F444476

General Info

Members Datasets Scaffolds Average Seq Length
440 238 880 261

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0061839|Ga0451577_0061839_1215_2051
Length 278
Sequence MPIGSRFHYKTPEEIEIIRKNCLLVSETLAEVAKHIKPGVTGLMLDTLAETFIRDHGAEPAFKGYPGSISDFPASLCISFNEVIVHGIPDKREIKEGDILSVDCGVKMNGYFGDAAFTFAIGEIKPEELDLLVTTRECLDLAIGQAVAGNRLGDIGFAVQQHAEVEHGYGVIREMVGHGIGKKLHEKPEVPNYGKRGKGPVLHEGLTIAIEPMINLGTREVVLKKDGWTLVTRDLKPSAHYEHTIAIQKSAADVLSDHKVIDQAIKNNVNLSEVWIKR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
192 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
193 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
199 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
202 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
203 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
204 2738541283 Pedobacter sp. OK701 Isolate Unclassified
205 2738541284 Pedobacter sp. YR016 Isolate Unclassified
206 2738541302 Pedobacter sp. CF074 Isolate Unclassified
207 2738543023 Pedobacter sp. OK628 Isolate Unclassified
208 2739367651 Pedobacter sp. OK291 Isolate Unclassified
209 2739367656 Pedobacter sp. CF523 Isolate Unclassified
210 2739367663 Pedobacter sp. YR510 Isolate Unclassified
211 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
212 2818991437 Pedobacter terrae 518 Isolate Unclassified
213 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
214 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
215 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
216 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
217 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
218 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
219 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
220 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
221 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
222 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
223 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
224 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
225 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
226 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
227 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
228 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
229 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
230 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
231 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
232 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
233 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
234 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
235 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
236 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
237 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
238 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.64
Metatranscriptomes 2.73
Isolates 8.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.64
Nodule 0
Rhizoplane 0.45
Rhizosphere 80.91
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0061839 3300042876 Bacteria 3339
2 SwRhRL2b_contig_1197142 2162886007 Bacteria 2304
3 JGI24740J21852_10008913 3300001979 Bacteria 3965
4 JGI24737J22298_10001860 3300001990 Bacteria 7545
5 JGI24737J22298_10007583 3300001990 Bacteria 3656
6 JGI24735J21928_10000003 3300002067 Bacteria 385983
7 JGI25162J39368_1000039 3300002737 Bacteria 175976
8 JGI25162J39368_1001202 3300002737 Bacteria 15113
9 JGI25164J39214_1001166 3300002772 Bacteria 7290
10 JGI25152J39213_1000006 3300002773 Bacteria 158516
11 JGI25150J39212_1000005 3300002774 Bacteria 311800
12 JGI25151J46595_10000004 3300003187 Bacteria 494006
13 JGI25165J46597_1000678 3300003214 Bacteria 27401
14 JGI25153J46596_10000004 3300003215 Bacteria 494006
15 rootH1_10027299 3300003316 Bacteria 5608
16 rootH2_10026380 3300003320 Bacteria 6469
17 rootH2_10026382 3300003320 Bacteria 1425
18 rootH2_10040379 3300003320 Bacteria 2055
19 rootH1_10006680 3300003323 Bacteria 5974
20 rootH1_10018837 3300003323 Bacteria 2097
21 rootH1_10132210 3300003323 Bacteria 2506
22 Ga0055536_1000004 3300003781 Bacteria 411108
23 Ga0055530_10000817 3300003791 Bacteria 25836
24 Ga0058863_10160658 3300004799 Bacteria 11335
25 Ga0065165_1000831 3300005262 Bacteria 40595
26 Ga0065714_10002624 3300005288 Bacteria 24311
27 Ga0065714_10009709 3300005288 Bacteria 2483
28 Ga0065714_10083802 3300005288 Bacteria 2230
29 Ga0065714_10087799 3300005288 Bacteria 2041
30 Ga0065714_10190290 3300005288 Bacteria 928
31 Ga0065714_10226071 3300005288 Bacteria 826
32 Ga0065704_10000307 3300005289 Bacteria 35767
33 Ga0065704_10075644 3300005289 Bacteria 5484
34 Ga0070658_10000153 3300005327 Bacteria 60625
35 Ga0070658_10090878 3300005327 Bacteria 2516
36 Ga0070658_10140676 3300005327 Bacteria 2016
37 Ga0070658_10259438 3300005327 Bacteria 1476
38 Ga0070676_10000312 3300005328 Bacteria 21945
39 Ga0070680_100005676 3300005336 Bacteria 9464
40 Ga0070660_100047075 3300005339 Bacteria 3308
41 Ga0070660_100053292 3300005339 Bacteria 3120
42 Ga0070660_100341644 3300005339 Bacteria 1232
43 Ga0070691_10023134 3300005341 Bacteria 2885
44 Ga0070688_100073921 3300005365 Bacteria 2187
45 Ga0070659_100000375 3300005366 Bacteria 33764
46 Ga0070659_100017452 3300005366 Bacteria 5404
47 Ga0070663_100101524 3300005455 Bacteria 2147
48 Ga0070678_100001208 3300005456 Bacteria 13700
49 Ga0070662_100000074 3300005457 Bacteria 54943
50 Ga0070681_10002985 3300005458 Bacteria 15692
51 Ga0068867_100010877 3300005459 Bacteria 6418
52 Ga0070685_10093213 3300005466 Bacteria 1826
53 Ga0070679_100006255 3300005530 Bacteria 11090
54 Ga0070684_100167813 3300005535 Bacteria 1993
55 Ga0068853_100058721 3300005539 Bacteria 3321
56 Ga0068853_100090362 3300005539 Bacteria 2691
57 Ga0070672_100092632 3300005543 Bacteria 2440
58 Ga0070665_100000372 3300005548 Bacteria 66748
59 Ga0068855_100000360 3300005563 Bacteria 56448
60 Ga0068855_100012268 3300005563 Bacteria 10356
61 Ga0068855_100071470 3300005563 Bacteria 4035
62 Ga0068855_100359969 3300005563 Bacteria 1601
63 Ga0068855_100527471 3300005563 Bacteria 1280
64 Ga0068857_100112855 3300005577 Bacteria 2444
65 Ga0068856_100004718 3300005614 Bacteria 13531
66 Ga0068856_100016148 3300005614 Bacteria 7219
67 Ga0068856_100230141 3300005614 Bacteria 1869
68 Ga0068852_100010466 3300005616 Bacteria 6935
69 Ga0068852_100399350 3300005616 Bacteria 1352
70 Ga0068851_10000177 3300005834 Bacteria 31928
71 Ga0068858_100127549 3300005842 Bacteria 2384
72 Ga0075366_10000284 3300006195 Bacteria 22680
73 Ga0075366_10000288 3300006195 Bacteria 22515
74 Ga0075366_10204183 3300006195 Bacteria 1202
75 Ga0097621_100007799 3300006237 Bacteria 7678
76 Ga0075370_10027039 3300006353 Bacteria 3181
77 Ga0068871_100000141 3300006358 Bacteria 46656
78 Ga0068865_100000917 3300006881 Bacteria 16715
79 Ga0105244_10015827 3300009036 Bacteria 4315
80 Ga0105240_10000082 3300009093 Bacteria 195184
81 Ga0105240_10110375 3300009093 Bacteria 3329
82 Ga0105240_10237431 3300009093 Bacteria 2115
83 Ga0105240_10387298 3300009093 Bacteria 1577
84 Ga0111539_10616286 3300009094 Bacteria 1264
85 Ga0105243_10000009 3300009148 Bacteria 354419
86 Ga0105242_10089716 3300009176 Bacteria 2585
87 Ga0105237_10000794 3300009545 Bacteria 43200
88 Ga0105237_10002553 3300009545 Bacteria 22488
89 Ga0105237_10006510 3300009545 Bacteria 12935
90 Ga0105237_10015313 3300009545 Bacteria 7986
91 Ga0105237_10015662 3300009545 Bacteria 7882
92 Ga0105237_10071252 3300009545 Bacteria 3471
93 Ga0105237_10143356 3300009545 Bacteria 2383
94 Ga0105237_10221628 3300009545 Bacteria 1891
95 Ga0105238_10017754 3300009551 Bacteria 7234
96 Ga0105238_10369988 3300009551 Bacteria 1423
97 Ga0105249_10426658 3300009553 Bacteria 1361
98 Ga0105239_10000011 3300010375 Bacteria 337500
99 Ga0105239_10015682 3300010375 Bacteria 8387
100 Ga0105239_10075656 3300010375 Bacteria 3702
101 Ga0105239_10150240 3300010375 Bacteria 2600
102 Ga0105239_10190824 3300010375 Bacteria 2293
103 Ga0105239_10356241 3300010375 Bacteria 1652
104 Ga0105239_10436481 3300010375 Bacteria 1484
105 Ga0157373_10000129 3300013100 Bacteria 59252
106 Ga0157373_10001033 3300013100 Bacteria 21448
107 Ga0157373_10009996 3300013100 Bacteria 6992
108 Ga0157373_10028999 3300013100 Bacteria 3989
109 Ga0157373_10048319 3300013100 Bacteria 3034
110 Ga0157373_10077078 3300013100 Bacteria 2352
111 Ga0157371_10000041 3300013102 Bacteria 203957
112 Ga0157371_10001664 3300013102 Bacteria 22687
113 Ga0157371_10003367 3300013102 Bacteria 14536
114 Ga0157371_10021684 3300013102 Bacteria 4713
115 Ga0157371_10033811 3300013102 Bacteria 3672
116 Ga0157371_10035324 3300013102 Bacteria 3582
117 Ga0157370_10012207 3300013104 Bacteria 8929
118 Ga0157370_10014051 3300013104 Bacteria 8215
119 Ga0157370_10019720 3300013104 Bacteria 6751
120 Ga0157370_10060489 3300013104 Bacteria 3596
121 Ga0157370_10061379 3300013104 Bacteria 3568
122 Ga0157370_10084704 3300013104 Bacteria 2979
123 Ga0157370_10134256 3300013104 Bacteria 2307
124 Ga0157370_10333493 3300013104 Bacteria 1398
125 Ga0157369_10000016 3300013105 Bacteria 257827
126 Ga0157369_10004050 3300013105 Bacteria 17366
127 Ga0157369_10122617 3300013105 Bacteria 2757
128 Ga0157369_10294778 3300013105 Bacteria 1688
129 Ga0157369_10393357 3300013105 Bacteria 1438
130 Ga0157374_10030641 3300013296 Bacteria 4886
131 Ga0157374_10077301 3300013296 Bacteria 3150
132 Ga0157378_10008303 3300013297 Bacteria 9048
133 Ga0157378_10060889 3300013297 Bacteria 3368
134 Ga0157378_10186521 3300013297 Bacteria 1954
135 Ga0157378_10629553 3300013297 Bacteria 1087
136 Ga0163162_10001202 3300013306 Bacteria 24155
137 Ga0163162_10044820 3300013306 Bacteria 4431
138 Ga0163162_10070743 3300013306 Bacteria 3540
139 Ga0163162_10339588 3300013306 Bacteria 1634
140 Ga0157372_10000030 3300013307 Bacteria 179925
141 Ga0157372_10000332 3300013307 Bacteria 51907
142 Ga0157372_10001364 3300013307 Bacteria 26417
143 Ga0157372_10003430 3300013307 Bacteria 17111
144 Ga0157372_10011651 3300013307 Bacteria 9360
145 Ga0157372_10037880 3300013307 Bacteria 5321
146 Ga0157372_10086212 3300013307 Bacteria 3563
147 Ga0157372_10123218 3300013307 Bacteria 2980
148 Ga0157375_10022074 3300013308 Bacteria 5854
149 Ga0157375_10081872 3300013308 Bacteria 3269
150 Ga0157375_10187566 3300013308 Bacteria 2222
151 Ga0157375_10369293 3300013308 Bacteria 1601
152 Ga0163163_10277413 3300014325 Bacteria 1727
153 Ga0157380_10004578 3300014326 Bacteria 9601
154 Ga0182008_10000034 3300014497 Bacteria 138235
155 Ga0182008_10000600 3300014497 Bacteria 26471
156 Ga0182008_10003643 3300014497 Bacteria 9192
157 Ga0157377_10134890 3300014745 Bacteria 1511
158 Ga0157376_10436747 3300014969 Bacteria 1274
159 Ga0182006_1000103 3300015261 Bacteria 93638
160 Ga0182006_1006389 3300015261 Bacteria 5486
161 Ga0182006_1008481 3300015261 Bacteria 4656
162 Ga0182006_1020413 3300015261 Bacteria 2776
163 Ga0182006_1032340 3300015261 Bacteria 2103
164 Ga0182007_10000002 3300015262 Bacteria 564661
165 Ga0182007_10005771 3300015262 Bacteria 5382
166 Ga0183373_1004 3300015682 Bacteria 537398
167 Ga0163161_10013535 3300017792 Bacteria 5680
168 Ga0163161_10044157 3300017792 Bacteria 3210
169 Ga0163161_10050338 3300017792 Bacteria 3014
170 Ga0163161_10087977 3300017792 Bacteria 2296
171 Ga0163161_10098092 3300017792 Bacteria 2177
172 Ga0163161_10347618 3300017792 Bacteria 1178
173 Ga0197907_11036902 3300020069 Bacteria 5494
174 Ga0206351_10267476 3300020077 Bacteria 15418
175 Ga0206351_10512829 3300020077 Bacteria 15076
176 Ga0154015_1037437 3300020610 Bacteria 13281
177 Ga0154015_1495562 3300020610 Bacteria 11881
178 Ga0213872_10006418 3300021361 Bacteria 5910
179 Ga0207427_100025 3300025231 Bacteria 433726
180 Ga0209437_100010 3300025233 Bacteria 838447
181 Ga0209437_100135 3300025233 Bacteria 176455
182 Ga0207425_1000008 3300025245 Bacteria 618024
183 Ga0209026_1000610 3300025250 Bacteria 22917
184 Ga0209026_1004500 3300025250 Bacteria 4111
185 Ga0209129_1000040 3300025258 Bacteria 313043
186 Ga0209233_1000017 3300025261 Bacteria 898076
187 Ga0209233_1001079 3300025261 Bacteria 11257
188 Ga0209455_1001879 3300025272 Bacteria 8760
189 Ga0209676_1000009 3300025292 Bacteria 981719
190 Ga0209025_1000020 3300025294 Bacteria 618024
191 Ga0209758_1000022 3300025297 Bacteria 618024
192 Ga0209050_1000048 3300025298 Bacteria 371553
193 Ga0207656_10002394 3300025321 Bacteria 6311
194 Ga0207655_1034651 3300025728 Bacteria 2266
195 Ga0207647_10000171 3300025904 Bacteria 51875
196 Ga0207647_10022536 3300025904 Bacteria 4181
197 Ga0207647_10032931 3300025904 Bacteria 3324
198 Ga0207645_10000035 3300025907 Bacteria 89345
199 Ga0207705_10000108 3300025909 Bacteria 93501
200 Ga0207654_10034290 3300025911 Bacteria 2819
201 Ga0207654_10138162 3300025911 Bacteria 1551
202 Ga0207707_10032972 3300025912 Bacteria 4534
203 Ga0207695_10000053 3300025913 Bacteria 396740
204 Ga0207695_10039657 3300025913 Bacteria 5060
205 Ga0207695_10057771 3300025913 Bacteria 4030
206 Ga0207695_10080728 3300025913 Bacteria 3293
207 Ga0207695_10501005 3300025913 Bacteria 1096
208 Ga0207695_10611693 3300025913 Bacteria 971
209 Ga0207671_10005849 3300025914 Bacteria 11173
210 Ga0207671_10011776 3300025914 Bacteria 7082
211 Ga0207671_10013363 3300025914 Bacteria 6541
212 Ga0207671_10014424 3300025914 Bacteria 6246
213 Ga0207671_10018120 3300025914 Bacteria 5410
214 Ga0207671_10034795 3300025914 Bacteria 3742
215 Ga0207671_10053614 3300025914 Bacteria 2988
216 Ga0207671_10129273 3300025914 Bacteria 1938
217 Ga0207660_10024307 3300025917 Bacteria 4102
218 Ga0207657_10023513 3300025919 Bacteria 5737
219 Ga0207657_10058573 3300025919 Bacteria 3314
220 Ga0207657_10280514 3300025919 Bacteria 1323
221 Ga0207657_10316176 3300025919 Bacteria 1235
222 Ga0207652_10002419 3300025921 Bacteria 15754
223 Ga0207694_10009649 3300025924 Bacteria 7276
224 Ga0207694_10042226 3300025924 Bacteria 3517
225 Ga0207644_10013551 3300025931 Bacteria 5439
226 Ga0207690_10000936 3300025932 Bacteria 18684
227 Ga0207690_10005948 3300025932 Bacteria 7224
228 Ga0207706_10019009 3300025933 Bacteria 6180
229 Ga0207709_10000026 3300025935 Bacteria 354467
230 Ga0207704_10000036 3300025938 Bacteria 94574
231 Ga0207667_10000430 3300025949 Bacteria 56466
232 Ga0207667_10023666 3300025949 Bacteria 6761
233 Ga0207667_10041900 3300025949 Bacteria 4869
234 Ga0207667_10076563 3300025949 Bacteria 3471
235 Ga0207667_10152883 3300025949 Bacteria 2375
236 Ga0207651_10009416 3300025960 Bacteria 5347
237 Ga0207677_10112728 3300026023 Bacteria 2029
238 Ga0207639_10030197 3300026041 Bacteria 3973
239 Ga0207639_10034930 3300026041 Bacteria 3719
240 Ga0207639_10131675 3300026041 Bacteria 2071
241 Ga0207678_10131111 3300026067 Bacteria 2138
242 Ga0207702_10010443 3300026078 Bacteria 7766
243 Ga0207702_10010590 3300026078 Bacteria 7707
244 Ga0207702_10218656 3300026078 Bacteria 1775
245 Ga0207648_10000333 3300026089 Bacteria 51656
246 Ga0207674_10090260 3300026116 Bacteria 3055
247 Ga0207683_10003418 3300026121 Bacteria 13828
248 Ga0207698_10013453 3300026142 Bacteria 5399
249 Ga0207698_10102517 3300026142 Bacteria 2376
250 Ga0268266_10000658 3300028379 Bacteria 46741
251 Ga0307517_10012583 3300028786 Bacteria 11593
252 Ga0307515_10007084 3300028794 Bacteria 22272
253 Ga0307515_10067820 3300028794 Bacteria 4914
254 Ga0307515_10212142 3300028794 Bacteria 1777
255 Ga0307515_10315415 3300028794 Bacteria 1234
256 Ga0265338_10007954 3300028800 Bacteria 12991
257 Ga0316183_1033300 3300030742 Bacteria 31987
258 Ga0316181_1034557 3300030744 Bacteria 9867
259 Ga0316182_1296934 3300030745 Bacteria 1368
260 Ga0265327_10000370 3300031251 Bacteria 84921
261 Ga0265327_10041391 3300031251 Bacteria 2484
262 Ga0307408_100073008 3300031548 Bacteria 2541
263 Ga0307408_100134877 3300031548 Bacteria 1930
264 Ga0316576_10219645 3300031727 Bacteria 1430
265 Ga0307405_10000006 3300031731 Bacteria 361477
266 Ga0307405_10047315 3300031731 Bacteria 2648
267 Ga0307413_10054157 3300031824 Bacteria 2433
268 Ga0307407_10000003 3300031903 Bacteria 271723
269 Ga0307412_10002079 3300031911 Bacteria 11112
270 Ga0307412_10003796 3300031911 Bacteria 8399
271 Ga0307412_10041647 3300031911 Bacteria 2978
272 Ga0307412_10183233 3300031911 Bacteria 1577
273 Ga0307412_10185828 3300031911 Bacteria 1567
274 Ga0307409_100068515 3300031995 Bacteria 2807
275 Ga0307409_100104059 3300031995 Bacteria 2363
276 Ga0307416_100000002 3300032002 Bacteria 509907
277 Ga0307416_100079899 3300032002 Bacteria 2758
278 Ga0307416_100920455 3300032002 Bacteria 975
279 Ga0307414_10005329 3300032004 Bacteria 7075
280 Ga0307414_10005856 3300032004 Bacteria 6798
281 Ga0307414_10009488 3300032004 Bacteria 5593
282 Ga0307414_10012166 3300032004 Bacteria 5077
283 Ga0307414_10014141 3300032004 Bacteria 4772
284 Ga0307414_10078172 3300032004 Bacteria 2411
285 Ga0307414_10110482 3300032004 Bacteria 2091
286 Ga0307414_10163161 3300032004 Bacteria 1772
287 Ga0307414_10236098 3300032004 Bacteria 1510
288 Ga0307414_10274833 3300032004 Bacteria 1413
289 Ga0307411_10126165 3300032005 Bacteria 1862
290 Ga0307411_10296538 3300032005 Bacteria 1294
291 Ga0307507_10000034 3300033179 Bacteria 188697
292 Ga0307510_10003892 3300033180 Bacteria 17498
293 Ga0316592_1005027 3300033524 Bacteria 2492
294 Ga0316592_1045321 3300033524 Bacteria 978
295 Ga0316592_1049986 3300033524 Bacteria 933
296 Ga0316588_1035814 3300033528 Bacteria 1177
297 Ga0395899_0000021 3300037312 Bacteria 391702
298 Ga0395899_0000034 3300037312 Bacteria 302623
299 Ga0395899_0000472 3300037312 Bacteria 45477
300 Ga0395899_0000499 3300037312 Bacteria 43572
301 Ga0395899_0050121 3300037312 Bacteria 3101
302 Ga0395900_0000346 3300037418 Bacteria 68020
303 Ga0395900_0001482 3300037418 Bacteria 28015
304 Ga0395900_0199077 3300037418 Bacteria 2028
305 Ga0395898_0021701 3300037466 Bacteria 6509
306 Ga0395898_0063979 3300037466 Bacteria 3569
307 Ga0395905_0000001 3300037471 Bacteria 2037079
308 Ga0395905_0000528 3300037471 Bacteria 52404
309 Ga0395905_0002993 3300037471 Bacteria 18335
310 Ga0395905_0127136 3300037471 Bacteria 2397
311 Ga0395901_0000351 3300038443 Bacteria 56004
312 Ga0395901_0007776 3300038443 Bacteria 10816
313 Ga0436361_0433548 3300039447 Bacteria 14679
314 Ga0439448_0011844 3300042005 Bacteria 2601
315 Ga0439457_021694 3300042014 Bacteria 1424
316 Ga0466969_0040631 3300044656 Bacteria 2330
317 Ga0453683_0313753 3300044673 Unclassified 1004
318 Ga0466966_0001476 3300044684 Bacteria 15131
319 Ga0466961_0160913 3300044693 Bacteria 1399
320 Ga0453684_0004131 3300044712 Bacteria 31439
321 Ga0453684_0133450 3300044712 Bacteria 2976
322 Ga0453684_0156006 3300044712 Bacteria 2706
323 Ga0453684_0162796 3300044712 Bacteria 2637
324 Ga0466959_0100874 3300045049 Bacteria 2066
325 Ga0466959_0209237 3300045049 Bacteria 1356
326 Ga0466958_0007843 3300045836 Bacteria 5897
327 Ga0495650_0000023 3300046471 Bacteria 527763
328 Ga0495585_0000476 3300046492 Bacteria 38316
329 Ga0495585_0001907 3300046492 Bacteria 15677
330 Ga0495583_0034187 3300046506 Bacteria 2438
331 Ga0495583_0105868 3300046506 Bacteria 1196
332 Ga0495606_0003554 3300046507 Bacteria 16456
333 Ga0495606_0006936 3300046507 Bacteria 10302
334 Ga0495606_0010457 3300046507 Bacteria 7698
335 Ga0495606_0049128 3300046507 Bacteria 2769
336 Ga0495606_0363794 3300046507 Bacteria 764
337 Ga0495610_0020639 3300046512 Bacteria 3652
338 Ga0495610_0044214 3300046512 Bacteria 2212
339 Ga0495616_0029922 3300046513 Bacteria 2868
340 Ga0495616_0136857 3300046513 Bacteria 1118
341 Ga0495631_0002385 3300046518 Bacteria 10650
342 Ga0495631_0076583 3300046518 Bacteria 1444
343 Ga0495637_0047921 3300046520 Bacteria 1802
344 Ga0495637_0083256 3300046520 Bacteria 1272
345 Ga0495648_0017616 3300046524 Bacteria 5097
346 Ga0495652_0121985 3300046529 Bacteria 2077
347 Ga0495609_0004523 3300046538 Bacteria 7572
348 Ga0495609_0006730 3300046538 Bacteria 5828
349 Ga0495633_0000072 3300046558 Bacteria 131197
350 Ga0495633_0016150 3300046558 Bacteria 3858
351 Ga0495633_0025488 3300046558 Bacteria 2910
352 Ga0495668_0000165 3300046616 Bacteria 98016
353 Ga0495611_0059991 3300046648 Bacteria 1728
354 Ga0495625_0000308 3300046660 Bacteria 74661
355 Ga0495625_0047299 3300046660 Bacteria 3102
356 Ga0495625_0072461 3300046660 Bacteria 2416
357 Ga0495625_0077697 3300046660 Bacteria 2318
358 Ga0495625_0137903 3300046660 Bacteria 1647
359 Ga0495625_0176714 3300046660 Bacteria 1422
360 Ga0495625_0207069 3300046660 Bacteria 1291
361 Ga0495625_0209952 3300046660 Bacteria 1280
362 Ga0495625_0289001 3300046660 Bacteria 1052
363 Ga0495661_0022092 3300046665 Bacteria 4141
364 Ga0495661_0040831 3300046665 Bacteria 2874
365 Ga0495599_0161066 3300046678 Bacteria 1387
366 Ga0495649_0000105 3300046694 Bacteria 74750
367 Ga0495649_0167431 3300046694 Bacteria 1151
368 Ga0495660_0086890 3300046810 Bacteria 1632
369 Ga0495687_000233 3300047443 Bacteria 77056
370 Ga0495673_0013740 3300047469 Bacteria 4239
371 Ga0495686_0002422 3300047472 Bacteria 17639
372 Ga0495686_0010199 3300047472 Bacteria 6696
373 Ga0495686_0092084 3300047472 Bacteria 1839
374 Ga0495686_0241084 3300047472 Bacteria 1019
375 Ga0496114_0091395 3300048917 Bacteria 2585
376 Ga0496116_0005535 3300048919 Bacteria 11653
377 Ga0496117_0001863 3300048920 Bacteria 28457
378 Ga0496118_0025644 3300048921 Bacteria 5047
379 Ga0496122_0000862 3300048925 Bacteria 57049
380 Ga0496122_0006922 3300048925 Bacteria 12808
381 Ga0496123_0013292 3300048926 Bacteria 6932
382 Ga0496123_0015001 3300048926 Bacteria 6383
383 Ga0496124_0039503 3300048927 Bacteria 4091
384 Ga0496125_0048493 3300048928 Bacteria 3541
385 Ga0496125_0134546 3300048928 Bacteria 1732
386 Ga0496126_0060412 3300048929 Bacteria 3409
387 Ga0501311_005256 3300049527 Bacteria 1412
388 Ga0501323_009281 3300049539 Bacteria 1157
389 Ga0501198_003579 3300049649 Bacteria 2128
390 Ga0501223_000581 3300049663 Bacteria 8828
391 Ga0501280_012957 3300049776 Bacteria 1175
392 nmdc:mga0k408_2228_c1 3300050493 Bacteria 10371
393 nmdc:mga0k408_22365_c1 3300050493 Bacteria 3560
394 nmdc:mga0k408_349_c1 3300050493 Bacteria 23383
395 nmdc:mga0k408_86571_c2 3300050493 Bacteria 1204
396 nmdc:mga07m45_50194_c1 3300050496 Bacteria 1975
397 Ga0500651_0000078 3300053093 Bacteria 62741
398 Ga0500608_040061 3300053122 Bacteria 2245
399 Ga0500618_000057 3300053125 Bacteria 98383
400 Ga0500618_030023 3300053125 Bacteria 1280
401 Ga0500579_100265 3300053143 Bacteria 1513
402 Ga0500622_0000385 3300053156 Bacteria 42685
403 2586210038 2585427687 Bacteria 5544917
404 2599479373 2599185184 Bacteria 6430550
405 2722726186 2721755487 Bacteria 6357185
406 2738755668 2738541283 Bacteria 7222293
407 2738762115 2738541284 Bacteria 5199923
408 2738854410 2738541302 Bacteria 5944758
409 2739301905 2738543023 Bacteria 6767879
410 2739587962 2739367651 Bacteria 6359826
411 2739614387 2739367656 Bacteria 5152243
412 2739646681 2739367663 Bacteria 5040914
413 2776615259 2775506987 Bacteria 5373360
414 2819545838 2818991437 Bacteria 5805520
415 2842724269 2842722452 Bacteria 6263924
416 2842908287 2842903701 Bacteria 6986368
417 2842913597 2842909656 Bacteria 6185908
418 2849282591 2849281842 Bacteria 6065644
419 2852625385 2852623160 Bacteria 4376875
420 2852629122 2852627209 Bacteria 5896285
421 2857631660 2857627736 Bacteria 5625397
422 2884934396 2884933994 Bacteria 4535041
423 2890740654 2890737413 Bacteria 4269751
424 2896320829 2896317667 Bacteria 4606601
425 2896346878 2896344016 Bacteria 3811746
426 2898716217 2898713307 Bacteria 4110805
427 2902051179 2902048731 Bacteria 4976191
428 2904449078 2904445276 Bacteria 5310396
429 2904782797 2904780799 Bacteria 5840761
430 2919180407 2919177583 Bacteria 5641607
431 2919189080 2919186247 Bacteria 6244071
432 2919438026 2919437846 Bacteria 6199444
433 2928082317 2928078545 Bacteria 6534839
434 2928149104 2928147474 Bacteria 6512076
435 2932085029 2932082852 Bacteria 6563563
436 2939666765 2939664404 Bacteria 6364494
437 2945998908 2945997725 Bacteria 6404843
438 2954021351 2954016120 Bacteria 6446024
439 2977235862 2977232053 Bacteria 5485925
440 3003234783 3003233435 Bacteria 4458031
441 Ga0451577_0061839
442 SwRhRL2b_contig_1197142
443 JGI24740J21852_10008913
444 JGI24737J22298_10001860
445 JGI24737J22298_10007583
446 JGI24735J21928_10000003
447 JGI25162J39368_1000039
448 JGI25162J39368_1001202
449 JGI25164J39214_1001166
450 JGI25152J39213_1000006
451 JGI25150J39212_1000005
452 JGI25151J46595_10000004
453 JGI25165J46597_1000678
454 JGI25153J46596_10000004
455 rootH1_10027299
456 rootH2_10026380
457 rootH2_10026382
458 rootH2_10040379
459 rootH1_10006680
460 rootH1_10018837
461 rootH1_10132210
462 Ga0055536_1000004
463 Ga0055530_10000817
464 Ga0058863_10160658
465 Ga0065165_1000831
466 Ga0065714_10002624
467 Ga0065714_10009709
468 Ga0065714_10083802
469 Ga0065714_10087799
470 Ga0065714_10190290
471 Ga0065714_10226071
472 Ga0065704_10000307
473 Ga0065704_10075644
474 Ga0070658_10000153
475 Ga0070658_10090878
476 Ga0070658_10140676
477 Ga0070658_10259438
478 Ga0070676_10000312
479 Ga0070680_100005676
480 Ga0070660_100047075
481 Ga0070660_100053292
482 Ga0070660_100341644
483 Ga0070691_10023134
484 Ga0070688_100073921
485 Ga0070659_100000375
486 Ga0070659_100017452
487 Ga0070663_100101524
488 Ga0070678_100001208
489 Ga0070662_100000074
490 Ga0070681_10002985
491 Ga0068867_100010877
492 Ga0070685_10093213
493 Ga0070679_100006255
494 Ga0070684_100167813
495 Ga0068853_100058721
496 Ga0068853_100090362
497 Ga0070672_100092632
498 Ga0070665_100000372
499 Ga0068855_100000360
500 Ga0068855_100012268
501 Ga0068855_100071470
502 Ga0068855_100359969
503 Ga0068855_100527471
504 Ga0068857_100112855
505 Ga0068856_100004718
506 Ga0068856_100016148
507 Ga0068856_100230141
508 Ga0068852_100010466
509 Ga0068852_100399350
510 Ga0068851_10000177
511 Ga0068858_100127549
512 Ga0075366_10000284
513 Ga0075366_10000288
514 Ga0075366_10204183
515 Ga0097621_100007799
516 Ga0075370_10027039
517 Ga0068871_100000141
518 Ga0068865_100000917
519 Ga0105244_10015827
520 Ga0105240_10000082
521 Ga0105240_10110375
522 Ga0105240_10237431
523 Ga0105240_10387298
524 Ga0111539_10616286
525 Ga0105243_10000009
526 Ga0105242_10089716
527 Ga0105237_10000794
528 Ga0105237_10002553
529 Ga0105237_10006510
530 Ga0105237_10015313
531 Ga0105237_10015662
532 Ga0105237_10071252
533 Ga0105237_10143356
534 Ga0105237_10221628
535 Ga0105238_10017754
536 Ga0105238_10369988
537 Ga0105249_10426658
538 Ga0105239_10000011
539 Ga0105239_10015682
540 Ga0105239_10075656
541 Ga0105239_10150240
542 Ga0105239_10190824
543 Ga0105239_10356241
544 Ga0105239_10436481
545 Ga0157373_10000129
546 Ga0157373_10001033
547 Ga0157373_10009996
548 Ga0157373_10028999
549 Ga0157373_10048319
550 Ga0157373_10077078
551 Ga0157371_10000041
552 Ga0157371_10001664
553 Ga0157371_10003367
554 Ga0157371_10021684
555 Ga0157371_10033811
556 Ga0157371_10035324
557 Ga0157370_10012207
558 Ga0157370_10014051
559 Ga0157370_10019720
560 Ga0157370_10060489
561 Ga0157370_10061379
562 Ga0157370_10084704
563 Ga0157370_10134256
564 Ga0157370_10333493
565 Ga0157369_10000016
566 Ga0157369_10004050
567 Ga0157369_10122617
568 Ga0157369_10294778
569 Ga0157369_10393357
570 Ga0157374_10030641
571 Ga0157374_10077301
572 Ga0157378_10008303
573 Ga0157378_10060889
574 Ga0157378_10186521
575 Ga0157378_10629553
576 Ga0163162_10001202
577 Ga0163162_10044820
578 Ga0163162_10070743
579 Ga0163162_10339588
580 Ga0157372_10000030
581 Ga0157372_10000332
582 Ga0157372_10001364
583 Ga0157372_10003430
584 Ga0157372_10011651
585 Ga0157372_10037880
586 Ga0157372_10086212
587 Ga0157372_10123218
588 Ga0157375_10022074
589 Ga0157375_10081872
590 Ga0157375_10187566
591 Ga0157375_10369293
592 Ga0163163_10277413
593 Ga0157380_10004578
594 Ga0182008_10000034
595 Ga0182008_10000600
596 Ga0182008_10003643
597 Ga0157377_10134890
598 Ga0157376_10436747
599 Ga0182006_1000103
600 Ga0182006_1006389
601 Ga0182006_1008481
602 Ga0182006_1020413
603 Ga0182006_1032340
604 Ga0182007_10000002
605 Ga0182007_10005771
606 Ga0183373_1004
607 Ga0163161_10013535
608 Ga0163161_10044157
609 Ga0163161_10050338
610 Ga0163161_10087977
611 Ga0163161_10098092
612 Ga0163161_10347618
613 Ga0197907_11036902
614 Ga0206351_10267476
615 Ga0206351_10512829
616 Ga0154015_1037437
617 Ga0154015_1495562
618 Ga0213872_10006418
619 Ga0207427_100025
620 Ga0209437_100010
621 Ga0209437_100135
622 Ga0207425_1000008
623 Ga0209026_1000610
624 Ga0209026_1004500
625 Ga0209129_1000040
626 Ga0209233_1000017
627 Ga0209233_1001079
628 Ga0209455_1001879
629 Ga0209676_1000009
630 Ga0209025_1000020
631 Ga0209758_1000022
632 Ga0209050_1000048
633 Ga0207656_10002394
634 Ga0207655_1034651
635 Ga0207647_10000171
636 Ga0207647_10022536
637 Ga0207647_10032931
638 Ga0207645_10000035
639 Ga0207705_10000108
640 Ga0207654_10034290
641 Ga0207654_10138162
642 Ga0207707_10032972
643 Ga0207695_10000053
644 Ga0207695_10039657
645 Ga0207695_10057771
646 Ga0207695_10080728
647 Ga0207695_10501005
648 Ga0207695_10611693
649 Ga0207671_10005849
650 Ga0207671_10011776
651 Ga0207671_10013363
652 Ga0207671_10014424
653 Ga0207671_10018120
654 Ga0207671_10034795
655 Ga0207671_10053614
656 Ga0207671_10129273
657 Ga0207660_10024307
658 Ga0207657_10023513
659 Ga0207657_10058573
660 Ga0207657_10280514
661 Ga0207657_10316176
662 Ga0207652_10002419
663 Ga0207694_10009649
664 Ga0207694_10042226
665 Ga0207644_10013551
666 Ga0207690_10000936
667 Ga0207690_10005948
668 Ga0207706_10019009
669 Ga0207709_10000026
670 Ga0207704_10000036
671 Ga0207667_10000430
672 Ga0207667_10023666
673 Ga0207667_10041900
674 Ga0207667_10076563
675 Ga0207667_10152883
676 Ga0207651_10009416
677 Ga0207677_10112728
678 Ga0207639_10030197
679 Ga0207639_10034930
680 Ga0207639_10131675
681 Ga0207678_10131111
682 Ga0207702_10010443
683 Ga0207702_10010590
684 Ga0207702_10218656
685 Ga0207648_10000333
686 Ga0207674_10090260
687 Ga0207683_10003418
688 Ga0207698_10013453
689 Ga0207698_10102517
690 Ga0268266_10000658
691 Ga0307517_10012583
692 Ga0307515_10007084
693 Ga0307515_10067820
694 Ga0307515_10212142
695 Ga0307515_10315415
696 Ga0265338_10007954
697 Ga0316183_1033300
698 Ga0316181_1034557
699 Ga0316182_1296934
700 Ga0265327_10000370
701 Ga0265327_10041391
702 Ga0307408_100073008
703 Ga0307408_100134877
704 Ga0316576_10219645
705 Ga0307405_10000006
706 Ga0307405_10047315
707 Ga0307413_10054157
708 Ga0307407_10000003
709 Ga0307412_10002079
710 Ga0307412_10003796
711 Ga0307412_10041647
712 Ga0307412_10183233
713 Ga0307412_10185828
714 Ga0307409_100068515
715 Ga0307409_100104059
716 Ga0307416_100000002
717 Ga0307416_100079899
718 Ga0307416_100920455
719 Ga0307414_10005329
720 Ga0307414_10005856
721 Ga0307414_10009488
722 Ga0307414_10012166
723 Ga0307414_10014141
724 Ga0307414_10078172
725 Ga0307414_10110482
726 Ga0307414_10163161
727 Ga0307414_10236098
728 Ga0307414_10274833
729 Ga0307411_10126165
730 Ga0307411_10296538
731 Ga0307507_10000034
732 Ga0307510_10003892
733 Ga0316592_1005027
734 Ga0316592_1045321
735 Ga0316592_1049986
736 Ga0316588_1035814
737 Ga0395899_0000021
738 Ga0395899_0000034
739 Ga0395899_0000472
740 Ga0395899_0000499
741 Ga0395899_0050121
742 Ga0395900_0000346
743 Ga0395900_0001482
744 Ga0395900_0199077
745 Ga0395898_0021701
746 Ga0395898_0063979
747 Ga0395905_0000001
748 Ga0395905_0000528
749 Ga0395905_0002993
750 Ga0395905_0127136
751 Ga0395901_0000351
752 Ga0395901_0007776
753 Ga0436361_0433548
754 Ga0439448_0011844
755 Ga0439457_021694
756 Ga0466969_0040631
757 Ga0453683_0313753
758 Ga0466966_0001476
759 Ga0466961_0160913
760 Ga0453684_0004131
761 Ga0453684_0133450
762 Ga0453684_0156006
763 Ga0453684_0162796
764 Ga0466959_0100874
765 Ga0466959_0209237
766 Ga0466958_0007843
767 Ga0495650_0000023
768 Ga0495585_0000476
769 Ga0495585_0001907
770 Ga0495583_0034187
771 Ga0495583_0105868
772 Ga0495606_0003554
773 Ga0495606_0006936
774 Ga0495606_0010457
775 Ga0495606_0049128
776 Ga0495606_0363794
777 Ga0495610_0020639
778 Ga0495610_0044214
779 Ga0495616_0029922
780 Ga0495616_0136857
781 Ga0495631_0002385
782 Ga0495631_0076583
783 Ga0495637_0047921
784 Ga0495637_0083256
785 Ga0495648_0017616
786 Ga0495652_0121985
787 Ga0495609_0004523
788 Ga0495609_0006730
789 Ga0495633_0000072
790 Ga0495633_0016150
791 Ga0495633_0025488
792 Ga0495668_0000165
793 Ga0495611_0059991
794 Ga0495625_0000308
795 Ga0495625_0047299
796 Ga0495625_0072461
797 Ga0495625_0077697
798 Ga0495625_0137903
799 Ga0495625_0176714
800 Ga0495625_0207069
801 Ga0495625_0209952
802 Ga0495625_0289001
803 Ga0495661_0022092
804 Ga0495661_0040831
805 Ga0495599_0161066
806 Ga0495649_0000105
807 Ga0495649_0167431
808 Ga0495660_0086890
809 Ga0495687_000233
810 Ga0495673_0013740
811 Ga0495686_0002422
812 Ga0495686_0010199
813 Ga0495686_0092084
814 Ga0495686_0241084
815 Ga0496114_0091395
816 Ga0496116_0005535
817 Ga0496117_0001863
818 Ga0496118_0025644
819 Ga0496122_0000862
820 Ga0496122_0006922
821 Ga0496123_0013292
822 Ga0496123_0015001
823 Ga0496124_0039503
824 Ga0496125_0048493
825 Ga0496125_0134546
826 Ga0496126_0060412
827 Ga0501311_005256
828 Ga0501323_009281
829 Ga0501198_003579
830 Ga0501223_000581
831 Ga0501280_012957
832 nmdc:mga0k408_2228_c1
833 nmdc:mga0k408_22365_c1
834 nmdc:mga0k408_349_c1
835 nmdc:mga0k408_86571_c2
836 nmdc:mga07m45_50194_c1
837 Ga0500651_0000078
838 Ga0500608_040061
839 Ga0500618_000057
840 Ga0500618_030023
841 Ga0500579_100265
842 Ga0500622_0000385
843 2586210038
844 2599479373
845 2722726186
846 2738755668
847 2738762115
848 2738854410
849 2739301905
850 2739587962
851 2739614387
852 2739646681
853 2776615259
854 2819545838
855 2842724269
856 2842908287
857 2842913597
858 2849282591
859 2852625385
860 2852629122
861 2857631660
862 2884934396
863 2890740654
864 2896320829
865 2896346878
866 2898716217
867 2902051179
868 2904449078
869 2904782797
870 2919180407
871 2919189080
872 2919438026
873 2928082317
874 2928149104
875 2932085029
876 2939666765
877 2945998908
878 2954021351
879 2977235862
880 3003234783

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

16

249

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9884 3 251
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9838 3 250
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9804 3 249
8bqx-assembly1.cif.gz_x yeast 80s ribosome in complex with map1 (conformation 2) 0.977 3 249
2b3k-assembly1.cif.gz_A crystal structure of human methionine aminopeptidase type i in the holo form 0.9749 1 249
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9875 3 249 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9812 50 249 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.981 16 126 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9804 3 249 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.978 3 249 3.90.230.10
ID Description Score Start End GO Terms
AF-A6EHP3-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 1.002 25 261 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A317EX38-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9981 3 259 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A4Q3Q0Z2-F1-model_v4 deleted 0.9976 69 256
AF-A0A661YHV2-F1-model_v4 deleted 0.9965 3 224
AF-A0A356ZCU1-F1-model_v4 Type I methionyl aminopeptidase 0.9956 85 190 GO:0005829
GO:0006508
GO:0070006

Map