F444442

General Info

Members Datasets Scaffolds Average Seq Length
440 234 440 186

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10030023|Ga0207681_100300232
Length 217
Sequence MRRSCAGRQAQRRRGRDALAPEPSTGEHYAMSEMTLDLAGNGLLAVTKDALAALRYALMRDTGHAAAAYFQEAGYAGGAALFDAFRGWLDERDALSPESLPLDEFQRLAAEFFRETGWGSLSIGTLHDTVATLDSPDWGEATPDAGMEHPCCHLSAGMFADFFGRVANAPLAVMEVECRSTGAERCRFLLGSAEVMQAVYDGMSQGQGYDEAVSGAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002792 3300005327 Bacteria 14509
2 Ga0070658_10064942 3300005327 Bacteria 2978
3 Ga0070658_10069880 3300005327 Unclassified 2874
4 Ga0070658_10410392 3300005327 Bacteria 1164
5 Ga0070658_11128100 3300005327 Bacteria 682
6 Ga0070676_10036064 3300005328 Unclassified 2847
7 Ga0070676_10340440 3300005328 Bacteria 1028
8 Ga0070676_10420923 3300005328 Unclassified 933
9 Ga0070676_10667461 3300005328 Unclassified 756
10 Ga0070683_100017629 3300005329 Bacteria 6310
11 Ga0070683_100027619 3300005329 Bacteria 5120
12 Ga0070683_100440596 3300005329 Bacteria 1243
13 Ga0070670_100005240 3300005331 Bacteria 10915
14 Ga0070680_100016153 3300005336 Bacteria 5869
15 Ga0070680_100039944 3300005336 Bacteria 3796
16 Ga0068868_100103179 3300005338 Unclassified 2310
17 Ga0068868_100160775 3300005338 Bacteria 1855
18 Ga0070660_100002933 3300005339 Bacteria 11738
19 Ga0070660_100087392 3300005339 Bacteria 2454
20 Ga0070691_10000572 3300005341 Bacteria 14054
21 Ga0070661_100014869 3300005344 Bacteria 5490
22 Ga0070661_100126040 3300005344 Bacteria 1921
23 Ga0070661_100204993 3300005344 Archaea 1508
24 Ga0070668_100026230 3300005347 Bacteria 4420
25 Ga0070669_100007145 3300005353 Bacteria 8025
26 Ga0070675_100001511 3300005354 Bacteria 17176
27 Ga0070671_100069223 3300005355 Bacteria 2943
28 Ga0070671_100129325 3300005355 Bacteria 2127
29 Ga0070674_100049933 3300005356 Unclassified 2879
30 Ga0070674_100057334 3300005356 Bacteria 2704
31 Ga0070674_100421627 3300005356 Bacteria 1095
32 Ga0070674_100576202 3300005356 Bacteria 948
33 Ga0070673_100305741 3300005364 Bacteria 1401
34 Ga0070673_100696368 3300005364 Bacteria 933
35 Ga0070673_101185715 3300005364 Bacteria 715
36 Ga0070688_100440273 3300005365 Bacteria 972
37 Ga0070659_100082140 3300005366 Bacteria 2574
38 Ga0070659_100098699 3300005366 Bacteria 2349
39 Ga0070659_100171168 3300005366 Archaea 1779
40 Ga0070714_100023611 3300005435 Bacteria 5055
41 Ga0070714_100025909 3300005435 Bacteria 4843
42 Ga0070714_100181790 3300005435 Bacteria 1914
43 Ga0070714_100246859 3300005435 Unclassified 1649
44 Ga0070713_100004084 3300005436 Bacteria 9723
45 Ga0070713_100166626 3300005436 Unclassified 1970
46 Ga0070713_100840455 3300005436 Bacteria 881
47 Ga0070710_10194801 3300005437 Bacteria 1276
48 Ga0070678_100283375 3300005456 Bacteria 1402
49 Ga0070678_100401493 3300005456 Unclassified 1191
50 Ga0070662_100083023 3300005457 Bacteria 2391
51 Ga0070662_100177858 3300005457 Bacteria 1675
52 Ga0070662_100199273 3300005457 Bacteria 1587
53 Ga0070681_10019316 3300005458 Bacteria 6820
54 Ga0068867_100006965 3300005459 Bacteria 7993
55 Ga0068867_100048370 3300005459 Bacteria 3128
56 Ga0068867_100060017 3300005459 Bacteria 2820
57 Ga0070698_100114663 3300005471 Bacteria 2659
58 Ga0070699_100630436 3300005518 Bacteria 978
59 Ga0070679_100003639 3300005530 Bacteria 14101
60 Ga0070679_100028836 3300005530 Bacteria 5475
61 Ga0070679_100142480 3300005530 Bacteria 2376
62 Ga0070679_100351680 3300005530 Unclassified 1421
63 Ga0070679_100364473 3300005530 Bacteria 1392
64 Ga0070679_100422041 3300005530 Unclassified 1279
65 Ga0070679_100436822 3300005530 Bacteria 1254
66 Ga0070684_100114705 3300005535 Bacteria 2419
67 Ga0070684_100165754 3300005535 Bacteria 2005
68 Ga0070684_100267250 3300005535 Bacteria 1565
69 Ga0070684_100352450 3300005535 Bacteria 1354
70 Ga0070684_100355395 3300005535 Bacteria 1348
71 Ga0068853_100069801 3300005539 Bacteria 3057
72 Ga0068853_100266524 3300005539 Bacteria 1576
73 Ga0068853_100972724 3300005539 Bacteria 817
74 Ga0070672_100056614 3300005543 Unclassified 3076
75 Ga0070672_100085489 3300005543 Unclassified 2535
76 Ga0070672_100339207 3300005543 Unclassified 1280
77 Ga0070686_100347737 3300005544 Bacteria 1113
78 Ga0070665_100019563 3300005548 Bacteria 6797
79 Ga0068855_101412455 3300005563 Bacteria 717
80 Ga0070664_100023648 3300005564 Bacteria 5076
81 Ga0070664_100024639 3300005564 Unclassified 4980
82 Ga0070664_100989897 3300005564 Bacteria 790
83 Ga0068857_100008104 3300005577 Bacteria 9070
84 Ga0068857_100125654 3300005577 Bacteria 2311
85 Ga0068856_100728868 3300005614 Bacteria 1012
86 Ga0070702_100105405 3300005615 Bacteria 1737
87 Ga0068852_100040845 3300005616 Bacteria 3917
88 Ga0068852_100124009 3300005616 Bacteria 2369
89 Ga0068852_101275358 3300005616 Bacteria 756
90 Ga0068852_101372737 3300005616 Unclassified 728
91 Ga0068859_100402231 3300005617 Unclassified 1465
92 Ga0068864_100533055 3300005618 Unclassified 1133
93 Ga0068864_101240507 3300005618 Bacteria 745
94 Ga0068866_10013364 3300005718 Bacteria 3601
95 Ga0068858_100066521 3300005842 Bacteria 3337
96 Ga0068860_100136732 3300005843 Bacteria 2353
97 Ga0068862_100000864 3300005844 Bacteria 29658
98 Ga0070717_10074541 3300006028 Bacteria 2837
99 Ga0070717_10220403 3300006028 Bacteria 1667
100 Ga0070715_10049479 3300006163 Bacteria 1801
101 Ga0070712_100035288 3300006175 Bacteria 3395
102 Ga0097621_100813834 3300006237 Bacteria 866
103 Ga0075428_100014623 3300006844 Bacteria 8715
104 Ga0075430_100009108 3300006846 Bacteria 8386
105 Ga0075430_100032116 3300006846 Bacteria 4456
106 Ga0075431_100019180 3300006847 Bacteria 6970
107 Ga0075431_100213425 3300006847 Unclassified 1971
108 Ga0075431_100344300 3300006847 Bacteria 1500
109 Ga0075434_100223861 3300006871 Bacteria 1901
110 Ga0075429_100014668 3300006880 Bacteria 6794
111 Ga0068865_100020282 3300006881 Bacteria 4310
112 Ga0068865_100113206 3300006881 Unclassified 2005
113 Ga0075436_100253641 3300006914 Bacteria 1253
114 Ga0097620_100402259 3300006931 Unclassified 1465
115 Ga0075435_100190540 3300007076 Bacteria 1736
116 Ga0111539_10798339 3300009094 Unclassified 1099
117 Ga0114129_10009098 3300009147 Bacteria 14155
118 Ga0114129_10345736 3300009147 Bacteria 1971
119 Ga0105243_10269236 3300009148 Unclassified 1529
120 Ga0105243_10999592 3300009148 Bacteria 839
121 Ga0105242_10063690 3300009176 Bacteria 3037
122 Ga0105242_10797608 3300009176 Unclassified 934
123 Ga0105248_10119719 3300009177 Bacteria 2969
124 Ga0105248_10349429 3300009177 Bacteria 1665
125 Ga0105238_10266033 3300009551 Bacteria 1695
126 Ga0105238_10692696 3300009551 Unclassified 1031
127 Ga0105249_10001122 3300009553 Bacteria 23841
128 Ga0105246_10403399 3300011119 Unclassified 1136
129 Ga0157373_10035219 3300013100 Bacteria 3595
130 Ga0157373_10115342 3300013100 Bacteria 1888
131 Ga0157373_10617406 3300013100 Bacteria 790
132 Ga0157371_10166293 3300013102 Bacteria 1575
133 Ga0157370_10625256 3300013104 Unclassified 985
134 Ga0157369_10026908 3300013105 Bacteria 6378
135 Ga0157369_10107034 3300013105 Unclassified 2975
136 Ga0157369_10641374 3300013105 Unclassified 1096
137 Ga0157369_11232378 3300013105 Bacteria 763
138 Ga0157378_10411180 3300013297 Unclassified 1335
139 Ga0163162_10061655 3300013306 Bacteria 3788
140 Ga0163162_11301204 3300013306 Bacteria 826
141 Ga0157372_10003730 3300013307 Bacteria 16362
142 Ga0157372_10004718 3300013307 Bacteria 14483
143 Ga0157372_10041857 3300013307 Bacteria 5065
144 Ga0157372_10044369 3300013307 Bacteria 4926
145 Ga0157372_10632973 3300013307 Bacteria 1246
146 Ga0157372_10697514 3300013307 Bacteria 1181
147 Ga0157372_10866780 3300013307 Bacteria 1048
148 Ga0157375_10021987 3300013308 Bacteria 5863
149 Ga0157375_10168924 3300013308 Bacteria 2334
150 Ga0157380_10003024 3300014326 Bacteria 11459
151 Ga0182008_10011300 3300014497 Bacteria 4756
152 Ga0157376_10896569 3300014969 Unclassified 905
153 Ga0157376_11194801 3300014969 Bacteria 788
154 Ga0182007_10155597 3300015262 Bacteria 779
155 Ga0206354_11609563 3300020081 Bacteria 1108
156 Ga0213875_10142112 3300021388 Bacteria 1124
157 Ga0207682_10021720 3300025893 Bacteria 2526
158 Ga0207642_10096528 3300025899 Bacteria 1474
159 Ga0207647_10058030 3300025904 Bacteria 2371
160 Ga0207699_10004999 3300025906 Bacteria 6340
161 Ga0207699_10063828 3300025906 Unclassified 2226
162 Ga0207699_10165210 3300025906 Bacteria 1477
163 Ga0207645_10040627 3300025907 Bacteria 2979
164 Ga0207705_10004955 3300025909 Bacteria 9997
165 Ga0207705_10005590 3300025909 Bacteria 9398
166 Ga0207705_10023340 3300025909 Bacteria 4413
167 Ga0207705_10023862 3300025909 Bacteria 4364
168 Ga0207705_10146772 3300025909 Bacteria 1765
169 Ga0207705_10152784 3300025909 Unclassified 1730
170 Ga0207705_10450487 3300025909 Unclassified 998
171 Ga0207705_10679393 3300025909 Bacteria 801
172 Ga0207707_10011009 3300025912 Bacteria 7871
173 Ga0207707_10034107 3300025912 Bacteria 4454
174 Ga0207707_10124925 3300025912 Bacteria 2250
175 Ga0207707_10382290 3300025912 Bacteria 1210
176 Ga0207707_10435151 3300025912 Bacteria 1123
177 Ga0207695_10038501 3300025913 Bacteria 5147
178 Ga0207693_10018146 3300025915 Bacteria 5607
179 Ga0207693_10029954 3300025915 Bacteria 4295
180 Ga0207660_10014023 3300025917 Bacteria 5260
181 Ga0207660_10017761 3300025917 Bacteria 4732
182 Ga0207660_10092757 3300025917 Bacteria 2242
183 Ga0207660_10183355 3300025917 Bacteria 1627
184 Ga0207660_10753411 3300025917 Bacteria 795
185 Ga0207657_10000690 3300025919 Bacteria 35945
186 Ga0207657_10012848 3300025919 Bacteria 8239
187 Ga0207657_10109280 3300025919 Bacteria 2286
188 Ga0207649_10061369 3300025920 Bacteria 2366
189 Ga0207649_10197713 3300025920 Bacteria 1418
190 Ga0207652_10009462 3300025921 Bacteria 7834
191 Ga0207652_10035504 3300025921 Bacteria 4208
192 Ga0207652_10177548 3300025921 Bacteria 1913
193 Ga0207652_10376769 3300025921 Bacteria 1281
194 Ga0207652_10427163 3300025921 Bacteria 1195
195 Ga0207652_10471558 3300025921 Bacteria 1131
196 Ga0207681_10000870 3300025923 Bacteria 19848
197 Ga0207681_10030023 3300025923 Bacteria 3540
198 Ga0207694_10003117 3300025924 Bacteria 13255
199 Ga0207694_10202406 3300025924 Bacteria 1616
200 Ga0207659_10056666 3300025926 Unclassified 2808
201 Ga0207659_10192276 3300025926 Unclassified 1625
202 Ga0207700_10010549 3300025928 Bacteria 5838
203 Ga0207700_10041101 3300025928 Unclassified 3380
204 Ga0207664_10005409 3300025929 Bacteria 8721
205 Ga0207664_10033654 3300025929 Bacteria 3940
206 Ga0207664_10051023 3300025929 Bacteria 3265
207 Ga0207644_10063231 3300025931 Bacteria 2687
208 Ga0207644_10732218 3300025931 Unclassified 825
209 Ga0207690_10041658 3300025932 Bacteria 3011
210 Ga0207690_10108992 3300025932 Bacteria 1991
211 Ga0207690_10141719 3300025932 Archaea 1772
212 Ga0207690_10229580 3300025932 Bacteria 1424
213 Ga0207706_10033441 3300025933 Bacteria 4577
214 Ga0207706_10085763 3300025933 Bacteria 2769
215 Ga0207706_10224462 3300025933 Unclassified 1644
216 Ga0207686_10092675 3300025934 Bacteria 1998
217 Ga0207686_10137973 3300025934 Bacteria 1682
218 Ga0207669_10083036 3300025937 Bacteria 2059
219 Ga0207669_10371257 3300025937 Bacteria 1112
220 Ga0207704_10001732 3300025938 Bacteria 9772
221 Ga0207704_10286623 3300025938 Bacteria 1254
222 Ga0207691_10005458 3300025940 Bacteria 12277
223 Ga0207691_10016782 3300025940 Bacteria 6948
224 Ga0207711_10085171 3300025941 Bacteria 2769
225 Ga0207661_10012679 3300025944 Bacteria 6136
226 Ga0207661_10140019 3300025944 Bacteria 2081
227 Ga0207679_10011107 3300025945 Bacteria 5814
228 Ga0207679_10052746 3300025945 Bacteria 2984
229 Ga0207679_10198625 3300025945 Bacteria 1674
230 Ga0207679_10604553 3300025945 Bacteria 988
231 Ga0207667_10428949 3300025949 Bacteria 1345
232 Ga0207667_10907016 3300025949 Bacteria 873
233 Ga0207712_10001107 3300025961 Bacteria 18842
234 Ga0207658_10063649 3300025986 Unclassified 2765
235 Ga0207703_10188771 3300026035 Unclassified 1824
236 Ga0207639_10054682 3300026041 Bacteria 3052
237 Ga0207639_10058703 3300026041 Bacteria 2960
238 Ga0207639_10637955 3300026041 Unclassified 985
239 Ga0207639_11183766 3300026041 Bacteria 717
240 Ga0207678_10309065 3300026067 Bacteria 1359
241 Ga0207702_11057274 3300026078 Bacteria 805
242 Ga0207641_10330082 3300026088 Bacteria 1449
243 Ga0207648_10020671 3300026089 Bacteria 5926
244 Ga0207648_10114102 3300026089 Bacteria 2374
245 Ga0207676_10056914 3300026095 Bacteria 3077
246 Ga0207676_10261081 3300026095 Bacteria 1564
247 Ga0207676_10520184 3300026095 Bacteria 1133
248 Ga0207674_10006313 3300026116 Bacteria 13968
249 Ga0207674_10187953 3300026116 Bacteria 2016
250 Ga0207683_10410562 3300026121 Unclassified 1246
251 Ga0207698_10053335 3300026142 Bacteria 3103
252 Ga0207698_10126393 3300026142 Bacteria 2175
253 Ga0207698_10262610 3300026142 Bacteria 1587
254 Ga0268266_10031484 3300028379 Bacteria 4505
255 Ga0268265_10004069 3300028380 Bacteria 10277
256 Ga0268265_11444373 3300028380 Unclassified 691
257 Ga0268264_10084341 3300028381 Bacteria 2724
258 Ga0265332_10147274 3300031238 Unclassified 985
259 Ga0307408_100012902 3300031548 Bacteria 5540
260 Ga0307408_100964948 3300031548 Bacteria 784
261 Ga0265314_10008723 3300031711 Bacteria 8666
262 Ga0307405_10000162 3300031731 Bacteria 24577
263 Ga0307413_10000538 3300031824 Bacteria 12594
264 Ga0307410_10013161 3300031852 Bacteria 4815
265 Ga0307410_10186127 3300031852 Unclassified 1576
266 Ga0307406_10003650 3300031901 Bacteria 8382
267 Ga0307406_10852316 3300031901 Unclassified 773
268 Ga0307407_10001101 3300031903 Bacteria 9436
269 Ga0307407_10230399 3300031903 Bacteria 1258
270 Ga0307412_10003190 3300031911 Bacteria 9108
271 Ga0307412_10251351 3300031911 Bacteria 1373
272 Ga0307412_10850714 3300031911 Unclassified 796
273 Ga0307409_100594887 3300031995 Bacteria 1092
274 Ga0307409_101382539 3300031995 Unclassified 730
275 Ga0307416_100032752 3300032002 Bacteria 3932
276 Ga0307416_100264307 3300032002 Bacteria 1684
277 Ga0307416_100553737 3300032002 Bacteria 1224
278 Ga0307416_100696280 3300032002 Unclassified 1105
279 Ga0307414_10005259 3300032004 Bacteria 7115
280 Ga0307411_10001407 3300032005 Bacteria 9780
281 Ga0307411_10455770 3300032005 Bacteria 1071
282 Ga0307411_10671796 3300032005 Unclassified 899
283 Ga0307415_100004918 3300032126 Bacteria 7020
284 Ga0307415_100035301 3300032126 Bacteria 3265
285 Ga0373934_0000246 3300035086 Bacteria 19441
286 Ga0373923_0022710 3300035111 Bacteria 2462
287 Ga0373936_0129614 3300035113 Unclassified 1083
288 Ga0373945_0004315 3300035116 Bacteria 4518
289 Ga0373956_0001027 3300035119 Bacteria 11515
290 Ga0373943_0008063 3300035170 Bacteria 4725
291 Ga0373955_0013331 3300035172 Bacteria 3973
292 Ga0373924_0007337 3300035410 Bacteria 3978
293 Ga0373935_0007945 3300035692 Bacteria 6362
294 Ga0373927_0018614 3300035695 Bacteria 4561
295 Ga0373933_0005341 3300035724 Bacteria 7001
296 Ga0373937_0001671 3300036401 Bacteria 18648
297 Ga0373937_0914355 3300036401 Bacteria 826
298 Ga0373925_0000385 3300037068 Bacteria 45502
299 Ga0373925_0343543 3300037068 Unclassified 1211
300 Ga0395905_1038651 3300037471 Unclassified 723
301 Ga0436364_0920498 3300037853 Bacteria 3827
302 Ga0436364_1510006 3300037853 Unclassified 1224
303 Ga0451853_2313564 3300041512 Unclassified 985
304 Ga0466957_0088368 3300044842 Bacteria 1939
305 Ga0466959_0120661 3300045049 Unclassified 1864
306 Ga0451576_0203429 3300045051 Bacteria 2068
307 Ga0466958_0060058 3300045836 Bacteria 2314
308 Ga0466967_0013918 3300045976 Bacteria 6241
309 Ga0466967_0066069 3300045976 Bacteria 3222
310 Ga0466967_0996715 3300045976 Unclassified 834
311 Ga0495592_0000632 3300046454 Bacteria 24520
312 Ga0495592_0216590 3300046454 Bacteria 1283
313 Ga0495603_0003985 3300046455 Bacteria 8790
314 Ga0495603_0087846 3300046455 Bacteria 1819
315 Ga0495590_0355242 3300046457 Bacteria 557
316 Ga0495629_0012457 3300046459 Bacteria 6160
317 Ga0495629_0020898 3300046459 Bacteria 4672
318 Ga0495629_0495447 3300046459 Bacteria 824
319 Ga0495651_0000077 3300046462 Bacteria 71891
320 Ga0495653_0000153 3300046463 Bacteria 57262
321 Ga0495653_0277173 3300046463 Bacteria 1102
322 Ga0495580_0001293 3300046472 Bacteria 22086
323 Ga0495582_0174663 3300046473 Bacteria 1224
324 Ga0495582_0176067 3300046473 Unclassified 1218
325 Ga0495639_0000575 3300046475 Bacteria 17150
326 Ga0495662_0124060 3300046476 Bacteria 1268
327 Ga0495664_0085858 3300046477 Unclassified 1890
328 Ga0495585_0259621 3300046492 Bacteria 864
329 Ga0495594_0160107 3300046499 Bacteria 1280
330 Ga0495594_0257395 3300046499 Bacteria 994
331 Ga0495608_0000166 3300046511 Bacteria 46948
332 Ga0495608_0194086 3300046511 Bacteria 1281
333 Ga0495618_0363782 3300046514 Bacteria 890
334 Ga0495628_0002032 3300046516 Bacteria 18338
335 Ga0495628_0343663 3300046516 Bacteria 1098
336 Ga0495630_0000980 3300046517 Bacteria 19843
337 Ga0495630_0021535 3300046517 Bacteria 4760
338 Ga0495652_0002213 3300046529 Bacteria 20389
339 Ga0495652_0240568 3300046529 Bacteria 1347
340 Ga0495665_0000002 3300046531 Bacteria 128983
341 Ga0495665_0163725 3300046531 Bacteria 1159
342 Ga0495665_0183776 3300046531 Bacteria 1086
343 Ga0495640_0084751 3300046533 Bacteria 2101
344 Ga0495640_0207858 3300046533 Bacteria 1238
345 Ga0495586_0015017 3300046535 Bacteria 4117
346 Ga0495586_0040394 3300046535 Bacteria 2509
347 Ga0495586_0048991 3300046535 Bacteria 2284
348 Ga0495586_0151912 3300046535 Bacteria 1303
349 Ga0495587_0000400 3300046536 Bacteria 30690
350 Ga0495587_0013079 3300046536 Bacteria 5219
351 Ga0495587_0167550 3300046536 Bacteria 1248
352 Ga0495645_0000484 3300046543 Bacteria 27579
353 Ga0495645_0182362 3300046543 Bacteria 1437
354 Ga0495645_0182682 3300046543 Bacteria 1435
355 Ga0495667_0000489 3300046559 Bacteria 25253
356 Ga0495667_0095779 3300046559 Bacteria 1921
357 Ga0495667_0210096 3300046559 Bacteria 1244
358 Ga0495635_0000048 3300046663 Bacteria 79393
359 Ga0495635_0141357 3300046663 Bacteria 1639
360 Ga0495588_0000817 3300046674 Bacteria 13886
361 Ga0495657_0000318 3300046675 Bacteria 44307
362 Ga0495657_0119120 3300046675 Bacteria 1664
363 Ga0495657_0377748 3300046675 Unclassified 836
364 Ga0495599_0002246 3300046678 Bacteria 11242
365 Ga0495599_0238787 3300046678 Unclassified 1108
366 Ga0495599_0303414 3300046678 Bacteria 963
367 Ga0495623_0000110 3300046679 Bacteria 50112
368 Ga0495623_0100278 3300046679 Bacteria 1765
369 Ga0495646_0002674 3300046680 Bacteria 11030
370 Ga0495658_0000017 3300046683 Bacteria 93346
371 Ga0495613_0009269 3300046689 Bacteria 7303
372 Ga0495613_0046381 3300046689 Bacteria 3213
373 Ga0495624_0358711 3300046690 Bacteria 877
374 Ga0495600_0000273 3300046809 Bacteria 28023
375 Ga0495600_0096954 3300046809 Bacteria 1922
376 Ga0495600_0209649 3300046809 Bacteria 1249
377 Ga0495600_0564821 3300046809 Viruses 694
378 Ga0495581_0000727 3300047315 Bacteria 17418
379 Ga0495581_0035752 3300047315 Bacteria 2874
380 Ga0495581_0043946 3300047315 Bacteria 2584
381 Ga0495581_0321028 3300047315 Unclassified 905
382 Ga0495604_0000017 3300047317 Bacteria 192029
383 Ga0495604_0066128 3300047317 Bacteria 2751
384 Ga0495674_0024600 3300047319 Bacteria 5530
385 Ga0495674_0090221 3300047319 Bacteria 2619
386 Ga0495674_0093459 3300047319 Bacteria 2566
387 Ga0495680_0015843 3300047322 Bacteria 6488
388 Ga0495680_0074131 3300047322 Bacteria 2585
389 Ga0495680_0179977 3300047322 Bacteria 1526
390 Ga0495675_0000800 3300047444 Bacteria 19382
391 Ga0495684_0000785 3300047471 Bacteria 25792
392 Ga0495684_0226304 3300047471 Bacteria 1369
393 Ga0495593_0104721 3300047673 Bacteria 1448
394 Ga0495593_0118489 3300047673 Unclassified 1348
395 Ga0495602_0007248 3300048088 Bacteria 11612
396 Ga0495602_0028785 3300048088 Bacteria 5307
397 Ga0495602_0075395 3300048088 Bacteria 2863
398 Ga0495614_0000005 3300048089 Bacteria 74692
399 Ga0496100_0365956 3300048903 Bacteria 1092
400 Ga0496104_0118557 3300048907 Bacteria 2541
401 Ga0496104_0197845 3300048907 Bacteria 1922
402 Ga0496108_0938143 3300048911 Bacteria 741
403 Ga0496110_1272222 3300048913 Bacteria 645
404 Ga0496112_0038996 3300048915 Bacteria 4640
405 Ga0496112_0201749 3300048915 Bacteria 1948
406 Ga0496113_0049369 3300048916 Bacteria 3133
407 Ga0496115_0036770 3300048918 Bacteria 3878
408 Ga0501032_0510260 3300049569 Bacteria 768
409 Ga0501033_0004019 3300049570 Bacteria 11885
410 Ga0501034_0022849 3300049571 Bacteria 6372
411 Ga0501036_0012090 3300049572 Bacteria 7155
412 Ga0501036_0284851 3300049572 Bacteria 1383
413 Ga0501037_0352625 3300049573 Bacteria 1015
414 Ga0501038_0046096 3300049574 Bacteria 3781
415 Ga0501043_0055146 3300049579 Bacteria 3122
416 Ga0501047_0013386 3300049581 Bacteria 7775
417 Ga0501070_0039373 3300049586 Bacteria 3943
418 Ga0501207_048338 3300049654 Bacteria 755
419 Ga0501035_0105817 3300049822 Bacteria 2467
420 Ga0501044_0003693 3300049823 Bacteria 17206
421 nmdc:mga05p37_407334_c1 3300050507 Unclassified 1586
422 nmdc:mga05p37_42957_c1 3300050507 Bacteria 5557
423 nmdc:mga09592_9336_c1 3300050508 Bacteria 7975
424 nmdc:mga0qj67_15827_c1 3300050509 Bacteria 5712
425 nmdc:mga0qj67_26080_c1 3300050509 Bacteria 4523
426 nmdc:mga06r32_201686_c1 3300050510 Bacteria 1977
427 nmdc:mga06r32_282157_c1 3300050510 Unclassified 1648
428 nmdc:mga06r32_463599_c1 3300050510 Unclassified 1246
429 nmdc:mga08y16_41772_c1 3300050511 Bacteria 4803
430 nmdc:mga0n895_346406_c1 3300050512 Unclassified 1505
431 nmdc:mga0n895_723038_c1 3300050512 Unclassified 990
432 nmdc:mga0a205_184739_c1 3300050515 Bacteria 1978
433 nmdc:mga0a205_448110_c1 3300050515 Unclassified 1151
434 Ga0495601_0004220 3300053077 Bacteria 8292
435 Ga0495612_0002385 3300053078 Bacteria 7747
436 Ga0495595_0022200 3300053084 Bacteria 2783
437 Ga0495619_0006054 3300053085 Bacteria 7664
438 Ga0590071_022508 3300059421 Bacteria 1487
439 Ga0590075_024906 3300059424 Bacteria 1503
440 Ga0590077_083922 3300059426 Unclassified 735

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0564821 Ga0495600_0564821_27_512 157
2 3300005456 Ga0070678_100283375 Ga0070678_1002833752 161
3 3300046675 Ga0495657_0377748 Ga0495657_0377748_100_654 169
4 3300047315 Ga0495581_0043946 Ga0495581_0043946_431_985 169
5 3300046531 Ga0495665_0183776 Ga0495665_0183776_366_920 170
6 3300046535 Ga0495586_0048991 Ga0495586_0048991_412_966 170
7 3300046689 Ga0495613_0046381 Ga0495613_0046381_1354_1908 170
8 3300046809 Ga0495600_0096954 Ga0495600_0096954_1264_1818 170
9 3300005327 Ga0070658_10069880 Ga0070658_100698804 174
10 3300005336 Ga0070680_100039944 Ga0070680_1000399443 174
11 3300005364 Ga0070673_101185715 Ga0070673_1011857151 174
12 3300005530 Ga0070679_100364473 Ga0070679_1003644732 174
13 3300025929 Ga0207664_10005409 Ga0207664_100054094 174
14 3300035172 Ga0373955_0013331 Ga0373955_0013331_3418_3954 174
15 3300046455 Ga0495603_0087846 Ga0495603_0087846_920_1486 174
16 3300046457 Ga0495590_0355242 Ga0495590_0355242_16_543 174
17 3300046459 Ga0495629_0495447 Ga0495629_0495447_235_801 174
18 3300046473 Ga0495582_0174663 Ga0495582_0174663_71_637 174
19 3300046499 Ga0495594_0257395 Ga0495594_0257395_80_646 174
20 3300021388 Ga0213875_10142112 Ga0213875_101421121 175
21 3300036401 Ga0373937_0914355 Ga0373937_0914355_66_632 175
22 3300037853 Ga0436364_1510006 Ga0436364_1510006_471_1031 175
23 3300046454 Ga0495592_0216590 Ga0495592_0216590_682_1248 175
24 3300046514 Ga0495618_0363782 Ga0495618_0363782_31_591 175
25 3300046516 Ga0495628_0343663 Ga0495628_0343663_319_885 175
26 3300046531 Ga0495665_0163725 Ga0495665_0163725_113_679 175
27 3300046535 Ga0495586_0151912 Ga0495586_0151912_150_716 175
28 3300046536 Ga0495587_0013079 Ga0495587_0013079_310_864 175
29 3300046536 Ga0495587_0167550 Ga0495587_0167550_599_1165 175
30 3300046543 Ga0495645_0182362 Ga0495645_0182362_37_603 175
31 3300046559 Ga0495667_0210096 Ga0495667_0210096_271_837 175
32 3300046678 Ga0495599_0303414 Ga0495599_0303414_224_790 175
33 3300046679 Ga0495623_0100278 Ga0495623_0100278_62_628 175
34 3300046690 Ga0495624_0358711 Ga0495624_0358711_296_862 175
35 3300047319 Ga0495674_0093459 Ga0495674_0093459_66_632 175
36 3300047322 Ga0495680_0074131 Ga0495680_0074131_89_655 175
37 3300047471 Ga0495684_0226304 Ga0495684_0226304_441_1007 175
38 3300048088 Ga0495602_0075395 Ga0495602_0075395_2162_2728 175
39 3300009176 Ga0105242_10797608 Ga0105242_107976082 177
40 3300014969 Ga0157376_11194801 Ga0157376_111948011 177
41 3300025907 Ga0207645_10040627 Ga0207645_100406272 177
42 3300046499 Ga0495594_0160107 Ga0495594_0160107_222_776 180
43 3300005564 Ga0070664_100989897 Ga0070664_1009898971 181
44 3300005616 Ga0068852_101275358 Ga0068852_1012753582 181
45 3300006871 Ga0075434_100223861 Ga0075434_1002238612 181
46 3300007076 Ga0075435_100190540 Ga0075435_1001905402 181
47 3300025909 Ga0207705_10023862 Ga0207705_100238621 181
48 3300025932 Ga0207690_10108992 Ga0207690_101089921 181
49 3300025945 Ga0207679_10052746 Ga0207679_100527464 181
50 3300026142 Ga0207698_10262610 Ga0207698_102626102 181
51 3300031548 Ga0307408_100012902 Ga0307408_1000129023 181
52 3300031731 Ga0307405_10000162 Ga0307405_1000016217 181
53 3300031824 Ga0307413_10000538 Ga0307413_100005383 181
54 3300031852 Ga0307410_10013161 Ga0307410_100131612 181
55 3300031901 Ga0307406_10003650 Ga0307406_100036502 181
56 3300031903 Ga0307407_10001101 Ga0307407_100011015 181
57 3300031911 Ga0307412_10003190 Ga0307412_100031902 181
58 3300032002 Ga0307416_100032752 Ga0307416_1000327522 181
59 3300032004 Ga0307414_10005259 Ga0307414_100052595 181
60 3300032005 Ga0307411_10001407 Ga0307411_100014072 181
61 3300032126 Ga0307415_100004918 Ga0307415_1000049188 181
62 3300045051 Ga0451576_0203429 Ga0451576_0203429_39_590 181
63 3300048918 Ga0496115_0036770 Ga0496115_0036770_2499_3044 181
64 3300050512 nmdc:mga0n895_346406_c1 nmdc:mga0n895_346406_c1_210_761 181
65 3300050515 nmdc:mga0a205_448110_c1 nmdc:mga0a205_448110_c1_513_1064 181
66 3300037853 Ga0436364_0920498 Ga0436364_0920498_1044_1604 182
67 3300045976 Ga0466967_0013918 Ga0466967_0013918_2869_3447 182
68 3300049570 Ga0501033_0004019 Ga0501033_0004019_6090_6647 182
69 3300049571 Ga0501034_0022849 Ga0501034_0022849_4924_5481 182
70 3300049572 Ga0501036_0012090 Ga0501036_0012090_5724_6281 182
71 3300049823 Ga0501044_0003693 Ga0501044_0003693_6705_7262 182
72 3300005327 Ga0070658_10002792 Ga0070658_1000279212 183
73 3300005327 Ga0070658_10064942 Ga0070658_100649422 183
74 3300005327 Ga0070658_10410392 Ga0070658_104103922 183
75 3300005327 Ga0070658_11128100 Ga0070658_111281001 183
76 3300005328 Ga0070676_10036064 Ga0070676_100360642 183
77 3300005328 Ga0070676_10340440 Ga0070676_103404402 183
78 3300005328 Ga0070676_10420923 Ga0070676_104209231 183
79 3300005328 Ga0070676_10667461 Ga0070676_106674611 183
80 3300005329 Ga0070683_100017629 Ga0070683_1000176294 183
81 3300005329 Ga0070683_100027619 Ga0070683_1000276195 183
82 3300005329 Ga0070683_100440596 Ga0070683_1004405962 183
83 3300005331 Ga0070670_100005240 Ga0070670_10000524015 183
84 3300005336 Ga0070680_100016153 Ga0070680_1000161536 183
85 3300005338 Ga0068868_100103179 Ga0068868_1001031792 183
86 3300005338 Ga0068868_100160775 Ga0068868_1001607752 183
87 3300005339 Ga0070660_100002933 Ga0070660_1000029338 183
88 3300005339 Ga0070660_100087392 Ga0070660_1000873922 183
89 3300005341 Ga0070691_10000572 Ga0070691_100005728 183
90 3300005344 Ga0070661_100014869 Ga0070661_1000148692 183
91 3300005344 Ga0070661_100126040 Ga0070661_1001260401 183
92 3300005344 Ga0070661_100204993 Ga0070661_1002049932 183
93 3300005347 Ga0070668_100026230 Ga0070668_1000262302 183
94 3300005353 Ga0070669_100007145 Ga0070669_1000071452 183
95 3300005354 Ga0070675_100001511 Ga0070675_1000015117 183
96 3300005355 Ga0070671_100069223 Ga0070671_1000692234 183
97 3300005355 Ga0070671_100129325 Ga0070671_1001293253 183
98 3300005356 Ga0070674_100049933 Ga0070674_1000499333 183
99 3300005356 Ga0070674_100057334 Ga0070674_1000573342 183
100 3300005356 Ga0070674_100421627 Ga0070674_1004216272 183
101 3300005356 Ga0070674_100576202 Ga0070674_1005762021 183
102 3300005364 Ga0070673_100305741 Ga0070673_1003057411 183
103 3300005364 Ga0070673_100696368 Ga0070673_1006963682 183
104 3300005365 Ga0070688_100440273 Ga0070688_1004402732 183
105 3300005366 Ga0070659_100082140 Ga0070659_1000821403 183
106 3300005366 Ga0070659_100098699 Ga0070659_1000986992 183
107 3300005366 Ga0070659_100171168 Ga0070659_1001711683 183
108 3300005435 Ga0070714_100023611 Ga0070714_1000236112 183
109 3300005435 Ga0070714_100025909 Ga0070714_1000259094 183
110 3300005435 Ga0070714_100181790 Ga0070714_1001817902 183
111 3300005435 Ga0070714_100246859 Ga0070714_1002468592 183
112 3300005436 Ga0070713_100004084 Ga0070713_1000040847 183
113 3300005436 Ga0070713_100166626 Ga0070713_1001666262 183
114 3300005436 Ga0070713_100840455 Ga0070713_1008404552 183
115 3300005437 Ga0070710_10194801 Ga0070710_101948012 183
116 3300005456 Ga0070678_100401493 Ga0070678_1004014932 183
117 3300005457 Ga0070662_100083023 Ga0070662_1000830232 183
118 3300005457 Ga0070662_100177858 Ga0070662_1001778582 183
119 3300005457 Ga0070662_100199273 Ga0070662_1001992732 183
120 3300005458 Ga0070681_10019316 Ga0070681_100193162 183
121 3300005459 Ga0068867_100006965 Ga0068867_1000069657 183
122 3300005459 Ga0068867_100048370 Ga0068867_1000483704 183
123 3300005459 Ga0068867_100060017 Ga0068867_1000600172 183
124 3300005471 Ga0070698_100114663 Ga0070698_1001146634 183
125 3300005518 Ga0070699_100630436 Ga0070699_1006304361 183
126 3300005530 Ga0070679_100003639 Ga0070679_1000036392 183
127 3300005530 Ga0070679_100028836 Ga0070679_1000288364 183
128 3300005530 Ga0070679_100142480 Ga0070679_1001424802 183
129 3300005530 Ga0070679_100351680 Ga0070679_1003516801 183
130 3300005530 Ga0070679_100422041 Ga0070679_1004220412 183
131 3300005530 Ga0070679_100436822 Ga0070679_1004368222 183
132 3300005535 Ga0070684_100114705 Ga0070684_1001147052 183
133 3300005535 Ga0070684_100165754 Ga0070684_1001657542 183
134 3300005535 Ga0070684_100267250 Ga0070684_1002672501 183
135 3300005535 Ga0070684_100352450 Ga0070684_1003524502 183
136 3300005535 Ga0070684_100355395 Ga0070684_1003553951 183
137 3300005539 Ga0068853_100069801 Ga0068853_1000698011 183
138 3300005539 Ga0068853_100266524 Ga0068853_1002665242 183
139 3300005539 Ga0068853_100972724 Ga0068853_1009727241 183
140 3300005543 Ga0070672_100056614 Ga0070672_1000566144 183
141 3300005543 Ga0070672_100085489 Ga0070672_1000854892 183
142 3300005543 Ga0070672_100339207 Ga0070672_1003392072 183
143 3300005544 Ga0070686_100347737 Ga0070686_1003477372 183
144 3300005548 Ga0070665_100019563 Ga0070665_1000195631 183
145 3300005563 Ga0068855_101412455 Ga0068855_1014124551 183
146 3300005564 Ga0070664_100023648 Ga0070664_1000236484 183
147 3300005564 Ga0070664_100024639 Ga0070664_1000246393 183
148 3300005577 Ga0068857_100008104 Ga0068857_10000810412 183
149 3300005577 Ga0068857_100125654 Ga0068857_1001256542 183
150 3300005614 Ga0068856_100728868 Ga0068856_1007288682 183
151 3300005615 Ga0070702_100105405 Ga0070702_1001054051 183
152 3300005616 Ga0068852_100040845 Ga0068852_1000408452 183
153 3300005616 Ga0068852_100124009 Ga0068852_1001240092 183
154 3300005616 Ga0068852_101372737 Ga0068852_1013727372 183
155 3300005617 Ga0068859_100402231 Ga0068859_1004022312 183
156 3300005618 Ga0068864_100533055 Ga0068864_1005330551 183
157 3300005618 Ga0068864_101240507 Ga0068864_1012405071 183
158 3300005718 Ga0068866_10013364 Ga0068866_100133645 183
159 3300005842 Ga0068858_100066521 Ga0068858_1000665213 183
160 3300005843 Ga0068860_100136732 Ga0068860_1001367321 183
161 3300005844 Ga0068862_100000864 Ga0068862_10000086415 183
162 3300006028 Ga0070717_10074541 Ga0070717_100745412 183
163 3300006028 Ga0070717_10220403 Ga0070717_102204032 183
164 3300006163 Ga0070715_10049479 Ga0070715_100494792 183
165 3300006175 Ga0070712_100035288 Ga0070712_1000352883 183
166 3300006237 Ga0097621_100813834 Ga0097621_1008138342 183
167 3300006844 Ga0075428_100014623 Ga0075428_1000146236 183
168 3300006846 Ga0075430_100009108 Ga0075430_1000091086 183
169 3300006846 Ga0075430_100032116 Ga0075430_1000321162 183
170 3300006847 Ga0075431_100019180 Ga0075431_1000191805 183
171 3300006847 Ga0075431_100213425 Ga0075431_1002134253 183
172 3300006847 Ga0075431_100344300 Ga0075431_1003443002 183
173 3300006880 Ga0075429_100014668 Ga0075429_1000146685 183
174 3300006881 Ga0068865_100020282 Ga0068865_1000202826 183
175 3300006881 Ga0068865_100113206 Ga0068865_1001132063 183
176 3300006914 Ga0075436_100253641 Ga0075436_1002536412 183
177 3300006931 Ga0097620_100402259 Ga0097620_1004022592 183
178 3300009094 Ga0111539_10798339 Ga0111539_107983391 183
179 3300009147 Ga0114129_10009098 Ga0114129_1000909813 183
180 3300009147 Ga0114129_10345736 Ga0114129_103457363 183
181 3300009148 Ga0105243_10269236 Ga0105243_102692362 183
182 3300009148 Ga0105243_10999592 Ga0105243_109995922 183
183 3300009176 Ga0105242_10063690 Ga0105242_100636904 183
184 3300009177 Ga0105248_10119719 Ga0105248_101197193 183
185 3300009177 Ga0105248_10349429 Ga0105248_103494292 183
186 3300009551 Ga0105238_10266033 Ga0105238_102660331 183
187 3300009551 Ga0105238_10692696 Ga0105238_106926962 183
188 3300009553 Ga0105249_10001122 Ga0105249_100011227 183
189 3300011119 Ga0105246_10403399 Ga0105246_104033992 183
190 3300013100 Ga0157373_10035219 Ga0157373_100352195 183
191 3300013100 Ga0157373_10115342 Ga0157373_101153422 183
192 3300013100 Ga0157373_10617406 Ga0157373_106174061 183
193 3300013102 Ga0157371_10166293 Ga0157371_101662932 183
194 3300013104 Ga0157370_10625256 Ga0157370_106252562 183
195 3300013105 Ga0157369_10026908 Ga0157369_100269082 183
196 3300013105 Ga0157369_10107034 Ga0157369_101070344 183
197 3300013105 Ga0157369_10641374 Ga0157369_106413742 183
198 3300013105 Ga0157369_11232378 Ga0157369_112323781 183
199 3300013297 Ga0157378_10411180 Ga0157378_104111802 183
200 3300013306 Ga0163162_10061655 Ga0163162_100616553 183
201 3300013306 Ga0163162_11301204 Ga0163162_113012042 183
202 3300013307 Ga0157372_10003730 Ga0157372_100037303 183
203 3300013307 Ga0157372_10004718 Ga0157372_1000471810 183
204 3300013307 Ga0157372_10041857 Ga0157372_100418574 183
205 3300013307 Ga0157372_10044369 Ga0157372_100443693 183
206 3300013307 Ga0157372_10632973 Ga0157372_106329732 183
207 3300013307 Ga0157372_10697514 Ga0157372_106975142 183
208 3300013307 Ga0157372_10866780 Ga0157372_108667801 183
209 3300013308 Ga0157375_10021987 Ga0157375_100219872 183
210 3300013308 Ga0157375_10168924 Ga0157375_101689242 183
211 3300014326 Ga0157380_10003024 Ga0157380_1000302410 183
212 3300014497 Ga0182008_10011300 Ga0182008_100113005 183
213 3300014969 Ga0157376_10896569 Ga0157376_108965692 183
214 3300015262 Ga0182007_10155597 Ga0182007_101555971 183
215 3300020081 Ga0206354_11609563 Ga0206354_116095632 183
216 3300025893 Ga0207682_10021720 Ga0207682_100217204 183
217 3300025899 Ga0207642_10096528 Ga0207642_100965282 183
218 3300025904 Ga0207647_10058030 Ga0207647_100580302 183
219 3300025906 Ga0207699_10004999 Ga0207699_100049997 183
220 3300025906 Ga0207699_10063828 Ga0207699_100638283 183
221 3300025906 Ga0207699_10165210 Ga0207699_101652102 183
222 3300025909 Ga0207705_10004955 Ga0207705_100049552 183
223 3300025909 Ga0207705_10005590 Ga0207705_100055907 183
224 3300025909 Ga0207705_10023340 Ga0207705_100233403 183
225 3300025909 Ga0207705_10146772 Ga0207705_101467722 183
226 3300025909 Ga0207705_10152784 Ga0207705_101527842 183
227 3300025909 Ga0207705_10450487 Ga0207705_104504872 183
228 3300025909 Ga0207705_10679393 Ga0207705_106793932 183
229 3300025912 Ga0207707_10011009 Ga0207707_100110094 183
230 3300025912 Ga0207707_10034107 Ga0207707_100341074 183
231 3300025912 Ga0207707_10124925 Ga0207707_101249252 183
232 3300025912 Ga0207707_10382290 Ga0207707_103822901 183
233 3300025912 Ga0207707_10435151 Ga0207707_104351512 183
234 3300025913 Ga0207695_10038501 Ga0207695_100385014 183
235 3300025915 Ga0207693_10018146 Ga0207693_100181464 183
236 3300025915 Ga0207693_10029954 Ga0207693_100299543 183
237 3300025917 Ga0207660_10014023 Ga0207660_100140233 183
238 3300025917 Ga0207660_10017761 Ga0207660_100177614 183
239 3300025917 Ga0207660_10092757 Ga0207660_100927572 183
240 3300025917 Ga0207660_10183355 Ga0207660_101833552 183
241 3300025917 Ga0207660_10753411 Ga0207660_107534112 183
242 3300025919 Ga0207657_10000690 Ga0207657_1000069023 183
243 3300025919 Ga0207657_10012848 Ga0207657_100128483 183
244 3300025919 Ga0207657_10109280 Ga0207657_101092802 183
245 3300025920 Ga0207649_10061369 Ga0207649_100613692 183
246 3300025920 Ga0207649_10197713 Ga0207649_101977132 183
247 3300025921 Ga0207652_10009462 Ga0207652_100094627 183
248 3300025921 Ga0207652_10035504 Ga0207652_100355042 183
249 3300025921 Ga0207652_10177548 Ga0207652_101775482 183
250 3300025921 Ga0207652_10376769 Ga0207652_103767692 183
251 3300025921 Ga0207652_10427163 Ga0207652_104271633 183
252 3300025921 Ga0207652_10471558 Ga0207652_104715581 183
253 3300025923 Ga0207681_10000870 Ga0207681_1000087012 183
254 3300025923 Ga0207681_10030023 Ga0207681_100300232 183
255 3300025924 Ga0207694_10003117 Ga0207694_100031174 183
256 3300025924 Ga0207694_10202406 Ga0207694_102024062 183
257 3300025926 Ga0207659_10056666 Ga0207659_100566662 183
258 3300025926 Ga0207659_10192276 Ga0207659_101922762 183
259 3300025928 Ga0207700_10010549 Ga0207700_100105493 183
260 3300025928 Ga0207700_10041101 Ga0207700_100411012 183
261 3300025929 Ga0207664_10033654 Ga0207664_100336545 183
262 3300025929 Ga0207664_10051023 Ga0207664_100510233 183
263 3300025931 Ga0207644_10063231 Ga0207644_100632312 183
264 3300025931 Ga0207644_10732218 Ga0207644_107322181 183
265 3300025932 Ga0207690_10041658 Ga0207690_100416581 183
266 3300025932 Ga0207690_10141719 Ga0207690_101417193 183
267 3300025932 Ga0207690_10229580 Ga0207690_102295802 183
268 3300025933 Ga0207706_10033441 Ga0207706_100334415 183
269 3300025933 Ga0207706_10085763 Ga0207706_100857632 183
270 3300025933 Ga0207706_10224462 Ga0207706_102244621 183
271 3300025934 Ga0207686_10092675 Ga0207686_100926753 183
272 3300025934 Ga0207686_10137973 Ga0207686_101379732 183
273 3300025937 Ga0207669_10083036 Ga0207669_100830362 183
274 3300025937 Ga0207669_10371257 Ga0207669_103712572 183
275 3300025938 Ga0207704_10001732 Ga0207704_100017322 183
276 3300025938 Ga0207704_10286623 Ga0207704_102866232 183
277 3300025940 Ga0207691_10005458 Ga0207691_1000545810 183
278 3300025940 Ga0207691_10016782 Ga0207691_100167821 183
279 3300025941 Ga0207711_10085171 Ga0207711_100851712 183
280 3300025944 Ga0207661_10012679 Ga0207661_100126796 183
281 3300025944 Ga0207661_10140019 Ga0207661_101400192 183
282 3300025945 Ga0207679_10011107 Ga0207679_100111074 183
283 3300025945 Ga0207679_10198625 Ga0207679_101986252 183
284 3300025945 Ga0207679_10604553 Ga0207679_106045532 183
285 3300025949 Ga0207667_10428949 Ga0207667_104289492 183
286 3300025949 Ga0207667_10907016 Ga0207667_109070161 183
287 3300025961 Ga0207712_10001107 Ga0207712_1000110718 183
288 3300025986 Ga0207658_10063649 Ga0207658_100636492 183
289 3300026035 Ga0207703_10188771 Ga0207703_101887712 183
290 3300026041 Ga0207639_10054682 Ga0207639_100546822 183
291 3300026041 Ga0207639_10058703 Ga0207639_100587032 183
292 3300026041 Ga0207639_10637955 Ga0207639_106379551 183
293 3300026041 Ga0207639_11183766 Ga0207639_111837661 183
294 3300026067 Ga0207678_10309065 Ga0207678_103090652 183
295 3300026078 Ga0207702_11057274 Ga0207702_110572742 183
296 3300026088 Ga0207641_10330082 Ga0207641_103300822 183
297 3300026089 Ga0207648_10020671 Ga0207648_100206714 183
298 3300026089 Ga0207648_10114102 Ga0207648_101141022 183
299 3300026095 Ga0207676_10056914 Ga0207676_100569145 183
300 3300026095 Ga0207676_10261081 Ga0207676_102610812 183
301 3300026095 Ga0207676_10520184 Ga0207676_105201842 183
302 3300026116 Ga0207674_10006313 Ga0207674_100063136 183
303 3300026116 Ga0207674_10187953 Ga0207674_101879532 183
304 3300026121 Ga0207683_10410562 Ga0207683_104105622 183
305 3300026142 Ga0207698_10053335 Ga0207698_100533352 183
306 3300026142 Ga0207698_10126393 Ga0207698_101263931 183
307 3300028379 Ga0268266_10031484 Ga0268266_100314842 183
308 3300028380 Ga0268265_10004069 Ga0268265_1000406912 183
309 3300028380 Ga0268265_11444373 Ga0268265_114443731 183
310 3300028381 Ga0268264_10084341 Ga0268264_100843412 183
311 3300031238 Ga0265332_10147274 Ga0265332_101472742 183
312 3300031548 Ga0307408_100964948 Ga0307408_1009649481 183
313 3300031711 Ga0265314_10008723 Ga0265314_100087238 183
314 3300031852 Ga0307410_10186127 Ga0307410_101861271 183
315 3300031901 Ga0307406_10852316 Ga0307406_108523161 183
316 3300031903 Ga0307407_10230399 Ga0307407_102303991 183
317 3300031911 Ga0307412_10251351 Ga0307412_102513512 183
318 3300031911 Ga0307412_10850714 Ga0307412_108507141 183
319 3300031995 Ga0307409_100594887 Ga0307409_1005948872 183
320 3300031995 Ga0307409_101382539 Ga0307409_1013825392 183
321 3300032002 Ga0307416_100264307 Ga0307416_1002643072 183
322 3300032002 Ga0307416_100553737 Ga0307416_1005537372 183
323 3300032002 Ga0307416_100696280 Ga0307416_1006962802 183
324 3300032005 Ga0307411_10455770 Ga0307411_104557702 183
325 3300032005 Ga0307411_10671796 Ga0307411_106717962 183
326 3300032126 Ga0307415_100035301 Ga0307415_1000353014 183
327 3300035086 Ga0373934_0000246 Ga0373934_0000246_14220_14789 183
328 3300035111 Ga0373923_0022710 Ga0373923_0022710_878_1447 183
329 3300035113 Ga0373936_0129614 Ga0373936_0129614_474_1043 183
330 3300035116 Ga0373945_0004315 Ga0373945_0004315_3131_3694 183
331 3300035119 Ga0373956_0001027 Ga0373956_0001027_5054_5623 183
332 3300035170 Ga0373943_0008063 Ga0373943_0008063_4045_4608 183
333 3300035410 Ga0373924_0007337 Ga0373924_0007337_2523_3092 183
334 3300035692 Ga0373935_0007945 Ga0373935_0007945_733_1296 183
335 3300035695 Ga0373927_0018614 Ga0373927_0018614_3931_4494 183
336 3300035724 Ga0373933_0005341 Ga0373933_0005341_5231_5800 183
337 3300036401 Ga0373937_0001671 Ga0373937_0001671_8019_8588 183
338 3300037068 Ga0373925_0000385 Ga0373925_0000385_109_672 183
339 3300037068 Ga0373925_0343543 Ga0373925_0343543_343_912 183
340 3300037471 Ga0395905_1038651 Ga0395905_1038651_149_712 183
341 3300041512 Ga0451853_2313564 Ga0451853_2313564_11_589 183
342 3300044842 Ga0466957_0088368 Ga0466957_0088368_697_1263 183
343 3300045049 Ga0466959_0120661 Ga0466959_0120661_394_960 183
344 3300045836 Ga0466958_0060058 Ga0466958_0060058_525_1091 183
345 3300045976 Ga0466967_0066069 Ga0466967_0066069_19_579 183
346 3300045976 Ga0466967_0996715 Ga0466967_0996715_63_623 183
347 3300046454 Ga0495592_0000632 Ga0495592_0000632_6109_6678 183
348 3300046455 Ga0495603_0003985 Ga0495603_0003985_8201_8764 183
349 3300046459 Ga0495629_0012457 Ga0495629_0012457_1464_2033 183
350 3300046459 Ga0495629_0020898 Ga0495629_0020898_3987_4550 183
351 3300046462 Ga0495651_0000077 Ga0495651_0000077_63548_64117 183
352 3300046463 Ga0495653_0000153 Ga0495653_0000153_12328_12897 183
353 3300046463 Ga0495653_0277173 Ga0495653_0277173_132_692 183
354 3300046472 Ga0495580_0001293 Ga0495580_0001293_3284_3847 183
355 3300046473 Ga0495582_0176067 Ga0495582_0176067_19_582 183
356 3300046475 Ga0495639_0000575 Ga0495639_0000575_5353_5916 183
357 3300046476 Ga0495662_0124060 Ga0495662_0124060_91_651 183
358 3300046477 Ga0495664_0085858 Ga0495664_0085858_45_614 183
359 3300046492 Ga0495585_0259621 Ga0495585_0259621_129_689 183
360 3300046511 Ga0495608_0000166 Ga0495608_0000166_36933_37502 183
361 3300046511 Ga0495608_0194086 Ga0495608_0194086_281_841 183
362 3300046516 Ga0495628_0002032 Ga0495628_0002032_8019_8588 183
363 3300046517 Ga0495630_0000980 Ga0495630_0000980_14205_14768 183
364 3300046517 Ga0495630_0021535 Ga0495630_0021535_2483_3052 183
365 3300046529 Ga0495652_0002213 Ga0495652_0002213_13831_14400 183
366 3300046529 Ga0495652_0240568 Ga0495652_0240568_726_1286 183
367 3300046531 Ga0495665_0000002 Ga0495665_0000002_104325_104888 183
368 3300046533 Ga0495640_0084751 Ga0495640_0084751_959_1528 183
369 3300046533 Ga0495640_0207858 Ga0495640_0207858_58_618 183
370 3300046535 Ga0495586_0015017 Ga0495586_0015017_1869_2438 183
371 3300046535 Ga0495586_0040394 Ga0495586_0040394_1924_2484 183
372 3300046536 Ga0495587_0000400 Ga0495587_0000400_14084_14653 183
373 3300046543 Ga0495645_0000484 Ga0495645_0000484_8092_8661 183
374 3300046543 Ga0495645_0182682 Ga0495645_0182682_55_612 183
375 3300046559 Ga0495667_0000489 Ga0495667_0000489_18582_19151 183
376 3300046559 Ga0495667_0095779 Ga0495667_0095779_1280_1840 183
377 3300046663 Ga0495635_0000048 Ga0495635_0000048_56187_56756 183
378 3300046663 Ga0495635_0141357 Ga0495635_0141357_991_1551 183
379 3300046674 Ga0495588_0000817 Ga0495588_0000817_7872_8435 183
380 3300046675 Ga0495657_0000318 Ga0495657_0000318_12328_12897 183
381 3300046675 Ga0495657_0119120 Ga0495657_0119120_87_647 183
382 3300046678 Ga0495599_0002246 Ga0495599_0002246_8019_8588 183
383 3300046678 Ga0495599_0238787 Ga0495599_0238787_477_1034 183
384 3300046679 Ga0495623_0000110 Ga0495623_0000110_11896_12465 183
385 3300046680 Ga0495646_0002674 Ga0495646_0002674_8019_8588 183
386 3300046683 Ga0495658_0000017 Ga0495658_0000017_60_623 183
387 3300046689 Ga0495613_0009269 Ga0495613_0009269_6685_7248 183
388 3300046809 Ga0495600_0000273 Ga0495600_0000273_4927_5496 183
389 3300046809 Ga0495600_0209649 Ga0495600_0209649_646_1206 183
390 3300047315 Ga0495581_0000727 Ga0495581_0000727_81_644 183
391 3300047315 Ga0495581_0035752 Ga0495581_0035752_736_1305 183
392 3300047315 Ga0495581_0321028 Ga0495581_0321028_334_894 183
393 3300047317 Ga0495604_0000017 Ga0495604_0000017_23647_24216 183
394 3300047317 Ga0495604_0066128 Ga0495604_0066128_2146_2706 183
395 3300047319 Ga0495674_0024600 Ga0495674_0024600_3127_3696 183
396 3300047319 Ga0495674_0090221 Ga0495674_0090221_73_633 183
397 3300047322 Ga0495680_0015843 Ga0495680_0015843_1008_1577 183
398 3300047322 Ga0495680_0179977 Ga0495680_0179977_818_1378 183
399 3300047444 Ga0495675_0000800 Ga0495675_0000800_18206_18775 183
400 3300047471 Ga0495684_0000785 Ga0495684_0000785_2420_2989 183
401 3300047673 Ga0495593_0104721 Ga0495593_0104721_765_1328 183
402 3300047673 Ga0495593_0118489 Ga0495593_0118489_532_1101 183
403 3300048088 Ga0495602_0007248 Ga0495602_0007248_3149_3718 183
404 3300048088 Ga0495602_0028785 Ga0495602_0028785_26_586 183
405 3300048089 Ga0495614_0000005 Ga0495614_0000005_71_634 183
406 3300048903 Ga0496100_0365956 Ga0496100_0365956_472_1035 183
407 3300048907 Ga0496104_0118557 Ga0496104_0118557_849_1412 183
408 3300048907 Ga0496104_0197845 Ga0496104_0197845_612_1175 183
409 3300048911 Ga0496108_0938143 Ga0496108_0938143_74_637 183
410 3300048913 Ga0496110_1272222 Ga0496110_1272222_17_580 183
411 3300048915 Ga0496112_0038996 Ga0496112_0038996_3911_4474 183
412 3300048915 Ga0496112_0201749 Ga0496112_0201749_448_1011 183
413 3300048916 Ga0496113_0049369 Ga0496113_0049369_1217_1780 183
414 3300049569 Ga0501032_0510260 Ga0501032_0510260_71_628 183
415 3300049572 Ga0501036_0284851 Ga0501036_0284851_142_693 183
416 3300049573 Ga0501037_0352625 Ga0501037_0352625_29_580 183
417 3300049574 Ga0501038_0046096 Ga0501038_0046096_3159_3710 183
418 3300049579 Ga0501043_0055146 Ga0501043_0055146_2418_2969 183
419 3300049581 Ga0501047_0013386 Ga0501047_0013386_5203_5754 183
420 3300049586 Ga0501070_0039373 Ga0501070_0039373_3234_3785 183
421 3300049654 Ga0501207_048338 Ga0501207_048338_105_665 183
422 3300049822 Ga0501035_0105817 Ga0501035_0105817_1568_2119 183
423 3300050507 nmdc:mga05p37_407334_c1 nmdc:mga05p37_407334_c1_924_1484 183
424 3300050507 nmdc:mga05p37_42957_c1 nmdc:mga05p37_42957_c1_2199_2759 183
425 3300050508 nmdc:mga09592_9336_c1 nmdc:mga09592_9336_c1_4905_5465 183
426 3300050509 nmdc:mga0qj67_15827_c1 nmdc:mga0qj67_15827_c1_4969_5529 183
427 3300050509 nmdc:mga0qj67_26080_c1 nmdc:mga0qj67_26080_c1_663_1223 183
428 3300050510 nmdc:mga06r32_201686_c1 nmdc:mga06r32_201686_c1_1183_1743 183
429 3300050510 nmdc:mga06r32_282157_c1 nmdc:mga06r32_282157_c1_510_1070 183
430 3300050510 nmdc:mga06r32_463599_c1 nmdc:mga06r32_463599_c1_49_609 183
431 3300050511 nmdc:mga08y16_41772_c1 nmdc:mga08y16_41772_c1_74_634 183
432 3300050512 nmdc:mga0n895_723038_c1 nmdc:mga0n895_723038_c1_345_905 183
433 3300050515 nmdc:mga0a205_184739_c1 nmdc:mga0a205_184739_c1_181_741 183
434 3300053077 Ga0495601_0004220 Ga0495601_0004220_160_729 183
435 3300053078 Ga0495612_0002385 Ga0495612_0002385_4234_4803 183
436 3300053084 Ga0495595_0022200 Ga0495595_0022200_504_1073 183
437 3300053085 Ga0495619_0006054 Ga0495619_0006054_199_768 183
438 3300059421 Ga0590071_022508 Ga0590071_022508_365_925 183
439 3300059424 Ga0590075_024906 Ga0590075_024906_906_1466 183
440 3300059426 Ga0590077_083922 Ga0590077_083922_140_700 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02830

V4R

V4R domain

141

192

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oso-assembly1.cif.gz_A crystal structure of a vinyl-4-reductase family protein (mj_1460) from methanocaldococcus jannaschii dsm at 1.90 a resolution 0.8386 37 157
7b70-assembly1.cif.gz_A trappcore plus c8 (355-596) and c11 (1-718) from minitrappiii 0.768 15 158
7vqf-assembly1.cif.gz_A phenol binding protein, mopr 0.7535 10 159
7e2d-assembly1.cif.gz_C monomer of trappii (closed) 0.7527 13 158
6aq3-assembly1.cif.gz_A crystal structure of a trafficking protein particle complex subunit 3 from naegleria fowleri covalently bound to palmitic acid 0.7492 15 158
ID Description Score Start End Superfamily
2osdA00 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.8449 74 159 3.30.1380.20
af_Q3UQ05_61_243_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.8143 88 102 3.15.10.10
af_Q58265_65_225_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.8027 18 160 3.30.1380.20
af_Q58155_28_181_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7814 11 160 3.30.1380.20
af_Q58149_3_150_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7531 10 157 3.30.1380.20
ID Description Score Start End GO Terms
AF-A0A7Y5TR62-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9853 1 182
AF-A0A2V7T0X8-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9788 1 182
AF-A0A7Y5TR62-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9747 1 182
AF-A0A2V7T0X8-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9683 1 182
AF-A0A7V9PI20-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9617 1 181

Feature Viewer

pLDDT pTM Quality
86.44 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map