |
| 302 | Ga0436364_1510006 | 3300037853 | Unclassified | 1224 |
| 303 | Ga0451853_2313564 | 3300041512 | Unclassified | 985 |
| 304 | Ga0466957_0088368 | 3300044842 | Bacteria | 1939 |
| 305 | Ga0466959_0120661 | 3300045049 | Unclassified | 1864 |
| 306 | Ga0451576_0203429 | 3300045051 | Bacteria | 2068 |
| 307 | Ga0466958_0060058 | 3300045836 | Bacteria | 2314 |
| 308 | Ga0466967_0013918 | 3300045976 | Bacteria | 6241 |
| 309 | Ga0466967_0066069 | 3300045976 | Bacteria | 3222 |
| 310 | Ga0466967_0996715 | 3300045976 | Unclassified | 834 |
| 311 | Ga0495592_0000632 | 3300046454 | Bacteria | 24520 |
| 312 | Ga0495592_0216590 | 3300046454 | Bacteria | 1283 |
| 313 | Ga0495603_0003985 | 3300046455 | Bacteria | 8790 |
| 314 | Ga0495603_0087846 | 3300046455 | Bacteria | 1819 |
| 315 | Ga0495590_0355242 | 3300046457 | Bacteria | 557 |
| 316 | Ga0495629_0012457 | 3300046459 | Bacteria | 6160 |
| 317 | Ga0495629_0020898 | 3300046459 | Bacteria | 4672 |
| 318 | Ga0495629_0495447 | 3300046459 | Bacteria | 824 |
| 319 | Ga0495651_0000077 | 3300046462 | Bacteria | 71891 |
| 320 | Ga0495653_0000153 | 3300046463 | Bacteria | 57262 |
| 321 | Ga0495653_0277173 | 3300046463 | Bacteria | 1102 |
| 322 | Ga0495580_0001293 | 3300046472 | Bacteria | 22086 |
| 323 | Ga0495582_0174663 | 3300046473 | Bacteria | 1224 |
| 324 | Ga0495582_0176067 | 3300046473 | Unclassified | 1218 |
| 325 | Ga0495639_0000575 | 3300046475 | Bacteria | 17150 |
| 326 | Ga0495662_0124060 | 3300046476 | Bacteria | 1268 |
| 327 | Ga0495664_0085858 | 3300046477 | Unclassified | 1890 |
| 328 | Ga0495585_0259621 | 3300046492 | Bacteria | 864 |
| 329 | Ga0495594_0160107 | 3300046499 | Bacteria | 1280 |
| 330 | Ga0495594_0257395 | 3300046499 | Bacteria | 994 |
| 331 | Ga0495608_0000166 | 3300046511 | Bacteria | 46948 |
| 332 | Ga0495608_0194086 | 3300046511 | Bacteria | 1281 |
| 333 | Ga0495618_0363782 | 3300046514 | Bacteria | 890 |
| 334 | Ga0495628_0002032 | 3300046516 | Bacteria | 18338 |
| 335 | Ga0495628_0343663 | 3300046516 | Bacteria | 1098 |
| 336 | Ga0495630_0000980 | 3300046517 | Bacteria | 19843 |
| 337 | Ga0495630_0021535 | 3300046517 | Bacteria | 4760 |
| 338 | Ga0495652_0002213 | 3300046529 | Bacteria | 20389 |
| 339 | Ga0495652_0240568 | 3300046529 | Bacteria | 1347 |
| 340 | Ga0495665_0000002 | 3300046531 | Bacteria | 128983 |
| 341 | Ga0495665_0163725 | 3300046531 | Bacteria | 1159 |
| 342 | Ga0495665_0183776 | 3300046531 | Bacteria | 1086 |
| 343 | Ga0495640_0084751 | 3300046533 | Bacteria | 2101 |
| 344 | Ga0495640_0207858 | 3300046533 | Bacteria | 1238 |
| 345 | Ga0495586_0015017 | 3300046535 | Bacteria | 4117 |
| 346 | Ga0495586_0040394 | 3300046535 | Bacteria | 2509 |
| 347 | Ga0495586_0048991 | 3300046535 | Bacteria | 2284 |
| 348 | Ga0495586_0151912 | 3300046535 | Bacteria | 1303 |
| 349 | Ga0495587_0000400 | 3300046536 | Bacteria | 30690 |
| 350 | Ga0495587_0013079 | 3300046536 | Bacteria | 5219 |
| 351 | Ga0495587_0167550 | 3300046536 | Bacteria | 1248 |
| 352 | Ga0495645_0000484 | 3300046543 | Bacteria | 27579 |
| 353 | Ga0495645_0182362 | 3300046543 | Bacteria | 1437 |
| 354 | Ga0495645_0182682 | 3300046543 | Bacteria | 1435 |
| 355 | Ga0495667_0000489 | 3300046559 | Bacteria | 25253 |
| 356 | Ga0495667_0095779 | 3300046559 | Bacteria | 1921 |
| 357 | Ga0495667_0210096 | 3300046559 | Bacteria | 1244 |
| 358 | Ga0495635_0000048 | 3300046663 | Bacteria | 79393 |
| 359 | Ga0495635_0141357 | 3300046663 | Bacteria | 1639 |
| 360 | Ga0495588_0000817 | 3300046674 | Bacteria | 13886 |
| 361 | Ga0495657_0000318 | 3300046675 | Bacteria | 44307 |
| 362 | Ga0495657_0119120 | 3300046675 | Bacteria | 1664 |
| 363 | Ga0495657_0377748 | 3300046675 | Unclassified | 836 |
| 364 | Ga0495599_0002246 | 3300046678 | Bacteria | 11242 |
| 365 | Ga0495599_0238787 | 3300046678 | Unclassified | 1108 |
| 366 | Ga0495599_0303414 | 3300046678 | Bacteria | 963 |
| 367 | Ga0495623_0000110 | 3300046679 | Bacteria | 50112 |
| 368 | Ga0495623_0100278 | 3300046679 | Bacteria | 1765 |
| 369 | Ga0495646_0002674 | 3300046680 | Bacteria | 11030 |
| 370 | Ga0495658_0000017 | 3300046683 | Bacteria | 93346 |
| 371 | Ga0495613_0009269 | 3300046689 | Bacteria | 7303 |
| 372 | Ga0495613_0046381 | 3300046689 | Bacteria | 3213 |
| 373 | Ga0495624_0358711 | 3300046690 | Bacteria | 877 |
| 374 | Ga0495600_0000273 | 3300046809 | Bacteria | 28023 |
| 375 | Ga0495600_0096954 | 3300046809 | Bacteria | 1922 |
| 376 | Ga0495600_0209649 | 3300046809 | Bacteria | 1249 |
| 377 | Ga0495600_0564821 | 3300046809 | Viruses | 694 |
| 378 | Ga0495581_0000727 | 3300047315 | Bacteria | 17418 |
| 379 | Ga0495581_0035752 | 3300047315 | Bacteria | 2874 |
| 380 | Ga0495581_0043946 | 3300047315 | Bacteria | 2584 |
| 381 | Ga0495581_0321028 | 3300047315 | Unclassified | 905 |
| 382 | Ga0495604_0000017 | 3300047317 | Bacteria | 192029 |
| 383 | Ga0495604_0066128 | 3300047317 | Bacteria | 2751 |
| 384 | Ga0495674_0024600 | 3300047319 | Bacteria | 5530 |
| 385 | Ga0495674_0090221 | 3300047319 | Bacteria | 2619 |
| 386 | Ga0495674_0093459 | 3300047319 | Bacteria | 2566 |
| 387 | Ga0495680_0015843 | 3300047322 | Bacteria | 6488 |
| 388 | Ga0495680_0074131 | 3300047322 | Bacteria | 2585 |
| 389 | Ga0495680_0179977 | 3300047322 | Bacteria | 1526 |
| 390 | Ga0495675_0000800 | 3300047444 | Bacteria | 19382 |
| 391 | Ga0495684_0000785 | 3300047471 | Bacteria | 25792 |
| 392 | Ga0495684_0226304 | 3300047471 | Bacteria | 1369 |
| 393 | Ga0495593_0104721 | 3300047673 | Bacteria | 1448 |
| 394 | Ga0495593_0118489 | 3300047673 | Unclassified | 1348 |
| 395 | Ga0495602_0007248 | 3300048088 | Bacteria | 11612 |
| 396 | Ga0495602_0028785 | 3300048088 | Bacteria | 5307 |
| 397 | Ga0495602_0075395 | 3300048088 | Bacteria | 2863 |
| 398 | Ga0495614_0000005 | 3300048089 | Bacteria | 74692 |
| 399 | Ga0496100_0365956 | 3300048903 | Bacteria | 1092 |
| 400 | Ga0496104_0118557 | 3300048907 | Bacteria | 2541 |
| 401 | Ga0496104_0197845 | 3300048907 | Bacteria | 1922 |
| 402 | Ga0496108_0938143 | 3300048911 | Bacteria | 741 |
| 403 | Ga0496110_1272222 | 3300048913 | Bacteria | 645 |
| 404 | Ga0496112_0038996 | 3300048915 | Bacteria | 4640 |
| 405 | Ga0496112_0201749 | 3300048915 | Bacteria | 1948 |
| 406 | Ga0496113_0049369 | 3300048916 | Bacteria | 3133 |
| 407 | Ga0496115_0036770 | 3300048918 | Bacteria | 3878 |
| 408 | Ga0501032_0510260 | 3300049569 | Bacteria | 768 |
| 409 | Ga0501033_0004019 | 3300049570 | Bacteria | 11885 |
| 410 | Ga0501034_0022849 | 3300049571 | Bacteria | 6372 |
| 411 | Ga0501036_0012090 | 3300049572 | Bacteria | 7155 |
| 412 | Ga0501036_0284851 | 3300049572 | Bacteria | 1383 |
| 413 | Ga0501037_0352625 | 3300049573 | Bacteria | 1015 |
| 414 | Ga0501038_0046096 | 3300049574 | Bacteria | 3781 |
| 415 | Ga0501043_0055146 | 3300049579 | Bacteria | 3122 |
| 416 | Ga0501047_0013386 | 3300049581 | Bacteria | 7775 |
| 417 | Ga0501070_0039373 | 3300049586 | Bacteria | 3943 |
| 418 | Ga0501207_048338 | 3300049654 | Bacteria | 755 |
| 419 | Ga0501035_0105817 | 3300049822 | Bacteria | 2467 |
| 420 | Ga0501044_0003693 | 3300049823 | Bacteria | 17206 |
| 421 | nmdc:mga05p37_407334_c1 | 3300050507 | Unclassified | 1586 |
| 422 | nmdc:mga05p37_42957_c1 | 3300050507 | Bacteria | 5557 |
| 423 | nmdc:mga09592_9336_c1 | 3300050508 | Bacteria | 7975 |
| 424 | nmdc:mga0qj67_15827_c1 | 3300050509 | Bacteria | 5712 |
| 425 | nmdc:mga0qj67_26080_c1 | 3300050509 | Bacteria | 4523 |
| 426 | nmdc:mga06r32_201686_c1 | 3300050510 | Bacteria | 1977 |
| 427 | nmdc:mga06r32_282157_c1 | 3300050510 | Unclassified | 1648 |
| 428 | nmdc:mga06r32_463599_c1 | 3300050510 | Unclassified | 1246 |
| 429 | nmdc:mga08y16_41772_c1 | 3300050511 | Bacteria | 4803 |
| 430 | nmdc:mga0n895_346406_c1 | 3300050512 | Unclassified | 1505 |
| 431 | nmdc:mga0n895_723038_c1 | 3300050512 | Unclassified | 990 |
| 432 | nmdc:mga0a205_184739_c1 | 3300050515 | Bacteria | 1978 |
| 433 | nmdc:mga0a205_448110_c1 | 3300050515 | Unclassified | 1151 |
| 434 | Ga0495601_0004220 | 3300053077 | Bacteria | 8292 |
| 435 | Ga0495612_0002385 | 3300053078 | Bacteria | 7747 |
| 436 | Ga0495595_0022200 | 3300053084 | Bacteria | 2783 |
| 437 | Ga0495619_0006054 | 3300053085 | Bacteria | 7664 |
| 438 | Ga0590071_022508 | 3300059421 | Bacteria | 1487 |
| 439 | Ga0590075_024906 | 3300059424 | Bacteria | 1503 |
| 440 | Ga0590077_083922 | 3300059426 | Unclassified | 735 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0564821 | Ga0495600_0564821_27_512 | 157 |
| 2 | 3300005456 | Ga0070678_100283375 | Ga0070678_1002833752 | 161 |
| 3 | 3300046675 | Ga0495657_0377748 | Ga0495657_0377748_100_654 | 169 |
| 4 | 3300047315 | Ga0495581_0043946 | Ga0495581_0043946_431_985 | 169 |
| 5 | 3300046531 | Ga0495665_0183776 | Ga0495665_0183776_366_920 | 170 |
| 6 | 3300046535 | Ga0495586_0048991 | Ga0495586_0048991_412_966 | 170 |
| 7 | 3300046689 | Ga0495613_0046381 | Ga0495613_0046381_1354_1908 | 170 |
| 8 | 3300046809 | Ga0495600_0096954 | Ga0495600_0096954_1264_1818 | 170 |
| 9 | 3300005327 | Ga0070658_10069880 | Ga0070658_100698804 | 174 |
| 10 | 3300005336 | Ga0070680_100039944 | Ga0070680_1000399443 | 174 |
| 11 | 3300005364 | Ga0070673_101185715 | Ga0070673_1011857151 | 174 |
| 12 | 3300005530 | Ga0070679_100364473 | Ga0070679_1003644732 | 174 |
| 13 | 3300025929 | Ga0207664_10005409 | Ga0207664_100054094 | 174 |
| 14 | 3300035172 | Ga0373955_0013331 | Ga0373955_0013331_3418_3954 | 174 |
| 15 | 3300046455 | Ga0495603_0087846 | Ga0495603_0087846_920_1486 | 174 |
| 16 | 3300046457 | Ga0495590_0355242 | Ga0495590_0355242_16_543 | 174 |
| 17 | 3300046459 | Ga0495629_0495447 | Ga0495629_0495447_235_801 | 174 |
| 18 | 3300046473 | Ga0495582_0174663 | Ga0495582_0174663_71_637 | 174 |
| 19 | 3300046499 | Ga0495594_0257395 | Ga0495594_0257395_80_646 | 174 |
| 20 | 3300021388 | Ga0213875_10142112 | Ga0213875_101421121 | 175 |
| 21 | 3300036401 | Ga0373937_0914355 | Ga0373937_0914355_66_632 | 175 |
| 22 | 3300037853 | Ga0436364_1510006 | Ga0436364_1510006_471_1031 | 175 |
| 23 | 3300046454 | Ga0495592_0216590 | Ga0495592_0216590_682_1248 | 175 |
| 24 | 3300046514 | Ga0495618_0363782 | Ga0495618_0363782_31_591 | 175 |
| 25 | 3300046516 | Ga0495628_0343663 | Ga0495628_0343663_319_885 | 175 |
| 26 | 3300046531 | Ga0495665_0163725 | Ga0495665_0163725_113_679 | 175 |
| 27 | 3300046535 | Ga0495586_0151912 | Ga0495586_0151912_150_716 | 175 |
| 28 | 3300046536 | Ga0495587_0013079 | Ga0495587_0013079_310_864 | 175 |
| 29 | 3300046536 | Ga0495587_0167550 | Ga0495587_0167550_599_1165 | 175 |
| 30 | 3300046543 | Ga0495645_0182362 | Ga0495645_0182362_37_603 | 175 |
| 31 | 3300046559 | Ga0495667_0210096 | Ga0495667_0210096_271_837 | 175 |
| 32 | 3300046678 | Ga0495599_0303414 | Ga0495599_0303414_224_790 | 175 |
| 33 | 3300046679 | Ga0495623_0100278 | Ga0495623_0100278_62_628 | 175 |
| 34 | 3300046690 | Ga0495624_0358711 | Ga0495624_0358711_296_862 | 175 |
| 35 | 3300047319 | Ga0495674_0093459 | Ga0495674_0093459_66_632 | 175 |
| 36 | 3300047322 | Ga0495680_0074131 | Ga0495680_0074131_89_655 | 175 |
| 37 | 3300047471 | Ga0495684_0226304 | Ga0495684_0226304_441_1007 | 175 |
| 38 | 3300048088 | Ga0495602_0075395 | Ga0495602_0075395_2162_2728 | 175 |
| 39 | 3300009176 | Ga0105242_10797608 | Ga0105242_107976082 | 177 |
| 40 | 3300014969 | Ga0157376_11194801 | Ga0157376_111948011 | 177 |
| 41 | 3300025907 | Ga0207645_10040627 | Ga0207645_100406272 | 177 |
| 42 | 3300046499 | Ga0495594_0160107 | Ga0495594_0160107_222_776 | 180 |
| 43 | 3300005564 | Ga0070664_100989897 | Ga0070664_1009898971 | 181 |
| 44 | 3300005616 | Ga0068852_101275358 | Ga0068852_1012753582 | 181 |
| 45 | 3300006871 | Ga0075434_100223861 | Ga0075434_1002238612 | 181 |
| 46 | 3300007076 | Ga0075435_100190540 | Ga0075435_1001905402 | 181 |
| 47 | 3300025909 | Ga0207705_10023862 | Ga0207705_100238621 | 181 |
| 48 | 3300025932 | Ga0207690_10108992 | Ga0207690_101089921 | 181 |
| 49 | 3300025945 | Ga0207679_10052746 | Ga0207679_100527464 | 181 |
| 50 | 3300026142 | Ga0207698_10262610 | Ga0207698_102626102 | 181 |
| 51 | 3300031548 | Ga0307408_100012902 | Ga0307408_1000129023 | 181 |
| 52 | 3300031731 | Ga0307405_10000162 | Ga0307405_1000016217 | 181 |
| 53 | 3300031824 | Ga0307413_10000538 | Ga0307413_100005383 | 181 |
| 54 | 3300031852 | Ga0307410_10013161 | Ga0307410_100131612 | 181 |
| 55 | 3300031901 | Ga0307406_10003650 | Ga0307406_100036502 | 181 |
| 56 | 3300031903 | Ga0307407_10001101 | Ga0307407_100011015 | 181 |
| 57 | 3300031911 | Ga0307412_10003190 | Ga0307412_100031902 | 181 |
| 58 | 3300032002 | Ga0307416_100032752 | Ga0307416_1000327522 | 181 |
| 59 | 3300032004 | Ga0307414_10005259 | Ga0307414_100052595 | 181 |
| 60 | 3300032005 | Ga0307411_10001407 | Ga0307411_100014072 | 181 |
| 61 | 3300032126 | Ga0307415_100004918 | Ga0307415_1000049188 | 181 |
| 62 | 3300045051 | Ga0451576_0203429 | Ga0451576_0203429_39_590 | 181 |
| 63 | 3300048918 | Ga0496115_0036770 | Ga0496115_0036770_2499_3044 | 181 |
| 64 | 3300050512 | nmdc:mga0n895_346406_c1 | nmdc:mga0n895_346406_c1_210_761 | 181 |
| 65 | 3300050515 | nmdc:mga0a205_448110_c1 | nmdc:mga0a205_448110_c1_513_1064 | 181 |
| 66 | 3300037853 | Ga0436364_0920498 | Ga0436364_0920498_1044_1604 | 182 |
| 67 | 3300045976 | Ga0466967_0013918 | Ga0466967_0013918_2869_3447 | 182 |
| 68 | 3300049570 | Ga0501033_0004019 | Ga0501033_0004019_6090_6647 | 182 |
| 69 | 3300049571 | Ga0501034_0022849 | Ga0501034_0022849_4924_5481 | 182 |
| 70 | 3300049572 | Ga0501036_0012090 | Ga0501036_0012090_5724_6281 | 182 |
| 71 | 3300049823 | Ga0501044_0003693 | Ga0501044_0003693_6705_7262 | 182 |
| 72 | 3300005327 | Ga0070658_10002792 | Ga0070658_1000279212 | 183 |
| 73 | 3300005327 | Ga0070658_10064942 | Ga0070658_100649422 | 183 |
| 74 | 3300005327 | Ga0070658_10410392 | Ga0070658_104103922 | 183 |
| 75 | 3300005327 | Ga0070658_11128100 | Ga0070658_111281001 | 183 |
| 76 | 3300005328 | Ga0070676_10036064 | Ga0070676_100360642 | 183 |
| 77 | 3300005328 | Ga0070676_10340440 | Ga0070676_103404402 | 183 |
| 78 | 3300005328 | Ga0070676_10420923 | Ga0070676_104209231 | 183 |
| 79 | 3300005328 | Ga0070676_10667461 | Ga0070676_106674611 | 183 |
| 80 | 3300005329 | Ga0070683_100017629 | Ga0070683_1000176294 | 183 |
| 81 | 3300005329 | Ga0070683_100027619 | Ga0070683_1000276195 | 183 |
| 82 | 3300005329 | Ga0070683_100440596 | Ga0070683_1004405962 | 183 |
| 83 | 3300005331 | Ga0070670_100005240 | Ga0070670_10000524015 | 183 |
| 84 | 3300005336 | Ga0070680_100016153 | Ga0070680_1000161536 | 183 |
| 85 | 3300005338 | Ga0068868_100103179 | Ga0068868_1001031792 | 183 |
| 86 | 3300005338 | Ga0068868_100160775 | Ga0068868_1001607752 | 183 |
| 87 | 3300005339 | Ga0070660_100002933 | Ga0070660_1000029338 | 183 |
| 88 | 3300005339 | Ga0070660_100087392 | Ga0070660_1000873922 | 183 |
| 89 | 3300005341 | Ga0070691_10000572 | Ga0070691_100005728 | 183 |
| 90 | 3300005344 | Ga0070661_100014869 | Ga0070661_1000148692 | 183 |
| 91 | 3300005344 | Ga0070661_100126040 | Ga0070661_1001260401 | 183 |
| 92 | 3300005344 | Ga0070661_100204993 | Ga0070661_1002049932 | 183 |
| 93 | 3300005347 | Ga0070668_100026230 | Ga0070668_1000262302 | 183 |
| 94 | 3300005353 | Ga0070669_100007145 | Ga0070669_1000071452 | 183 |
| 95 | 3300005354 | Ga0070675_100001511 | Ga0070675_1000015117 | 183 |
| 96 | 3300005355 | Ga0070671_100069223 | Ga0070671_1000692234 | 183 |
| 97 | 3300005355 | Ga0070671_100129325 | Ga0070671_1001293253 | 183 |
| 98 | 3300005356 | Ga0070674_100049933 | Ga0070674_1000499333 | 183 |
| 99 | 3300005356 | Ga0070674_100057334 | Ga0070674_1000573342 | 183 |
| 100 | 3300005356 | Ga0070674_100421627 | Ga0070674_1004216272 | 183 |
| 101 | 3300005356 | Ga0070674_100576202 | Ga0070674_1005762021 | 183 |
| 102 | 3300005364 | Ga0070673_100305741 | Ga0070673_1003057411 | 183 |
| 103 | 3300005364 | Ga0070673_100696368 | Ga0070673_1006963682 | 183 |
| 104 | 3300005365 | Ga0070688_100440273 | Ga0070688_1004402732 | 183 |
| 105 | 3300005366 | Ga0070659_100082140 | Ga0070659_1000821403 | 183 |
| 106 | 3300005366 | Ga0070659_100098699 | Ga0070659_1000986992 | 183 |
| 107 | 3300005366 | Ga0070659_100171168 | Ga0070659_1001711683 | 183 |
| 108 | 3300005435 | Ga0070714_100023611 | Ga0070714_1000236112 | 183 |
| 109 | 3300005435 | Ga0070714_100025909 | Ga0070714_1000259094 | 183 |
| 110 | 3300005435 | Ga0070714_100181790 | Ga0070714_1001817902 | 183 |
| 111 | 3300005435 | Ga0070714_100246859 | Ga0070714_1002468592 | 183 |
| 112 | 3300005436 | Ga0070713_100004084 | Ga0070713_1000040847 | 183 |
| 113 | 3300005436 | Ga0070713_100166626 | Ga0070713_1001666262 | 183 |
| 114 | 3300005436 | Ga0070713_100840455 | Ga0070713_1008404552 | 183 |
| 115 | 3300005437 | Ga0070710_10194801 | Ga0070710_101948012 | 183 |
| 116 | 3300005456 | Ga0070678_100401493 | Ga0070678_1004014932 | 183 |
| 117 | 3300005457 | Ga0070662_100083023 | Ga0070662_1000830232 | 183 |
| 118 | 3300005457 | Ga0070662_100177858 | Ga0070662_1001778582 | 183 |
| 119 | 3300005457 | Ga0070662_100199273 | Ga0070662_1001992732 | 183 |
| 120 | 3300005458 | Ga0070681_10019316 | Ga0070681_100193162 | 183 |
| 121 | 3300005459 | Ga0068867_100006965 | Ga0068867_1000069657 | 183 |
| 122 | 3300005459 | Ga0068867_100048370 | Ga0068867_1000483704 | 183 |
| 123 | 3300005459 | Ga0068867_100060017 | Ga0068867_1000600172 | 183 |
| 124 | 3300005471 | Ga0070698_100114663 | Ga0070698_1001146634 | 183 |
| 125 | 3300005518 | Ga0070699_100630436 | Ga0070699_1006304361 | 183 |
| 126 | 3300005530 | Ga0070679_100003639 | Ga0070679_1000036392 | 183 |
| 127 | 3300005530 | Ga0070679_100028836 | Ga0070679_1000288364 | 183 |
| 128 | 3300005530 | Ga0070679_100142480 | Ga0070679_1001424802 | 183 |
| 129 | 3300005530 | Ga0070679_100351680 | Ga0070679_1003516801 | 183 |
| 130 | 3300005530 | Ga0070679_100422041 | Ga0070679_1004220412 | 183 |
| 131 | 3300005530 | Ga0070679_100436822 | Ga0070679_1004368222 | 183 |
| 132 | 3300005535 | Ga0070684_100114705 | Ga0070684_1001147052 | 183 |
| 133 | 3300005535 | Ga0070684_100165754 | Ga0070684_1001657542 | 183 |
| 134 | 3300005535 | Ga0070684_100267250 | Ga0070684_1002672501 | 183 |
| 135 | 3300005535 | Ga0070684_100352450 | Ga0070684_1003524502 | 183 |
| 136 | 3300005535 | Ga0070684_100355395 | Ga0070684_1003553951 | 183 |
| 137 | 3300005539 | Ga0068853_100069801 | Ga0068853_1000698011 | 183 |
| 138 | 3300005539 | Ga0068853_100266524 | Ga0068853_1002665242 | 183 |
| 139 | 3300005539 | Ga0068853_100972724 | Ga0068853_1009727241 | 183 |
| 140 | 3300005543 | Ga0070672_100056614 | Ga0070672_1000566144 | 183 |
| 141 | 3300005543 | Ga0070672_100085489 | Ga0070672_1000854892 | 183 |
| 142 | 3300005543 | Ga0070672_100339207 | Ga0070672_1003392072 | 183 |
| 143 | 3300005544 | Ga0070686_100347737 | Ga0070686_1003477372 | 183 |
| 144 | 3300005548 | Ga0070665_100019563 | Ga0070665_1000195631 | 183 |
| 145 | 3300005563 | Ga0068855_101412455 | Ga0068855_1014124551 | 183 |
| 146 | 3300005564 | Ga0070664_100023648 | Ga0070664_1000236484 | 183 |
| 147 | 3300005564 | Ga0070664_100024639 | Ga0070664_1000246393 | 183 |
| 148 | 3300005577 | Ga0068857_100008104 | Ga0068857_10000810412 | 183 |
| 149 | 3300005577 | Ga0068857_100125654 | Ga0068857_1001256542 | 183 |
| 150 | 3300005614 | Ga0068856_100728868 | Ga0068856_1007288682 | 183 |
| 151 | 3300005615 | Ga0070702_100105405 | Ga0070702_1001054051 | 183 |
| 152 | 3300005616 | Ga0068852_100040845 | Ga0068852_1000408452 | 183 |
| 153 | 3300005616 | Ga0068852_100124009 | Ga0068852_1001240092 | 183 |
| 154 | 3300005616 | Ga0068852_101372737 | Ga0068852_1013727372 | 183 |
| 155 | 3300005617 | Ga0068859_100402231 | Ga0068859_1004022312 | 183 |
| 156 | 3300005618 | Ga0068864_100533055 | Ga0068864_1005330551 | 183 |
| 157 | 3300005618 | Ga0068864_101240507 | Ga0068864_1012405071 | 183 |
| 158 | 3300005718 | Ga0068866_10013364 | Ga0068866_100133645 | 183 |
| 159 | 3300005842 | Ga0068858_100066521 | Ga0068858_1000665213 | 183 |
| 160 | 3300005843 | Ga0068860_100136732 | Ga0068860_1001367321 | 183 |
| 161 | 3300005844 | Ga0068862_100000864 | Ga0068862_10000086415 | 183 |
| 162 | 3300006028 | Ga0070717_10074541 | Ga0070717_100745412 | 183 |
| 163 | 3300006028 | Ga0070717_10220403 | Ga0070717_102204032 | 183 |
| 164 | 3300006163 | Ga0070715_10049479 | Ga0070715_100494792 | 183 |
| 165 | 3300006175 | Ga0070712_100035288 | Ga0070712_1000352883 | 183 |
| 166 | 3300006237 | Ga0097621_100813834 | Ga0097621_1008138342 | 183 |
| 167 | 3300006844 | Ga0075428_100014623 | Ga0075428_1000146236 | 183 |
| 168 | 3300006846 | Ga0075430_100009108 | Ga0075430_1000091086 | 183 |
| 169 | 3300006846 | Ga0075430_100032116 | Ga0075430_1000321162 | 183 |
| 170 | 3300006847 | Ga0075431_100019180 | Ga0075431_1000191805 | 183 |
| 171 | 3300006847 | Ga0075431_100213425 | Ga0075431_1002134253 | 183 |
| 172 | 3300006847 | Ga0075431_100344300 | Ga0075431_1003443002 | 183 |
| 173 | 3300006880 | Ga0075429_100014668 | Ga0075429_1000146685 | 183 |
| 174 | 3300006881 | Ga0068865_100020282 | Ga0068865_1000202826 | 183 |
| 175 | 3300006881 | Ga0068865_100113206 | Ga0068865_1001132063 | 183 |
| 176 | 3300006914 | Ga0075436_100253641 | Ga0075436_1002536412 | 183 |
| 177 | 3300006931 | Ga0097620_100402259 | Ga0097620_1004022592 | 183 |
| 178 | 3300009094 | Ga0111539_10798339 | Ga0111539_107983391 | 183 |
| 179 | 3300009147 | Ga0114129_10009098 | Ga0114129_1000909813 | 183 |
| 180 | 3300009147 | Ga0114129_10345736 | Ga0114129_103457363 | 183 |
| 181 | 3300009148 | Ga0105243_10269236 | Ga0105243_102692362 | 183 |
| 182 | 3300009148 | Ga0105243_10999592 | Ga0105243_109995922 | 183 |
| 183 | 3300009176 | Ga0105242_10063690 | Ga0105242_100636904 | 183 |
| 184 | 3300009177 | Ga0105248_10119719 | Ga0105248_101197193 | 183 |
| 185 | 3300009177 | Ga0105248_10349429 | Ga0105248_103494292 | 183 |
| 186 | 3300009551 | Ga0105238_10266033 | Ga0105238_102660331 | 183 |
| 187 | 3300009551 | Ga0105238_10692696 | Ga0105238_106926962 | 183 |
| 188 | 3300009553 | Ga0105249_10001122 | Ga0105249_100011227 | 183 |
| 189 | 3300011119 | Ga0105246_10403399 | Ga0105246_104033992 | 183 |
| 190 | 3300013100 | Ga0157373_10035219 | Ga0157373_100352195 | 183 |
| 191 | 3300013100 | Ga0157373_10115342 | Ga0157373_101153422 | 183 |
| 192 | 3300013100 | Ga0157373_10617406 | Ga0157373_106174061 | 183 |
| 193 | 3300013102 | Ga0157371_10166293 | Ga0157371_101662932 | 183 |
| 194 | 3300013104 | Ga0157370_10625256 | Ga0157370_106252562 | 183 |
| 195 | 3300013105 | Ga0157369_10026908 | Ga0157369_100269082 | 183 |
| 196 | 3300013105 | Ga0157369_10107034 | Ga0157369_101070344 | 183 |
| 197 | 3300013105 | Ga0157369_10641374 | Ga0157369_106413742 | 183 |
| 198 | 3300013105 | Ga0157369_11232378 | Ga0157369_112323781 | 183 |
| 199 | 3300013297 | Ga0157378_10411180 | Ga0157378_104111802 | 183 |
| 200 | 3300013306 | Ga0163162_10061655 | Ga0163162_100616553 | 183 |
| 201 | 3300013306 | Ga0163162_11301204 | Ga0163162_113012042 | 183 |
| 202 | 3300013307 | Ga0157372_10003730 | Ga0157372_100037303 | 183 |
| 203 | 3300013307 | Ga0157372_10004718 | Ga0157372_1000471810 | 183 |
| 204 | 3300013307 | Ga0157372_10041857 | Ga0157372_100418574 | 183 |
| 205 | 3300013307 | Ga0157372_10044369 | Ga0157372_100443693 | 183 |
| 206 | 3300013307 | Ga0157372_10632973 | Ga0157372_106329732 | 183 |
| 207 | 3300013307 | Ga0157372_10697514 | Ga0157372_106975142 | 183 |
| 208 | 3300013307 | Ga0157372_10866780 | Ga0157372_108667801 | 183 |
| 209 | 3300013308 | Ga0157375_10021987 | Ga0157375_100219872 | 183 |
| 210 | 3300013308 | Ga0157375_10168924 | Ga0157375_101689242 | 183 |
| 211 | 3300014326 | Ga0157380_10003024 | Ga0157380_1000302410 | 183 |
| 212 | 3300014497 | Ga0182008_10011300 | Ga0182008_100113005 | 183 |
| 213 | 3300014969 | Ga0157376_10896569 | Ga0157376_108965692 | 183 |
| 214 | 3300015262 | Ga0182007_10155597 | Ga0182007_101555971 | 183 |
| 215 | 3300020081 | Ga0206354_11609563 | Ga0206354_116095632 | 183 |
| 216 | 3300025893 | Ga0207682_10021720 | Ga0207682_100217204 | 183 |
| 217 | 3300025899 | Ga0207642_10096528 | Ga0207642_100965282 | 183 |
| 218 | 3300025904 | Ga0207647_10058030 | Ga0207647_100580302 | 183 |
| 219 | 3300025906 | Ga0207699_10004999 | Ga0207699_100049997 | 183 |
| 220 | 3300025906 | Ga0207699_10063828 | Ga0207699_100638283 | 183 |
| 221 | 3300025906 | Ga0207699_10165210 | Ga0207699_101652102 | 183 |
| 222 | 3300025909 | Ga0207705_10004955 | Ga0207705_100049552 | 183 |
| 223 | 3300025909 | Ga0207705_10005590 | Ga0207705_100055907 | 183 |
| 224 | 3300025909 | Ga0207705_10023340 | Ga0207705_100233403 | 183 |
| 225 | 3300025909 | Ga0207705_10146772 | Ga0207705_101467722 | 183 |
| 226 | 3300025909 | Ga0207705_10152784 | Ga0207705_101527842 | 183 |
| 227 | 3300025909 | Ga0207705_10450487 | Ga0207705_104504872 | 183 |
| 228 | 3300025909 | Ga0207705_10679393 | Ga0207705_106793932 | 183 |
| 229 | 3300025912 | Ga0207707_10011009 | Ga0207707_100110094 | 183 |
| 230 | 3300025912 | Ga0207707_10034107 | Ga0207707_100341074 | 183 |
| 231 | 3300025912 | Ga0207707_10124925 | Ga0207707_101249252 | 183 |
| 232 | 3300025912 | Ga0207707_10382290 | Ga0207707_103822901 | 183 |
| 233 | 3300025912 | Ga0207707_10435151 | Ga0207707_104351512 | 183 |
| 234 | 3300025913 | Ga0207695_10038501 | Ga0207695_100385014 | 183 |
| 235 | 3300025915 | Ga0207693_10018146 | Ga0207693_100181464 | 183 |
| 236 | 3300025915 | Ga0207693_10029954 | Ga0207693_100299543 | 183 |
| 237 | 3300025917 | Ga0207660_10014023 | Ga0207660_100140233 | 183 |
| 238 | 3300025917 | Ga0207660_10017761 | Ga0207660_100177614 | 183 |
| 239 | 3300025917 | Ga0207660_10092757 | Ga0207660_100927572 | 183 |
| 240 | 3300025917 | Ga0207660_10183355 | Ga0207660_101833552 | 183 |
| 241 | 3300025917 | Ga0207660_10753411 | Ga0207660_107534112 | 183 |
| 242 | 3300025919 | Ga0207657_10000690 | Ga0207657_1000069023 | 183 |
| 243 | 3300025919 | Ga0207657_10012848 | Ga0207657_100128483 | 183 |
| 244 | 3300025919 | Ga0207657_10109280 | Ga0207657_101092802 | 183 |
| 245 | 3300025920 | Ga0207649_10061369 | Ga0207649_100613692 | 183 |
| 246 | 3300025920 | Ga0207649_10197713 | Ga0207649_101977132 | 183 |
| 247 | 3300025921 | Ga0207652_10009462 | Ga0207652_100094627 | 183 |
| 248 | 3300025921 | Ga0207652_10035504 | Ga0207652_100355042 | 183 |
| 249 | 3300025921 | Ga0207652_10177548 | Ga0207652_101775482 | 183 |
| 250 | 3300025921 | Ga0207652_10376769 | Ga0207652_103767692 | 183 |
| 251 | 3300025921 | Ga0207652_10427163 | Ga0207652_104271633 | 183 |
| 252 | 3300025921 | Ga0207652_10471558 | Ga0207652_104715581 | 183 |
| 253 | 3300025923 | Ga0207681_10000870 | Ga0207681_1000087012 | 183 |
| 254 | 3300025923 | Ga0207681_10030023 | Ga0207681_100300232 | 183 |
| 255 | 3300025924 | Ga0207694_10003117 | Ga0207694_100031174 | 183 |
| 256 | 3300025924 | Ga0207694_10202406 | Ga0207694_102024062 | 183 |
| 257 | 3300025926 | Ga0207659_10056666 | Ga0207659_100566662 | 183 |
| 258 | 3300025926 | Ga0207659_10192276 | Ga0207659_101922762 | 183 |
| 259 | 3300025928 | Ga0207700_10010549 | Ga0207700_100105493 | 183 |
| 260 | 3300025928 | Ga0207700_10041101 | Ga0207700_100411012 | 183 |
| 261 | 3300025929 | Ga0207664_10033654 | Ga0207664_100336545 | 183 |
| 262 | 3300025929 | Ga0207664_10051023 | Ga0207664_100510233 | 183 |
| 263 | 3300025931 | Ga0207644_10063231 | Ga0207644_100632312 | 183 |
| 264 | 3300025931 | Ga0207644_10732218 | Ga0207644_107322181 | 183 |
| 265 | 3300025932 | Ga0207690_10041658 | Ga0207690_100416581 | 183 |
| 266 | 3300025932 | Ga0207690_10141719 | Ga0207690_101417193 | 183 |
| 267 | 3300025932 | Ga0207690_10229580 | Ga0207690_102295802 | 183 |
| 268 | 3300025933 | Ga0207706_10033441 | Ga0207706_100334415 | 183 |
| 269 | 3300025933 | Ga0207706_10085763 | Ga0207706_100857632 | 183 |
| 270 | 3300025933 | Ga0207706_10224462 | Ga0207706_102244621 | 183 |
| 271 | 3300025934 | Ga0207686_10092675 | Ga0207686_100926753 | 183 |
| 272 | 3300025934 | Ga0207686_10137973 | Ga0207686_101379732 | 183 |
| 273 | 3300025937 | Ga0207669_10083036 | Ga0207669_100830362 | 183 |
| 274 | 3300025937 | Ga0207669_10371257 | Ga0207669_103712572 | 183 |
| 275 | 3300025938 | Ga0207704_10001732 | Ga0207704_100017322 | 183 |
| 276 | 3300025938 | Ga0207704_10286623 | Ga0207704_102866232 | 183 |
| 277 | 3300025940 | Ga0207691_10005458 | Ga0207691_1000545810 | 183 |
| 278 | 3300025940 | Ga0207691_10016782 | Ga0207691_100167821 | 183 |
| 279 | 3300025941 | Ga0207711_10085171 | Ga0207711_100851712 | 183 |
| 280 | 3300025944 | Ga0207661_10012679 | Ga0207661_100126796 | 183 |
| 281 | 3300025944 | Ga0207661_10140019 | Ga0207661_101400192 | 183 |
| 282 | 3300025945 | Ga0207679_10011107 | Ga0207679_100111074 | 183 |
| 283 | 3300025945 | Ga0207679_10198625 | Ga0207679_101986252 | 183 |
| 284 | 3300025945 | Ga0207679_10604553 | Ga0207679_106045532 | 183 |
| 285 | 3300025949 | Ga0207667_10428949 | Ga0207667_104289492 | 183 |
| 286 | 3300025949 | Ga0207667_10907016 | Ga0207667_109070161 | 183 |
| 287 | 3300025961 | Ga0207712_10001107 | Ga0207712_1000110718 | 183 |
| 288 | 3300025986 | Ga0207658_10063649 | Ga0207658_100636492 | 183 |
| 289 | 3300026035 | Ga0207703_10188771 | Ga0207703_101887712 | 183 |
| 290 | 3300026041 | Ga0207639_10054682 | Ga0207639_100546822 | 183 |
| 291 | 3300026041 | Ga0207639_10058703 | Ga0207639_100587032 | 183 |
| 292 | 3300026041 | Ga0207639_10637955 | Ga0207639_106379551 | 183 |
| 293 | 3300026041 | Ga0207639_11183766 | Ga0207639_111837661 | 183 |
| 294 | 3300026067 | Ga0207678_10309065 | Ga0207678_103090652 | 183 |
| 295 | 3300026078 | Ga0207702_11057274 | Ga0207702_110572742 | 183 |
| 296 | 3300026088 | Ga0207641_10330082 | Ga0207641_103300822 | 183 |
| 297 | 3300026089 | Ga0207648_10020671 | Ga0207648_100206714 | 183 |
| 298 | 3300026089 | Ga0207648_10114102 | Ga0207648_101141022 | 183 |
| 299 | 3300026095 | Ga0207676_10056914 | Ga0207676_100569145 | 183 |
| 300 | 3300026095 | Ga0207676_10261081 | Ga0207676_102610812 | 183 |
| 301 | 3300026095 | Ga0207676_10520184 | Ga0207676_105201842 | 183 |
| 302 | 3300026116 | Ga0207674_10006313 | Ga0207674_100063136 | 183 |
| 303 | 3300026116 | Ga0207674_10187953 | Ga0207674_101879532 | 183 |
| 304 | 3300026121 | Ga0207683_10410562 | Ga0207683_104105622 | 183 |
| 305 | 3300026142 | Ga0207698_10053335 | Ga0207698_100533352 | 183 |
| 306 | 3300026142 | Ga0207698_10126393 | Ga0207698_101263931 | 183 |
| 307 | 3300028379 | Ga0268266_10031484 | Ga0268266_100314842 | 183 |
| 308 | 3300028380 | Ga0268265_10004069 | Ga0268265_1000406912 | 183 |
| 309 | 3300028380 | Ga0268265_11444373 | Ga0268265_114443731 | 183 |
| 310 | 3300028381 | Ga0268264_10084341 | Ga0268264_100843412 | 183 |
| 311 | 3300031238 | Ga0265332_10147274 | Ga0265332_101472742 | 183 |
| 312 | 3300031548 | Ga0307408_100964948 | Ga0307408_1009649481 | 183 |
| 313 | 3300031711 | Ga0265314_10008723 | Ga0265314_100087238 | 183 |
| 314 | 3300031852 | Ga0307410_10186127 | Ga0307410_101861271 | 183 |
| 315 | 3300031901 | Ga0307406_10852316 | Ga0307406_108523161 | 183 |
| 316 | 3300031903 | Ga0307407_10230399 | Ga0307407_102303991 | 183 |
| 317 | 3300031911 | Ga0307412_10251351 | Ga0307412_102513512 | 183 |
| 318 | 3300031911 | Ga0307412_10850714 | Ga0307412_108507141 | 183 |
| 319 | 3300031995 | Ga0307409_100594887 | Ga0307409_1005948872 | 183 |
| 320 | 3300031995 | Ga0307409_101382539 | Ga0307409_1013825392 | 183 |
| 321 | 3300032002 | Ga0307416_100264307 | Ga0307416_1002643072 | 183 |
| 322 | 3300032002 | Ga0307416_100553737 | Ga0307416_1005537372 | 183 |
| 323 | 3300032002 | Ga0307416_100696280 | Ga0307416_1006962802 | 183 |
| 324 | 3300032005 | Ga0307411_10455770 | Ga0307411_104557702 | 183 |
| 325 | 3300032005 | Ga0307411_10671796 | Ga0307411_106717962 | 183 |
| 326 | 3300032126 | Ga0307415_100035301 | Ga0307415_1000353014 | 183 |
| 327 | 3300035086 | Ga0373934_0000246 | Ga0373934_0000246_14220_14789 | 183 |
| 328 | 3300035111 | Ga0373923_0022710 | Ga0373923_0022710_878_1447 | 183 |
| 329 | 3300035113 | Ga0373936_0129614 | Ga0373936_0129614_474_1043 | 183 |
| 330 | 3300035116 | Ga0373945_0004315 | Ga0373945_0004315_3131_3694 | 183 |
| 331 | 3300035119 | Ga0373956_0001027 | Ga0373956_0001027_5054_5623 | 183 |
| 332 | 3300035170 | Ga0373943_0008063 | Ga0373943_0008063_4045_4608 | 183 |
| 333 | 3300035410 | Ga0373924_0007337 | Ga0373924_0007337_2523_3092 | 183 |
| 334 | 3300035692 | Ga0373935_0007945 | Ga0373935_0007945_733_1296 | 183 |
| 335 | 3300035695 | Ga0373927_0018614 | Ga0373927_0018614_3931_4494 | 183 |
| 336 | 3300035724 | Ga0373933_0005341 | Ga0373933_0005341_5231_5800 | 183 |
| 337 | 3300036401 | Ga0373937_0001671 | Ga0373937_0001671_8019_8588 | 183 |
| 338 | 3300037068 | Ga0373925_0000385 | Ga0373925_0000385_109_672 | 183 |
| 339 | 3300037068 | Ga0373925_0343543 | Ga0373925_0343543_343_912 | 183 |
| 340 | 3300037471 | Ga0395905_1038651 | Ga0395905_1038651_149_712 | 183 |
| 341 | 3300041512 | Ga0451853_2313564 | Ga0451853_2313564_11_589 | 183 |
| 342 | 3300044842 | Ga0466957_0088368 | Ga0466957_0088368_697_1263 | 183 |
| 343 | 3300045049 | Ga0466959_0120661 | Ga0466959_0120661_394_960 | 183 |
| 344 | 3300045836 | Ga0466958_0060058 | Ga0466958_0060058_525_1091 | 183 |
| 345 | 3300045976 | Ga0466967_0066069 | Ga0466967_0066069_19_579 | 183 |
| 346 | 3300045976 | Ga0466967_0996715 | Ga0466967_0996715_63_623 | 183 |
| 347 | 3300046454 | Ga0495592_0000632 | Ga0495592_0000632_6109_6678 | 183 |
| 348 | 3300046455 | Ga0495603_0003985 | Ga0495603_0003985_8201_8764 | 183 |
| 349 | 3300046459 | Ga0495629_0012457 | Ga0495629_0012457_1464_2033 | 183 |
| 350 | 3300046459 | Ga0495629_0020898 | Ga0495629_0020898_3987_4550 | 183 |
| 351 | 3300046462 | Ga0495651_0000077 | Ga0495651_0000077_63548_64117 | 183 |
| 352 | 3300046463 | Ga0495653_0000153 | Ga0495653_0000153_12328_12897 | 183 |
| 353 | 3300046463 | Ga0495653_0277173 | Ga0495653_0277173_132_692 | 183 |
| 354 | 3300046472 | Ga0495580_0001293 | Ga0495580_0001293_3284_3847 | 183 |
| 355 | 3300046473 | Ga0495582_0176067 | Ga0495582_0176067_19_582 | 183 |
| 356 | 3300046475 | Ga0495639_0000575 | Ga0495639_0000575_5353_5916 | 183 |
| 357 | 3300046476 | Ga0495662_0124060 | Ga0495662_0124060_91_651 | 183 |
| 358 | 3300046477 | Ga0495664_0085858 | Ga0495664_0085858_45_614 | 183 |
| 359 | 3300046492 | Ga0495585_0259621 | Ga0495585_0259621_129_689 | 183 |
| 360 | 3300046511 | Ga0495608_0000166 | Ga0495608_0000166_36933_37502 | 183 |
| 361 | 3300046511 | Ga0495608_0194086 | Ga0495608_0194086_281_841 | 183 |
| 362 | 3300046516 | Ga0495628_0002032 | Ga0495628_0002032_8019_8588 | 183 |
| 363 | 3300046517 | Ga0495630_0000980 | Ga0495630_0000980_14205_14768 | 183 |
| 364 | 3300046517 | Ga0495630_0021535 | Ga0495630_0021535_2483_3052 | 183 |
| 365 | 3300046529 | Ga0495652_0002213 | Ga0495652_0002213_13831_14400 | 183 |
| 366 | 3300046529 | Ga0495652_0240568 | Ga0495652_0240568_726_1286 | 183 |
| 367 | 3300046531 | Ga0495665_0000002 | Ga0495665_0000002_104325_104888 | 183 |
| 368 | 3300046533 | Ga0495640_0084751 | Ga0495640_0084751_959_1528 | 183 |
| 369 | 3300046533 | Ga0495640_0207858 | Ga0495640_0207858_58_618 | 183 |
| 370 | 3300046535 | Ga0495586_0015017 | Ga0495586_0015017_1869_2438 | 183 |
| 371 | 3300046535 | Ga0495586_0040394 | Ga0495586_0040394_1924_2484 | 183 |
| 372 | 3300046536 | Ga0495587_0000400 | Ga0495587_0000400_14084_14653 | 183 |
| 373 | 3300046543 | Ga0495645_0000484 | Ga0495645_0000484_8092_8661 | 183 |
| 374 | 3300046543 | Ga0495645_0182682 | Ga0495645_0182682_55_612 | 183 |
| 375 | 3300046559 | Ga0495667_0000489 | Ga0495667_0000489_18582_19151 | 183 |
| 376 | 3300046559 | Ga0495667_0095779 | Ga0495667_0095779_1280_1840 | 183 |
| 377 | 3300046663 | Ga0495635_0000048 | Ga0495635_0000048_56187_56756 | 183 |
| 378 | 3300046663 | Ga0495635_0141357 | Ga0495635_0141357_991_1551 | 183 |
| 379 | 3300046674 | Ga0495588_0000817 | Ga0495588_0000817_7872_8435 | 183 |
| 380 | 3300046675 | Ga0495657_0000318 | Ga0495657_0000318_12328_12897 | 183 |
| 381 | 3300046675 | Ga0495657_0119120 | Ga0495657_0119120_87_647 | 183 |
| 382 | 3300046678 | Ga0495599_0002246 | Ga0495599_0002246_8019_8588 | 183 |
| 383 | 3300046678 | Ga0495599_0238787 | Ga0495599_0238787_477_1034 | 183 |
| 384 | 3300046679 | Ga0495623_0000110 | Ga0495623_0000110_11896_12465 | 183 |
| 385 | 3300046680 | Ga0495646_0002674 | Ga0495646_0002674_8019_8588 | 183 |
| 386 | 3300046683 | Ga0495658_0000017 | Ga0495658_0000017_60_623 | 183 |
| 387 | 3300046689 | Ga0495613_0009269 | Ga0495613_0009269_6685_7248 | 183 |
| 388 | 3300046809 | Ga0495600_0000273 | Ga0495600_0000273_4927_5496 | 183 |
| 389 | 3300046809 | Ga0495600_0209649 | Ga0495600_0209649_646_1206 | 183 |
| 390 | 3300047315 | Ga0495581_0000727 | Ga0495581_0000727_81_644 | 183 |
| 391 | 3300047315 | Ga0495581_0035752 | Ga0495581_0035752_736_1305 | 183 |
| 392 | 3300047315 | Ga0495581_0321028 | Ga0495581_0321028_334_894 | 183 |
| 393 | 3300047317 | Ga0495604_0000017 | Ga0495604_0000017_23647_24216 | 183 |
| 394 | 3300047317 | Ga0495604_0066128 | Ga0495604_0066128_2146_2706 | 183 |
| 395 | 3300047319 | Ga0495674_0024600 | Ga0495674_0024600_3127_3696 | 183 |
| 396 | 3300047319 | Ga0495674_0090221 | Ga0495674_0090221_73_633 | 183 |
| 397 | 3300047322 | Ga0495680_0015843 | Ga0495680_0015843_1008_1577 | 183 |
| 398 | 3300047322 | Ga0495680_0179977 | Ga0495680_0179977_818_1378 | 183 |
| 399 | 3300047444 | Ga0495675_0000800 | Ga0495675_0000800_18206_18775 | 183 |
| 400 | 3300047471 | Ga0495684_0000785 | Ga0495684_0000785_2420_2989 | 183 |
| 401 | 3300047673 | Ga0495593_0104721 | Ga0495593_0104721_765_1328 | 183 |
| 402 | 3300047673 | Ga0495593_0118489 | Ga0495593_0118489_532_1101 | 183 |
| 403 | 3300048088 | Ga0495602_0007248 | Ga0495602_0007248_3149_3718 | 183 |
| 404 | 3300048088 | Ga0495602_0028785 | Ga0495602_0028785_26_586 | 183 |
| 405 | 3300048089 | Ga0495614_0000005 | Ga0495614_0000005_71_634 | 183 |
| 406 | 3300048903 | Ga0496100_0365956 | Ga0496100_0365956_472_1035 | 183 |
| 407 | 3300048907 | Ga0496104_0118557 | Ga0496104_0118557_849_1412 | 183 |
| 408 | 3300048907 | Ga0496104_0197845 | Ga0496104_0197845_612_1175 | 183 |
| 409 | 3300048911 | Ga0496108_0938143 | Ga0496108_0938143_74_637 | 183 |
| 410 | 3300048913 | Ga0496110_1272222 | Ga0496110_1272222_17_580 | 183 |
| 411 | 3300048915 | Ga0496112_0038996 | Ga0496112_0038996_3911_4474 | 183 |
| 412 | 3300048915 | Ga0496112_0201749 | Ga0496112_0201749_448_1011 | 183 |
| 413 | 3300048916 | Ga0496113_0049369 | Ga0496113_0049369_1217_1780 | 183 |
| 414 | 3300049569 | Ga0501032_0510260 | Ga0501032_0510260_71_628 | 183 |
| 415 | 3300049572 | Ga0501036_0284851 | Ga0501036_0284851_142_693 | 183 |
| 416 | 3300049573 | Ga0501037_0352625 | Ga0501037_0352625_29_580 | 183 |
| 417 | 3300049574 | Ga0501038_0046096 | Ga0501038_0046096_3159_3710 | 183 |
| 418 | 3300049579 | Ga0501043_0055146 | Ga0501043_0055146_2418_2969 | 183 |
| 419 | 3300049581 | Ga0501047_0013386 | Ga0501047_0013386_5203_5754 | 183 |
| 420 | 3300049586 | Ga0501070_0039373 | Ga0501070_0039373_3234_3785 | 183 |
| 421 | 3300049654 | Ga0501207_048338 | Ga0501207_048338_105_665 | 183 |
| 422 | 3300049822 | Ga0501035_0105817 | Ga0501035_0105817_1568_2119 | 183 |
| 423 | 3300050507 | nmdc:mga05p37_407334_c1 | nmdc:mga05p37_407334_c1_924_1484 | 183 |
| 424 | 3300050507 | nmdc:mga05p37_42957_c1 | nmdc:mga05p37_42957_c1_2199_2759 | 183 |
| 425 | 3300050508 | nmdc:mga09592_9336_c1 | nmdc:mga09592_9336_c1_4905_5465 | 183 |
| 426 | 3300050509 | nmdc:mga0qj67_15827_c1 | nmdc:mga0qj67_15827_c1_4969_5529 | 183 |
| 427 | 3300050509 | nmdc:mga0qj67_26080_c1 | nmdc:mga0qj67_26080_c1_663_1223 | 183 |
| 428 | 3300050510 | nmdc:mga06r32_201686_c1 | nmdc:mga06r32_201686_c1_1183_1743 | 183 |
| 429 | 3300050510 | nmdc:mga06r32_282157_c1 | nmdc:mga06r32_282157_c1_510_1070 | 183 |
| 430 | 3300050510 | nmdc:mga06r32_463599_c1 | nmdc:mga06r32_463599_c1_49_609 | 183 |
| 431 | 3300050511 | nmdc:mga08y16_41772_c1 | nmdc:mga08y16_41772_c1_74_634 | 183 |
| 432 | 3300050512 | nmdc:mga0n895_723038_c1 | nmdc:mga0n895_723038_c1_345_905 | 183 |
| 433 | 3300050515 | nmdc:mga0a205_184739_c1 | nmdc:mga0a205_184739_c1_181_741 | 183 |
| 434 | 3300053077 | Ga0495601_0004220 | Ga0495601_0004220_160_729 | 183 |
| 435 | 3300053078 | Ga0495612_0002385 | Ga0495612_0002385_4234_4803 | 183 |
| 436 | 3300053084 | Ga0495595_0022200 | Ga0495595_0022200_504_1073 | 183 |
| 437 | 3300053085 | Ga0495619_0006054 | Ga0495619_0006054_199_768 | 183 |
| 438 | 3300059421 | Ga0590071_022508 | Ga0590071_022508_365_925 | 183 |
| 439 | 3300059424 | Ga0590075_024906 | Ga0590075_024906_906_1466 | 183 |
| 440 | 3300059426 | Ga0590077_083922 | Ga0590077_083922_140_700 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oso-assembly1.cif.gz_A | crystal structure of a vinyl-4-reductase family protein (mj_1460) from methanocaldococcus jannaschii dsm at 1.90 a resolution | 0.8386 | 37 | 157 |
| 7b70-assembly1.cif.gz_A | trappcore plus c8 (355-596) and c11 (1-718) from minitrappiii | 0.768 | 15 | 158 |
| 7vqf-assembly1.cif.gz_A | phenol binding protein, mopr | 0.7535 | 10 | 159 |
| 7e2d-assembly1.cif.gz_C | monomer of trappii (closed) | 0.7527 | 13 | 158 |
| 6aq3-assembly1.cif.gz_A | crystal structure of a trafficking protein particle complex subunit 3 from naegleria fowleri covalently bound to palmitic acid | 0.7492 | 15 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2osdA00 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.8449 | 74 | 159 | 3.30.1380.20 |
| af_Q3UQ05_61_243_3.15.10.10 | Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 | 0.8143 | 88 | 102 | 3.15.10.10 |
| af_Q58265_65_225_3.30.1380.20 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.8027 | 18 | 160 | 3.30.1380.20 |
| af_Q58155_28_181_3.30.1380.20 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.7814 | 11 | 160 | 3.30.1380.20 |
| af_Q58149_3_150_3.30.1380.20 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.7531 | 10 | 157 | 3.30.1380.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5TR62-F1-model_v4 | 4-vinyl reductase 4VR domain-containing protein | 0.9853 | 1 | 182 |
|
| AF-A0A2V7T0X8-F1-model_v4 | 4-vinyl reductase 4VR domain-containing protein | 0.9788 | 1 | 182 |
|
| AF-A0A7Y5TR62-F1-model_v4 | 4-vinyl reductase 4VR domain-containing protein | 0.9747 | 1 | 182 |
|
| AF-A0A2V7T0X8-F1-model_v4 | 4-vinyl reductase 4VR domain-containing protein | 0.9683 | 1 | 182 |
|
| AF-A0A7V9PI20-F1-model_v4 | 4-vinyl reductase 4VR domain-containing protein | 0.9617 | 1 | 181 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar