F444484

General Info

Members Datasets Scaffolds Average Seq Length
440 239 423 342

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0010814|Ga0466967_0010814_2104_3243
Length 379
Sequence MERLPWPQVGRTDIRRRALPRHRVRSGTRSSNFPKGGGVRLGYHTGYWAAGPPAGVTDAIAECERLGFDSIWTAEAYGSDCLTPLAWWGAATSSVRLGTNIMQMSARTPVAAAMAAITLDHLSGGRFVLGLGASGPQVVEGWYGQPYPKPLARTREYIAIIRKVLARDEPVTFDGQFYPLPYPGGAGLGKPLKSTVHPLRNDIPIMLGAEGPKNVALAAEITDGWLPMFFSPKMDGFYRDALAEGFARPGARHTAETFEVPAFVPVVINDDVEEAANMIRPSIALYIGGMGAASMNFHANHFGRLGYEAEVAKIQELFLSGRKLEAVGAVPTAMVEDIALIGPVAKIRDELQLWESTVITSLIIQAPPQSLPAVANVLS

Samples

Sample ID Description Type Environment
1 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
5 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
6 2558860280 Kutzneria sp. 744 Isolate Unclassified
7 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
8 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
9 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
10 2643221721 Oerskovia sp. Root918 Isolate Unclassified
11 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
12 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
13 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
14 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
15 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
124 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
239 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.14
Metatranscriptomes 0
Isolates 3.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0.23
Rhizoplane 1.82
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 3.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10139371 3300005288 Bacteria 1183
2 Ga0070683_100487979 3300005329 Bacteria 1176
3 Ga0068868_100032071 3300005338 Bacteria 4039
4 Ga0070661_100012287 3300005344 Bacteria 5987
5 Ga0070692_10010527 3300005345 Bacteria 4214
6 Ga0070659_100014882 3300005366 Bacteria 5818
7 Ga0070709_10000079 3300005434 Bacteria 72360
8 Ga0070714_100003707 3300005435 Bacteria 11441
9 Ga0070714_100021729 3300005435 Bacteria 5252
10 Ga0070714_100027829 3300005435 Bacteria 4684
11 Ga0070714_100129637 3300005435 Bacteria 2253
12 Ga0070714_100312043 3300005435 Bacteria 1469
13 Ga0070713_100017881 3300005436 Bacteria 5377
14 Ga0070713_100022045 3300005436 Bacteria 4915
15 Ga0070713_100024718 3300005436 Bacteria 4686
16 Ga0070713_100097500 3300005436 Bacteria 2540
17 Ga0070710_10023591 3300005437 Bacteria 3235
18 Ga0070700_100002128 3300005441 Bacteria 10044
19 Ga0070694_100007140 3300005444 Bacteria 6800
20 Ga0070708_100018687 3300005445 Bacteria 5802
21 Ga0070663_100004098 3300005455 Bacteria 8512
22 Ga0070663_100054317 3300005455 Bacteria 2863
23 Ga0070681_10350718 3300005458 Bacteria 1386
24 Ga0070706_100225335 3300005467 Bacteria 1750
25 Ga0070679_100443261 3300005530 Bacteria 1243
26 Ga0070684_100035010 3300005535 Bacteria 4296
27 Ga0068853_100022970 3300005539 Bacteria 5216
28 Ga0070664_100048759 3300005564 Bacteria 3579
29 Ga0068856_100024264 3300005614 Bacteria 5901
30 Ga0068852_100013162 3300005616 Bacteria 6323
31 Ga0068858_100302865 3300005842 Bacteria 1525
32 Ga0068862_100057353 3300005844 Bacteria 3340
33 Ga0081455_10002172 3300005937 Bacteria 23388
34 Ga0081538_10000984 3300005981 Bacteria 30176
35 Ga0081538_10002372 3300005981 Bacteria 18516
36 Ga0070717_10024837 3300006028 Bacteria 4762
37 Ga0075365_10141378 3300006038 Bacteria 1671
38 Ga0075365_10225567 3300006038 Bacteria 1315
39 Ga0075363_100019799 3300006048 Bacteria 3369
40 Ga0070716_100003443 3300006173 Bacteria 7449
41 Ga0070712_100043553 3300006175 Bacteria 3090
42 Ga0075362_10035489 3300006177 Bacteria 2177
43 Ga0075428_100036634 3300006844 Bacteria 5403
44 Ga0075428_100038855 3300006844 Bacteria 5237
45 Ga0075430_100000956 3300006846 Bacteria 22763
46 Ga0075430_100002723 3300006846 Bacteria 14747
47 Ga0075431_100000493 3300006847 Bacteria 32801
48 Ga0075431_100001689 3300006847 Bacteria 20716
49 Ga0075431_100004565 3300006847 Bacteria 13597
50 Ga0075431_100047362 3300006847 Bacteria 4432
51 Ga0075429_100002333 3300006880 Bacteria 15950
52 Ga0075429_100003899 3300006880 Bacteria 12744
53 Ga0075429_100009951 3300006880 Bacteria 8240
54 Ga0075429_100146372 3300006880 Bacteria 2067
55 Ga0105240_10040594 3300009093 Bacteria 5949
56 Ga0111539_10000875 3300009094 Bacteria 39347
57 Ga0111539_10002197 3300009094 Bacteria 26053
58 Ga0111539_10118535 3300009094 Bacteria 3102
59 Ga0105245_10019940 3300009098 Bacteria 5879
60 Ga0105245_10032566 3300009098 Bacteria 4615
61 Ga0105245_10037967 3300009098 Bacteria 4283
62 Ga0114129_10012251 3300009147 Bacteria 12202
63 Ga0114129_10019428 3300009147 Bacteria 9673
64 Ga0114129_10034681 3300009147 Bacteria 7128
65 Ga0114129_10056395 3300009147 Bacteria 5503
66 Ga0114129_10144918 3300009147 Bacteria 3254
67 Ga0114129_10503417 3300009147 Bacteria 1582
68 Ga0105243_10098624 3300009148 Bacteria 2421
69 Ga0105241_10103310 3300009174 Bacteria 2269
70 Ga0105242_10369602 3300009176 Bacteria 1330
71 Ga0105238_10054926 3300009551 Bacteria 3999
72 Ga0105239_10126652 3300010375 Bacteria 2839
73 Ga0157369_10101056 3300013105 Bacteria 3074
74 Ga0157378_10462965 3300013297 Bacteria 1260
75 Ga0157375_10542081 3300013308 Bacteria 1326
76 Ga0213873_10021833 3300021358 Bacteria 1510
77 Ga0213875_10005802 3300021388 Bacteria 6571
78 Ga0207692_10079796 3300025898 Bacteria 1747
79 Ga0207647_10041074 3300025904 Bacteria 2910
80 Ga0207699_10000019 3300025906 Bacteria 180307
81 Ga0207645_10168869 3300025907 Bacteria 1433
82 Ga0207707_10331933 3300025912 Bacteria 1312
83 Ga0207695_10050708 3300025913 Bacteria 4363
84 Ga0207693_10014873 3300025915 Bacteria 6250
85 Ga0207693_10154353 3300025915 Bacteria 1806
86 Ga0207657_10128687 3300025919 Bacteria 2077
87 Ga0207694_10098847 3300025924 Bacteria 2311
88 Ga0207659_10038032 3300025926 Bacteria 3344
89 Ga0207687_10023930 3300025927 Bacteria 4075
90 Ga0207687_10172682 3300025927 Bacteria 1669
91 Ga0207700_10002086 3300025928 Bacteria 11402
92 Ga0207700_10016225 3300025928 Bacteria 4943
93 Ga0207700_10068666 3300025928 Bacteria 2717
94 Ga0207700_10105056 3300025928 Bacteria 2261
95 Ga0207664_10012118 3300025929 Bacteria 6159
96 Ga0207664_10263711 3300025929 Bacteria 1507
97 Ga0207686_10134406 3300025934 Bacteria 1701
98 Ga0207709_10040249 3300025935 Bacteria 2797
99 Ga0207665_10011602 3300025939 Bacteria 5789
100 Ga0207691_10303466 3300025940 Bacteria 1371
101 Ga0207689_10004771 3300025942 Bacteria 12227
102 Ga0207661_10181917 3300025944 Bacteria 1837
103 Ga0207661_10250166 3300025944 Bacteria 1575
104 Ga0207679_10012252 3300025945 Bacteria 5586
105 Ga0207667_10015050 3300025949 Bacteria 8800
106 Ga0207667_10099484 3300025949 Bacteria 3000
107 Ga0207667_10226805 3300025949 Bacteria 1913
108 Ga0207677_10027474 3300026023 Bacteria 3584
109 Ga0207639_10073264 3300026041 Bacteria 2684
110 Ga0207639_10117062 3300026041 Bacteria 2183
111 Ga0207678_10005683 3300026067 Bacteria 11142
112 Ga0207675_100054974 3300026118 Bacteria 3714
113 Ga0207683_10287654 3300026121 Bacteria 1503
114 Ga0207698_10009391 3300026142 Bacteria 6235
115 Ga0207698_10218440 3300026142 Bacteria 1720
116 Ga0207428_10004529 3300027907 Bacteria 13182
117 Ga0207428_10079489 3300027907 Bacteria 2564
118 Ga0307511_10000355 3300030521 Bacteria 48642
119 Ga0265327_10000264 3300031251 Bacteria 103984
120 Ga0265327_10092651 3300031251 Bacteria 1471
121 Ga0316576_10025861 3300031727 Bacteria 4113
122 Ga0316578_10041014 3300031728 Bacteria 2679
123 Ga0316578_10134832 3300031728 Bacteria 1486
124 Ga0307413_10021265 3300031824 Bacteria 3470
125 Ga0307410_10027475 3300031852 Bacteria 3597
126 Ga0307410_10036286 3300031852 Bacteria 3209
127 Ga0307409_100569874 3300031995 Bacteria 1114
128 Ga0307414_10072790 3300032004 Bacteria 2484
129 Ga0307414_10120531 3300032004 Bacteria 2016
130 Ga0307415_100015673 3300032126 Bacteria 4496
131 Ga0307415_100047428 3300032126 Bacteria 2892
132 Ga0307415_100171620 3300032126 Bacteria 1692
133 Ga0316580_10037092 3300032139 Bacteria 1508
134 Ga0373934_0000065 3300035086 Bacteria 35636
135 Ga0373934_0014380 3300035086 Bacteria 2999
136 Ga0373934_0029275 3300035086 Bacteria 2149
137 Ga0373923_0054140 3300035111 Bacteria 1688
138 Ga0373936_0016826 3300035113 Bacteria 2814
139 Ga0373945_0004839 3300035116 Bacteria 4289
140 Ga0373953_0000055 3300035117 Bacteria 28969
141 Ga0373953_0016068 3300035117 Bacteria 2726
142 Ga0373953_0027847 3300035117 Bacteria 2174
143 Ga0373956_0000141 3300035119 Bacteria 26025
144 Ga0373956_0082486 3300035119 Bacteria 1476
145 Ga0373957_0000093 3300035120 Bacteria 21429
146 Ga0373957_0009333 3300035120 Bacteria 3209
147 Ga0373955_0000207 3300035172 Bacteria 24476
148 Ga0373955_0070132 3300035172 Bacteria 1957
149 Ga0316574_0007959 3300035398 Bacteria 5854
150 Ga0316574_0085787 3300035398 Bacteria 2003
151 Ga0316574_0222202 3300035398 Bacteria 1210
152 Ga0373924_0000073 3300035410 Bacteria 26960
153 Ga0373924_0049406 3300035410 Bacteria 1740
154 Ga0373935_0184046 3300035692 Bacteria 1436
155 Ga0373933_0000054 3300035724 Bacteria 69499
156 Ga0373933_0083115 3300035724 Bacteria 1966
157 Ga0373947_0107600 3300035725 Bacteria 1758
158 Ga0373937_0000002 3300036401 Bacteria 304133
159 Ga0373937_0019452 3300036401 Bacteria 6079
160 Ga0316582_0030874 3300036647 Bacteria 3269
161 Ga0316584_0030481 3300036712 Bacteria 3984
162 Ga0316584_0077476 3300036712 Bacteria 2490
163 Ga0373925_0000607 3300037068 Bacteria 34152
164 Ga0373925_0050750 3300037068 Bacteria 3095
165 Ga0373925_0081496 3300037068 Bacteria 2461
166 Ga0316581_0033715 3300037588 Bacteria 1547
167 Ga0436364_0339865 3300037853 Bacteria 7330
168 Ga0436364_1067854 3300037853 Bacteria 29581
169 Ga0400485_00196 3300038735 Bacteria 12454
170 Ga0400483_145231 3300039062 Bacteria 12238
171 Ga0400483_285242 3300039062 Bacteria 19803
172 Ga0436365_0243059 3300039437 Bacteria 3706
173 Ga0436365_1458705 3300039437 Bacteria 5808
174 Ga0436362_0257049 3300039453 Bacteria 2796
175 Ga0439450_000417 3300042008 Bacteria 5502
176 Ga0439464_0007544 3300042439 Bacteria 2845
177 Ga0439460_0004950 3300042461 Bacteria 3254
178 Ga0451577_0004051 3300042876 Bacteria 15754
179 Ga0439440_0000279 3300042993 Bacteria 8252
180 Ga0466969_0073865 3300044656 Bacteria 1636
181 Ga0466969_0097949 3300044656 Bacteria 1383
182 Ga0466972_0000845 3300044658 Bacteria 14692
183 Ga0466972_0021321 3300044658 Bacteria 3231
184 Ga0466965_0062673 3300044683 Bacteria 1860
185 Ga0466966_0004911 3300044684 Bacteria 8791
186 Ga0466966_0049290 3300044684 Bacteria 2682
187 Ga0466966_0071830 3300044684 Bacteria 2168
188 Ga0466966_0076552 3300044684 Bacteria 2089
189 Ga0466966_0088664 3300044684 Bacteria 1922
190 Ga0466961_0014295 3300044693 Bacteria 5095
191 Ga0466961_0019936 3300044693 Bacteria 4316
192 Ga0466961_0021453 3300044693 Bacteria 4157
193 Ga0466961_0034536 3300044693 Bacteria 3247
194 Ga0466961_0072195 3300044693 Bacteria 2189
195 Ga0466963_0148128 3300044694 Bacteria 1629
196 Ga0466963_0156278 3300044694 Bacteria 1586
197 Ga0453684_0025752 3300044712 Bacteria 8529
198 Ga0466971_0006584 3300044719 Bacteria 5048
199 Ga0466971_0006995 3300044719 Bacteria 4909
200 Ga0466971_0062135 3300044719 Bacteria 1690
201 Ga0466970_0010967 3300044765 Bacteria 4609
202 Ga0466970_0013547 3300044765 Bacteria 4183
203 Ga0466970_0099267 3300044765 Bacteria 1585
204 Ga0466957_0002111 3300044842 Bacteria 10639
205 Ga0466957_0031460 3300044842 Bacteria 3171
206 Ga0466957_0238363 3300044842 Bacteria 1206
207 Ga0466959_0002045 3300045049 Bacteria 12753
208 Ga0466959_0028607 3300045049 Bacteria 4133
209 Ga0466959_0083557 3300045049 Bacteria 2299
210 Ga0466958_0016562 3300045836 Bacteria 4246
211 Ga0466958_0085371 3300045836 Bacteria 1947
212 Ga0466958_0126237 3300045836 Bacteria 1604
213 Ga0466958_0189598 3300045836 Bacteria 1306
214 Ga0466967_0000890 3300045976 Bacteria 15947
215 Ga0466967_0002084 3300045976 Bacteria 12245
216 Ga0466967_0004776 3300045976 Bacteria 9225
217 Ga0466967_0010814 3300045976 Bacteria 6869
218 Ga0466967_0042536 3300045976 Bacteria 3927
219 Ga0466967_0077241 3300045976 Bacteria 2997
220 Ga0466967_0115802 3300045976 Bacteria 2469
221 Ga0495592_0000003 3300046454 Bacteria 200744
222 Ga0495592_0008722 3300046454 Bacteria 7611
223 Ga0495592_0094886 3300046454 Bacteria 2134
224 Ga0495629_0007473 3300046459 Bacteria 8055
225 Ga0495629_0225254 3300046459 Bacteria 1293
226 Ga0495641_0062426 3300046461 Bacteria 1681
227 Ga0495651_0000036 3300046462 Bacteria 97779
228 Ga0495651_0203517 3300046462 Bacteria 1383
229 Ga0495653_0000406 3300046463 Bacteria 34551
230 Ga0495582_0003331 3300046473 Bacteria 9032
231 Ga0495582_0038008 3300046473 Bacteria 2648
232 Ga0495639_0055748 3300046475 Bacteria 1803
233 Ga0495662_0005200 3300046476 Bacteria 6523
234 Ga0495608_0000018 3300046511 Bacteria 192512
235 Ga0495608_0039552 3300046511 Bacteria 3160
236 Ga0495608_0081757 3300046511 Bacteria 2099
237 Ga0495608_0085206 3300046511 Bacteria 2048
238 Ga0495618_0081541 3300046514 Bacteria 2065
239 Ga0495618_0186877 3300046514 Bacteria 1315
240 Ga0495628_0000020 3300046516 Bacteria 148606
241 Ga0495628_0069145 3300046516 Bacteria 2754
242 Ga0495628_0125553 3300046516 Bacteria 1966
243 Ga0495630_0188029 3300046517 Bacteria 1576
244 Ga0495652_0000013 3300046529 Bacteria 238164
245 Ga0495652_0029110 3300046529 Bacteria 4852
246 Ga0495665_0000934 3300046531 Bacteria 15400
247 Ga0495640_0074986 3300046533 Bacteria 2260
248 Ga0495640_0119738 3300046533 Bacteria 1712
249 Ga0495587_0000014 3300046536 Bacteria 192100
250 Ga0495587_0007343 3300046536 Bacteria 7142
251 Ga0495587_0122063 3300046536 Bacteria 1492
252 Ga0495645_0014997 3300046543 Bacteria 5506
253 Ga0495645_0075152 3300046543 Bacteria 2432
254 Ga0495667_0000014 3300046559 Bacteria 200767
255 Ga0495667_0002110 3300046559 Bacteria 13220
256 Ga0495634_0013448 3300046642 Bacteria 5913
257 Ga0495634_0128393 3300046642 Bacteria 1618
258 Ga0495634_0203478 3300046642 Bacteria 1229
259 Ga0495635_0005720 3300046663 Bacteria 8660
260 Ga0495635_0030408 3300046663 Bacteria 3752
261 Ga0495635_0094184 3300046663 Bacteria 2048
262 Ga0495657_0000012 3300046675 Bacteria 197154
263 Ga0495657_0003138 3300046675 Bacteria 13641
264 Ga0495657_0003587 3300046675 Bacteria 12627
265 Ga0495657_0086114 3300046675 Bacteria 2024
266 Ga0495599_0000037 3300046678 Bacteria 101892
267 Ga0495623_0000079 3300046679 Bacteria 57590
268 Ga0495623_0006940 3300046679 Bacteria 7361
269 Ga0495646_0013031 3300046680 Bacteria 5284
270 Ga0495646_0022876 3300046680 Bacteria 3938
271 Ga0495646_0117270 3300046680 Bacteria 1509
272 Ga0495647_0077654 3300046681 Bacteria 1341
273 Ga0495658_0003553 3300046683 Bacteria 7711
274 Ga0495613_0002509 3300046689 Bacteria 13835
275 Ga0495624_0078327 3300046690 Bacteria 2050
276 Ga0495600_0005350 3300046809 Bacteria 7735
277 Ga0495581_0111923 3300047315 Bacteria 1587
278 Ga0495604_0000054 3300047317 Bacteria 101084
279 Ga0495604_0052896 3300047317 Bacteria 3142
280 Ga0495604_0289945 3300047317 Bacteria 1102
281 Ga0495674_0254711 3300047319 Bacteria 1443
282 Ga0495676_0115101 3300047321 Bacteria 1967
283 Ga0495680_0000003 3300047322 Bacteria 172246
284 Ga0495680_0002716 3300047322 Bacteria 17868
285 Ga0495680_0029036 3300047322 Bacteria 4531
286 Ga0495680_0051260 3300047322 Bacteria 3223
287 Ga0495675_0000389 3300047444 Bacteria 30325
288 Ga0495675_0012691 3300047444 Bacteria 5302
289 Ga0495684_0040441 3300047471 Bacteria 3574
290 Ga0495684_0126431 3300047471 Bacteria 1923
291 Ga0495684_0154516 3300047471 Bacteria 1714
292 Ga0495593_0054720 3300047673 Bacteria 2102
293 Ga0495602_0000014 3300048088 Bacteria 193335
294 Ga0495602_0022283 3300048088 Bacteria 6206
295 Ga0495602_0089608 3300048088 Bacteria 2557
296 Ga0495602_0169059 3300048088 Bacteria 1698
297 Ga0495614_0028350 3300048089 Bacteria 2412
298 Ga0495614_0029709 3300048089 Bacteria 2352
299 Ga0496100_0018278 3300048903 Bacteria 4155
300 Ga0496104_0020111 3300048907 Bacteria 6117
301 Ga0496104_0075131 3300048907 Bacteria 3218
302 Ga0496109_0223023 3300048912 Bacteria 1773
303 Ga0496110_0012453 3300048913 Bacteria 6994
304 Ga0496111_0343795 3300048914 Bacteria 1104
305 Ga0496112_0034603 3300048915 Bacteria 4916
306 Ga0496113_0037302 3300048916 Bacteria 3565
307 Ga0496118_0042351 3300048921 Bacteria 3593
308 Ga0501031_0019663 3300049568 Bacteria 4399
309 Ga0501031_0047590 3300049568 Bacteria 2796
310 Ga0501031_0059467 3300049568 Bacteria 2491
311 Ga0501032_0153384 3300049569 Bacteria 1514
312 Ga0501033_0035384 3300049570 Bacteria 3744
313 Ga0501033_0090062 3300049570 Bacteria 2244
314 Ga0501034_0001361 3300049571 Bacteria 33010
315 Ga0501036_0129473 3300049572 Bacteria 2131
316 Ga0501036_0284519 3300049572 Bacteria 1384
317 Ga0501036_0332514 3300049572 Bacteria 1269
318 Ga0501036_0426977 3300049572 Bacteria 1105
319 Ga0501037_0008857 3300049573 Bacteria 7371
320 Ga0501038_0023949 3300049574 Bacteria 5452
321 Ga0501038_0032117 3300049574 Bacteria 4634
322 Ga0501039_0022359 3300049575 Bacteria 4854
323 Ga0501039_0074054 3300049575 Bacteria 2646
324 Ga0501040_0002315 3300049576 Bacteria 12235
325 Ga0501040_0005753 3300049576 Bacteria 8022
326 Ga0501040_0031560 3300049576 Bacteria 3582
327 Ga0501040_0087811 3300049576 Bacteria 2159
328 Ga0501041_0007892 3300049577 Bacteria 6254
329 Ga0501041_0039105 3300049577 Bacteria 2878
330 Ga0501041_0066767 3300049577 Bacteria 2204
331 Ga0501042_0001926 3300049578 Bacteria 12494
332 Ga0501042_0010774 3300049578 Bacteria 6147
333 Ga0501042_0015127 3300049578 Bacteria 5276
334 Ga0501042_0091653 3300049578 Bacteria 2182
335 Ga0501042_0169218 3300049578 Bacteria 1577
336 Ga0501043_0033049 3300049579 Bacteria 4069
337 Ga0501046_0111989 3300049580 Bacteria 2084
338 Ga0501046_0256170 3300049580 Bacteria 1287
339 Ga0501047_0116691 3300049581 Bacteria 2551
340 Ga0501048_0157546 3300049582 Bacteria 1606
341 Ga0501067_0048690 3300049583 Bacteria 2350
342 Ga0501068_0004004 3300049584 Bacteria 8017
343 Ga0501068_0026155 3300049584 Bacteria 3437
344 Ga0501069_0005824 3300049585 Bacteria 6417
345 Ga0501070_0000447 3300049586 Bacteria 37526
346 Ga0501072_0003543 3300049588 Bacteria 11742
347 Ga0501072_0005533 3300049588 Bacteria 9607
348 Ga0501072_0021813 3300049588 Bacteria 4966
349 Ga0501072_0134557 3300049588 Bacteria 1971
350 Ga0501073_0001342 3300049589 Bacteria 18136
351 Ga0501073_0011347 3300049589 Bacteria 6518
352 Ga0501074_0078444 3300049590 Bacteria 2370
353 Ga0501074_0151408 3300049590 Bacteria 1658
354 Ga0501074_0170070 3300049590 Bacteria 1556
355 Ga0501075_0002181 3300049591 Bacteria 12953
356 Ga0501075_0031747 3300049591 Bacteria 3923
357 Ga0501075_0038180 3300049591 Bacteria 3590
358 Ga0501076_0010983 3300049592 Bacteria 6734
359 Ga0501076_0043067 3300049592 Bacteria 3556
360 Ga0501076_0075348 3300049592 Bacteria 2704
361 Ga0501076_0118964 3300049592 Bacteria 2139
362 Ga0501076_0190827 3300049592 Bacteria 1672
363 Ga0501077_0007641 3300049593 Bacteria 6672
364 Ga0501079_0069782 3300049741 Bacteria 2713
365 Ga0501079_0120823 3300049741 Bacteria 2037
366 Ga0501079_0170097 3300049741 Bacteria 1699
367 Ga0501080_0037769 3300049742 Bacteria 4509
368 Ga0501081_0013440 3300049743 Bacteria 5384
369 Ga0501081_0118061 3300049743 Bacteria 1887
370 Ga0501081_0223285 3300049743 Bacteria 1370
371 Ga0501083_0001590 3300049744 Bacteria 15515
372 Ga0501083_0037183 3300049744 Bacteria 3317
373 Ga0501083_0095454 3300049744 Bacteria 1962
374 Ga0501044_0022158 3300049823 Bacteria 6773
375 Ga0501044_0085074 3300049823 Bacteria 3196
376 Ga0501045_0042446 3300049824 Bacteria 3310
377 Ga0501045_0044067 3300049824 Bacteria 3249
378 Ga0501045_0244337 3300049824 Bacteria 1336
379 nmdc:mga0yw44_113112_c1 3300050492 Bacteria 1741
380 nmdc:mga0yw44_113791_c1 3300050492 Bacteria 1736
381 nmdc:mga05p37_107986_c1 3300050507 Bacteria 2894
382 nmdc:mga05p37_134536_c1 3300050507 Bacteria 3033
383 nmdc:mga05p37_184651_c1 3300050507 Bacteria 2536
384 nmdc:mga05p37_44765_c1 3300050507 Bacteria 5444
385 nmdc:mga09592_155051_c1 3300050508 Bacteria 1977
386 nmdc:mga09592_33394_c1 3300050508 Bacteria 4294
387 nmdc:mga09592_44410_c1 3300050508 Bacteria 3741
388 nmdc:mga09592_49194_c1 3300050508 Bacteria 3555
389 nmdc:mga09592_7678_c1 3300050508 Bacteria 8768
390 nmdc:mga0qj67_14332_c1 3300050509 Bacteria 5991
391 nmdc:mga0qj67_721_c1 3300050509 Bacteria 22503
392 nmdc:mga06r32_103990_c1 3300050510 Bacteria 2789
393 nmdc:mga06r32_778_c1 3300050510 Bacteria 28157
394 nmdc:mga08y16_238061_c1 3300050511 Bacteria 1882
395 nmdc:mga08y16_47420_c1 3300050511 Bacteria 4497
396 Ga0495601_0026797 3300053077 Bacteria 3560
397 Ga0495595_0000593 3300053084 Bacteria 13838
398 Ga0495595_0002257 3300053084 Bacteria 7505
399 Ga0495595_0007242 3300053084 Bacteria 4536
400 Ga0495595_0109240 3300053084 Bacteria 1340
401 Ga0495619_0009675 3300053085 Bacteria 6078
402 Ga0495619_0046850 3300053085 Bacteria 2844
403 Ga0495619_0167896 3300053085 Bacteria 1517
404 Ga0500568_0000032 3300053139 Bacteria 147655
405 Ga0501084_0000071 3300054114 Bacteria 76268
406 Ga0501084_0001216 3300054114 Bacteria 20230
407 Ga0501084_0002344 3300054114 Bacteria 15224
408 Ga0501084_0102167 3300054114 Bacteria 2408
409 Ga0501084_0280553 3300054114 Bacteria 1407
410 Ga0501084_0385204 3300054114 Bacteria 1185
411 Ga0590075_010203 3300059424 Bacteria 2259
412 Ga0501082_0022830 3300060353 Bacteria 5389
413 Ga0501082_0038363 3300060353 Bacteria 4133
414 Ga0501082_0094331 3300060353 Bacteria 2586
415 Ga0501082_0171897 3300060353 Bacteria 1884
416 Ga0501082_0258323 3300060353 Bacteria 1515
417 Ga0466962_0026426 3300061719 Bacteria 2787
418 Ga0466962_0039554 3300061719 Bacteria 2258
419 Ga0530510_0004534 3300061734 Bacteria 9614
420 Ga0530510_0016353 3300061734 Bacteria 5249
421 Ga0530510_0021739 3300061734 Bacteria 4566
422 Ga0530510_0032310 3300061734 Bacteria 3765
423 Ga0530510_0171957 3300061734 Bacteria 1605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0126431 Ga0495684_0126431_1023_1895 286
2 3300046536 Ga0495587_0122063 Ga0495587_0122063_529_1461 309
3 3300048903 Ga0496100_0018278 Ga0496100_0018278_3200_4141 312
4 3300005455 Ga0070663_100054317 Ga0070663_1000543172 314
5 3300025904 Ga0207647_10041074 Ga0207647_100410742 314
6 3300049568 Ga0501031_0059467 Ga0501031_0059467_801_1829 314
7 3300031251 Ga0265327_10000264 Ga0265327_1000026440 315
8 3300006038 Ga0075365_10225567 Ga0075365_102255672 316
9 3300050492 nmdc:mga0yw44_113112_c1 nmdc:mga0yw44_113112_c1_529_1596 316
10 3300006038 Ga0075365_10141378 Ga0075365_101413782 321
11 3300050492 nmdc:mga0yw44_113791_c1 nmdc:mga0yw44_113791_c1_540_1577 321
12 3300026041 Ga0207639_10117062 Ga0207639_101170622 322
13 3300026142 Ga0207698_10218440 Ga0207698_102184402 322
14 3300035398 Ga0316574_0085787 Ga0316574_0085787_1012_1989 323
15 3300042876 Ga0451577_0004051 Ga0451577_0004051_13327_14367 324
16 3300044712 Ga0453684_0025752 Ga0453684_0025752_5597_6637 324
17 3300054114 Ga0501084_0385204 Ga0501084_0385204_102_1139 324
18 3300044694 Ga0466963_0156278 Ga0466963_0156278_107_1132 327
19 3300045976 Ga0466967_0077241 Ga0466967_0077241_1019_2044 327
20 3300049570 Ga0501033_0035384 Ga0501033_0035384_529_1560 327
21 3300049572 Ga0501036_0332514 Ga0501036_0332514_11_1042 327
22 3300049574 Ga0501038_0023949 Ga0501038_0023949_4182_5213 327
23 3300049576 Ga0501040_0002315 Ga0501040_0002315_7409_8440 327
24 3300049577 Ga0501041_0039105 Ga0501041_0039105_1146_2177 327
25 3300049578 Ga0501042_0001926 Ga0501042_0001926_10432_11463 327
26 3300049579 Ga0501043_0033049 Ga0501043_0033049_1551_2582 327
27 3300049580 Ga0501046_0111989 Ga0501046_0111989_138_1169 327
28 3300049588 Ga0501072_0003543 Ga0501072_0003543_2701_3732 327
29 3300049590 Ga0501074_0078444 Ga0501074_0078444_343_1374 327
30 3300049592 Ga0501076_0075348 Ga0501076_0075348_1631_2662 327
31 3300049741 Ga0501079_0120823 Ga0501079_0120823_227_1258 327
32 3300049743 Ga0501081_0013440 Ga0501081_0013440_2076_3107 327
33 3300049744 Ga0501083_0095454 Ga0501083_0095454_568_1599 327
34 3300053139 Ga0500568_0000032 Ga0500568_0000032_91819_92853 327
35 3300054114 Ga0501084_0002344 Ga0501084_0002344_7403_8434 327
36 3300060353 Ga0501082_0022830 Ga0501082_0022830_2313_3344 327
37 3300061734 Ga0530510_0016353 Ga0530510_0016353_1550_2581 327
38 3300006048 Ga0075363_100019799 Ga0075363_1000197993 328
39 3300006177 Ga0075362_10035489 Ga0075362_100354892 328
40 3300005435 Ga0070714_100027829 Ga0070714_1000278292 330
41 3300005436 Ga0070713_100024718 Ga0070713_1000247182 330
42 3300025928 Ga0207700_10002086 Ga0207700_100020863 330
43 3300025929 Ga0207664_10012118 Ga0207664_100121182 330
44 3300035086 Ga0373934_0000065 Ga0373934_0000065_16859_17875 330
45 3300035086 Ga0373934_0014380 Ga0373934_0014380_1224_2240 330
46 3300035086 Ga0373934_0029275 Ga0373934_0029275_251_1315 330
47 3300035111 Ga0373923_0054140 Ga0373923_0054140_70_1134 330
48 3300035113 Ga0373936_0016826 Ga0373936_0016826_136_1200 330
49 3300035116 Ga0373945_0004839 Ga0373945_0004839_464_1528 330
50 3300035117 Ga0373953_0000055 Ga0373953_0000055_8298_9314 330
51 3300035117 Ga0373953_0016068 Ga0373953_0016068_272_1288 330
52 3300035117 Ga0373953_0027847 Ga0373953_0027847_833_1897 330
53 3300035119 Ga0373956_0000141 Ga0373956_0000141_11422_12438 330
54 3300035119 Ga0373956_0082486 Ga0373956_0082486_41_1105 330
55 3300035120 Ga0373957_0000093 Ga0373957_0000093_12048_13064 330
56 3300035120 Ga0373957_0009333 Ga0373957_0009333_775_1791 330
57 3300035172 Ga0373955_0000207 Ga0373955_0000207_23227_24243 330
58 3300035172 Ga0373955_0070132 Ga0373955_0070132_821_1885 330
59 3300035410 Ga0373924_0000073 Ga0373924_0000073_10046_11062 330
60 3300035410 Ga0373924_0049406 Ga0373924_0049406_346_1362 330
61 3300035724 Ga0373933_0000054 Ga0373933_0000054_51452_52468 330
62 3300035724 Ga0373933_0083115 Ga0373933_0083115_553_1569 330
63 3300035725 Ga0373947_0107600 Ga0373947_0107600_659_1723 330
64 3300036401 Ga0373937_0000002 Ga0373937_0000002_199913_200929 330
65 3300037068 Ga0373925_0000607 Ga0373925_0000607_9719_10735 330
66 3300037068 Ga0373925_0050750 Ga0373925_0050750_475_1539 330
67 3300046454 Ga0495592_0000003 Ga0495592_0000003_96553_97569 330
68 3300046454 Ga0495592_0094886 Ga0495592_0094886_373_1437 330
69 3300046459 Ga0495629_0007473 Ga0495629_0007473_5643_6707 330
70 3300046461 Ga0495641_0062426 Ga0495641_0062426_636_1658 330
71 3300046462 Ga0495651_0000036 Ga0495651_0000036_96572_97588 330
72 3300046462 Ga0495651_0203517 Ga0495651_0203517_151_1215 330
73 3300046463 Ga0495653_0000406 Ga0495653_0000406_6059_7075 330
74 3300046473 Ga0495582_0003331 Ga0495582_0003331_720_1784 330
75 3300046475 Ga0495639_0055748 Ga0495639_0055748_245_1309 330
76 3300046476 Ga0495662_0005200 Ga0495662_0005200_328_1392 330
77 3300046511 Ga0495608_0000018 Ga0495608_0000018_96549_97565 330
78 3300046511 Ga0495608_0039552 Ga0495608_0039552_279_1343 330
79 3300046511 Ga0495608_0081757 Ga0495608_0081757_1036_2052 330
80 3300046514 Ga0495618_0081541 Ga0495618_0081541_190_1254 330
81 3300046516 Ga0495628_0000020 Ga0495628_0000020_61642_62658 330
82 3300046516 Ga0495628_0125553 Ga0495628_0125553_372_1436 330
83 3300046517 Ga0495630_0188029 Ga0495630_0188029_478_1542 330
84 3300046529 Ga0495652_0000013 Ga0495652_0000013_96696_97712 330
85 3300046529 Ga0495652_0029110 Ga0495652_0029110_419_1435 330
86 3300046531 Ga0495665_0000934 Ga0495665_0000934_11709_12773 330
87 3300046533 Ga0495640_0119738 Ga0495640_0119738_227_1291 330
88 3300046536 Ga0495587_0000014 Ga0495587_0000014_96537_97553 330
89 3300046536 Ga0495587_0007343 Ga0495587_0007343_613_1677 330
90 3300046543 Ga0495645_0014997 Ga0495645_0014997_1243_2307 330
91 3300046543 Ga0495645_0075152 Ga0495645_0075152_344_1360 330
92 3300046559 Ga0495667_0000014 Ga0495667_0000014_103184_104200 330
93 3300046559 Ga0495667_0002110 Ga0495667_0002110_9107_10123 330
94 3300046642 Ga0495634_0013448 Ga0495634_0013448_516_1580 330
95 3300046663 Ga0495635_0030408 Ga0495635_0030408_427_1491 330
96 3300046675 Ga0495657_0000012 Ga0495657_0000012_100623_101639 330
97 3300046675 Ga0495657_0003138 Ga0495657_0003138_9806_10822 330
98 3300046675 Ga0495657_0086114 Ga0495657_0086114_716_1780 330
99 3300046678 Ga0495599_0000037 Ga0495599_0000037_74970_75986 330
100 3300046679 Ga0495623_0000079 Ga0495623_0000079_134_1150 330
101 3300046679 Ga0495623_0006940 Ga0495623_0006940_212_1228 330
102 3300046680 Ga0495646_0013031 Ga0495646_0013031_3400_4416 330
103 3300046680 Ga0495646_0117270 Ga0495646_0117270_167_1231 330
104 3300046681 Ga0495647_0077654 Ga0495647_0077654_145_1209 330
105 3300046683 Ga0495658_0003553 Ga0495658_0003553_5487_6551 330
106 3300046689 Ga0495613_0002509 Ga0495613_0002509_8435_9499 330
107 3300046690 Ga0495624_0078327 Ga0495624_0078327_855_1919 330
108 3300046809 Ga0495600_0005350 Ga0495600_0005350_3724_4788 330
109 3300047315 Ga0495581_0111923 Ga0495581_0111923_45_1109 330
110 3300047317 Ga0495604_0000054 Ga0495604_0000054_3315_4331 330
111 3300047317 Ga0495604_0289945 Ga0495604_0289945_19_1035 330
112 3300047319 Ga0495674_0254711 Ga0495674_0254711_76_1140 330
113 3300047322 Ga0495680_0000003 Ga0495680_0000003_74468_75484 330
114 3300047322 Ga0495680_0002716 Ga0495680_0002716_7776_8792 330
115 3300047322 Ga0495680_0051260 Ga0495680_0051260_1989_3053 330
116 3300047444 Ga0495675_0000389 Ga0495675_0000389_5376_6392 330
117 3300047444 Ga0495675_0012691 Ga0495675_0012691_961_2025 330
118 3300047673 Ga0495593_0054720 Ga0495593_0054720_558_1622 330
119 3300048088 Ga0495602_0000014 Ga0495602_0000014_95566_96582 330
120 3300048088 Ga0495602_0022283 Ga0495602_0022283_3212_4228 330
121 3300048088 Ga0495602_0089608 Ga0495602_0089608_500_1564 330
122 3300048089 Ga0495614_0028350 Ga0495614_0028350_606_1670 330
123 3300049571 Ga0501034_0001361 Ga0501034_0001361_15007_16038 330
124 3300049573 Ga0501037_0008857 Ga0501037_0008857_4970_6001 330
125 3300049584 Ga0501068_0004004 Ga0501068_0004004_142_1173 330
126 3300049588 Ga0501072_0005533 Ga0501072_0005533_5669_6700 330
127 3300049589 Ga0501073_0001342 Ga0501073_0001342_5405_6436 330
128 3300053077 Ga0495601_0026797 Ga0495601_0026797_599_1663 330
129 3300053084 Ga0495595_0000593 Ga0495595_0000593_543_1559 330
130 3300053084 Ga0495595_0002257 Ga0495595_0002257_1872_2936 330
131 3300053085 Ga0495619_0009675 Ga0495619_0009675_575_1639 330
132 3300053085 Ga0495619_0167896 Ga0495619_0167896_347_1363 330
133 3300005467 Ga0070706_100225335 Ga0070706_1002253353 331
134 3300046642 Ga0495634_0203478 Ga0495634_0203478_202_1203 331
135 3300005329 Ga0070683_100487979 Ga0070683_1004879791 333
136 3300039062 Ga0400483_145231 Ga0400483_145231_4517_5545 333
137 3300039062 Ga0400483_285242 Ga0400483_285242_14354_15382 333
138 3300025898 Ga0207692_10079796 Ga0207692_100797961 335
139 3300006844 Ga0075428_100036634 Ga0075428_1000366343 336
140 3300006846 Ga0075430_100002723 Ga0075430_1000027237 336
141 3300006847 Ga0075431_100004565 Ga0075431_10000456513 336
142 3300006880 Ga0075429_100002333 Ga0075429_10000233311 336
143 3300009147 Ga0114129_10056395 Ga0114129_100563953 336
144 3300009176 Ga0105242_10369602 Ga0105242_103696022 336
145 3300049572 Ga0501036_0426977 Ga0501036_0426977_11_1033 336
146 3300049824 Ga0501045_0244337 Ga0501045_0244337_246_1268 336
147 3300050507 nmdc:mga05p37_44765_c1 nmdc:mga05p37_44765_c1_2408_3421 336
148 3300050508 nmdc:mga09592_49194_c1 nmdc:mga09592_49194_c1_2272_3285 336
149 3300050509 nmdc:mga0qj67_721_c1 nmdc:mga0qj67_721_c1_12861_13874 336
150 iso_pu_bacteria 2515154088 2515494349 337
151 iso_pu_bacteria 2515154129 2515719619 337
152 iso_pu_bacteria 2515154137 2515757436 337
153 iso_pu_bacteria 2515154202 2516083956 337
154 iso_pu_bacteria 2515154203 2516088915 337
155 iso_pu_bacteria 8054472261 8054476242 337
156 iso_pu_bacteria 8055412473 8055416480 337
157 iso_pu_bacteria 2558860280 2559423968 338
158 iso_pu_bacteria 2738541308 2738888814 338
159 3300036647 Ga0316582_0030874 Ga0316582_0030874_58_1110 339
160 3300037588 Ga0316581_0033715 Ga0316581_0033715_49_1101 339
161 3300005539 Ga0068853_100022970 Ga0068853_1000229704 340
162 3300009098 Ga0105245_10032566 Ga0105245_100325666 340
163 3300009174 Ga0105241_10103310 Ga0105241_101033103 340
164 3300009551 Ga0105238_10054926 Ga0105238_100549262 340
165 3300013297 Ga0157378_10462965 Ga0157378_104629652 340
166 3300025924 Ga0207694_10098847 Ga0207694_100988471 340
167 3300025927 Ga0207687_10023930 Ga0207687_100239303 340
168 3300025934 Ga0207686_10134406 Ga0207686_101344062 340
169 3300026041 Ga0207639_10073264 Ga0207639_100732642 340
170 3300026121 Ga0207683_10287654 Ga0207683_102876542 340
171 3300030521 Ga0307511_10000355 Ga0307511_100003553 340
172 3300037068 Ga0373925_0081496 Ga0373925_0081496_92_1114 340
173 3300044684 Ga0466966_0049290 Ga0466966_0049290_61_1083 340
174 3300044693 Ga0466961_0019936 Ga0466961_0019936_967_1989 340
175 3300045049 Ga0466959_0002045 Ga0466959_0002045_10475_11497 340
176 3300046459 Ga0495629_0225254 Ga0495629_0225254_175_1200 340
177 3300046473 Ga0495582_0038008 Ga0495582_0038008_665_1690 340
178 3300046533 Ga0495640_0074986 Ga0495640_0074986_425_1450 340
179 3300048089 Ga0495614_0029709 Ga0495614_0029709_650_1675 340
180 3300049578 Ga0501042_0091653 Ga0501042_0091653_422_1459 340
181 3300061734 Ga0530510_0171957 Ga0530510_0171957_525_1550 340
182 iso_pu_bacteria 2585428094 2587863484 340
183 iso_pu_bacteria 2643221690 2644506385 340
184 iso_pu_bacteria 2643221694 2644526374 340
185 iso_pu_bacteria 2643221721 2644665060 340
186 iso_pu_bacteria 2643221722 2644671049 340
187 iso_pu_bacteria 2811994880 2812365690 340
188 iso_pu_bacteria 2932431166 2932434239 340
189 iso_pu_bacteria 2935890801 2935891229 340
190 3300005338 Ga0068868_100032071 Ga0068868_1000320714 341
191 3300005344 Ga0070661_100012287 Ga0070661_1000122877 341
192 3300005345 Ga0070692_10010527 Ga0070692_100105274 341
193 3300005366 Ga0070659_100014882 Ga0070659_1000148822 341
194 3300005434 Ga0070709_10000079 Ga0070709_1000007936 341
195 3300005435 Ga0070714_100003707 Ga0070714_1000037077 341
196 3300005435 Ga0070714_100021729 Ga0070714_1000217296 341
197 3300005435 Ga0070714_100129637 Ga0070714_1001296374 341
198 3300005435 Ga0070714_100312043 Ga0070714_1003120432 341
199 3300005436 Ga0070713_100017881 Ga0070713_10001788110 341
200 3300005436 Ga0070713_100022045 Ga0070713_1000220454 341
201 3300005436 Ga0070713_100097500 Ga0070713_1000975002 341
202 3300005437 Ga0070710_10023591 Ga0070710_100235912 341
203 3300005441 Ga0070700_100002128 Ga0070700_10000212811 341
204 3300005445 Ga0070708_100018687 Ga0070708_1000186873 341
205 3300005455 Ga0070663_100004098 Ga0070663_1000040985 341
206 3300005458 Ga0070681_10350718 Ga0070681_103507182 341
207 3300005530 Ga0070679_100443261 Ga0070679_1004432611 341
208 3300005535 Ga0070684_100035010 Ga0070684_1000350104 341
209 3300005564 Ga0070664_100048759 Ga0070664_1000487592 341
210 3300005614 Ga0068856_100024264 Ga0068856_1000242643 341
211 3300005616 Ga0068852_100013162 Ga0068852_1000131625 341
212 3300005842 Ga0068858_100302865 Ga0068858_1003028652 341
213 3300005844 Ga0068862_100057353 Ga0068862_1000573535 341
214 3300005937 Ga0081455_10002172 Ga0081455_100021729 341
215 3300005981 Ga0081538_10000984 Ga0081538_1000098411 341
216 3300005981 Ga0081538_10002372 Ga0081538_100023722 341
217 3300006028 Ga0070717_10024837 Ga0070717_100248374 341
218 3300006173 Ga0070716_100003443 Ga0070716_1000034432 341
219 3300006175 Ga0070712_100043553 Ga0070712_1000435534 341
220 3300006844 Ga0075428_100038855 Ga0075428_1000388553 341
221 3300006846 Ga0075430_100000956 Ga0075430_1000009564 341
222 3300006847 Ga0075431_100000493 Ga0075431_10000049331 341
223 3300006847 Ga0075431_100001689 Ga0075431_10000168919 341
224 3300006847 Ga0075431_100047362 Ga0075431_1000473622 341
225 3300006880 Ga0075429_100003899 Ga0075429_1000038999 341
226 3300006880 Ga0075429_100009951 Ga0075429_1000099513 341
227 3300006880 Ga0075429_100146372 Ga0075429_1001463722 341
228 3300009093 Ga0105240_10040594 Ga0105240_100405944 341
229 3300009094 Ga0111539_10000875 Ga0111539_1000087528 341
230 3300009094 Ga0111539_10002197 Ga0111539_1000219713 341
231 3300009094 Ga0111539_10118535 Ga0111539_101185355 341
232 3300009098 Ga0105245_10019940 Ga0105245_100199403 341
233 3300009098 Ga0105245_10037967 Ga0105245_100379675 341
234 3300009147 Ga0114129_10012251 Ga0114129_100122516 341
235 3300009147 Ga0114129_10019428 Ga0114129_100194282 341
236 3300009147 Ga0114129_10034681 Ga0114129_100346815 341
237 3300009147 Ga0114129_10144918 Ga0114129_101449182 341
238 3300009147 Ga0114129_10503417 Ga0114129_105034171 341
239 3300009148 Ga0105243_10098624 Ga0105243_100986242 341
240 3300010375 Ga0105239_10126652 Ga0105239_101266522 341
241 3300021358 Ga0213873_10021833 Ga0213873_100218331 341
242 3300021388 Ga0213875_10005802 Ga0213875_100058025 341
243 3300025906 Ga0207699_10000019 Ga0207699_10000019116 341
244 3300025907 Ga0207645_10168869 Ga0207645_101688692 341
245 3300025912 Ga0207707_10331933 Ga0207707_103319331 341
246 3300025913 Ga0207695_10050708 Ga0207695_100507084 341
247 3300025915 Ga0207693_10014873 Ga0207693_100148739 341
248 3300025915 Ga0207693_10154353 Ga0207693_101543533 341
249 3300025919 Ga0207657_10128687 Ga0207657_101286872 341
250 3300025926 Ga0207659_10038032 Ga0207659_100380325 341
251 3300025927 Ga0207687_10172682 Ga0207687_101726822 341
252 3300025928 Ga0207700_10016225 Ga0207700_100162254 341
253 3300025928 Ga0207700_10068666 Ga0207700_100686662 341
254 3300025928 Ga0207700_10105056 Ga0207700_101050562 341
255 3300025929 Ga0207664_10263711 Ga0207664_102637111 341
256 3300025935 Ga0207709_10040249 Ga0207709_100402493 341
257 3300025939 Ga0207665_10011602 Ga0207665_100116022 341
258 3300025940 Ga0207691_10303466 Ga0207691_103034661 341
259 3300025942 Ga0207689_10004771 Ga0207689_100047712 341
260 3300025944 Ga0207661_10181917 Ga0207661_101819171 341
261 3300025944 Ga0207661_10250166 Ga0207661_102501662 341
262 3300025945 Ga0207679_10012252 Ga0207679_100122523 341
263 3300025949 Ga0207667_10015050 Ga0207667_100150504 341
264 3300025949 Ga0207667_10099484 Ga0207667_100994843 341
265 3300025949 Ga0207667_10226805 Ga0207667_102268052 341
266 3300026023 Ga0207677_10027474 Ga0207677_100274742 341
267 3300026067 Ga0207678_10005683 Ga0207678_100056833 341
268 3300026118 Ga0207675_100054974 Ga0207675_1000549741 341
269 3300026142 Ga0207698_10009391 Ga0207698_100093915 341
270 3300027907 Ga0207428_10004529 Ga0207428_100045298 341
271 3300027907 Ga0207428_10079489 Ga0207428_100794894 341
272 3300031251 Ga0265327_10092651 Ga0265327_100926512 341
273 3300031728 Ga0316578_10041014 Ga0316578_100410142 341
274 3300031728 Ga0316578_10134832 Ga0316578_101348322 341
275 3300031824 Ga0307413_10021265 Ga0307413_100212652 341
276 3300031852 Ga0307410_10027475 Ga0307410_100274752 341
277 3300031852 Ga0307410_10036286 Ga0307410_100362863 341
278 3300031995 Ga0307409_100569874 Ga0307409_1005698741 341
279 3300032004 Ga0307414_10072790 Ga0307414_100727903 341
280 3300032004 Ga0307414_10120531 Ga0307414_101205313 341
281 3300032126 Ga0307415_100015673 Ga0307415_1000156735 341
282 3300032126 Ga0307415_100047428 Ga0307415_1000474282 341
283 3300032126 Ga0307415_100171620 Ga0307415_1001716202 341
284 3300032139 Ga0316580_10037092 Ga0316580_100370922 341
285 3300035398 Ga0316574_0007959 Ga0316574_0007959_218_1255 341
286 3300035398 Ga0316574_0222202 Ga0316574_0222202_34_1071 341
287 3300035692 Ga0373935_0184046 Ga0373935_0184046_324_1367 341
288 3300036401 Ga0373937_0019452 Ga0373937_0019452_2520_3560 341
289 3300036712 Ga0316584_0030481 Ga0316584_0030481_2554_3591 341
290 3300036712 Ga0316584_0077476 Ga0316584_0077476_131_1168 341
291 3300037853 Ga0436364_0339865 Ga0436364_0339865_1912_2952 341
292 3300037853 Ga0436364_1067854 Ga0436364_1067854_26627_27652 341
293 3300038735 Ga0400485_00196 Ga0400485_00196_6991_8022 341
294 3300039437 Ga0436365_0243059 Ga0436365_0243059_1849_2889 341
295 3300039453 Ga0436362_0257049 Ga0436362_0257049_1669_2709 341
296 3300042008 Ga0439450_000417 Ga0439450_000417_4440_5480 341
297 3300042439 Ga0439464_0007544 Ga0439464_0007544_979_2019 341
298 3300042461 Ga0439460_0004950 Ga0439460_0004950_823_1863 341
299 3300042993 Ga0439440_0000279 Ga0439440_0000279_2492_3532 341
300 3300044656 Ga0466969_0073865 Ga0466969_0073865_73_1098 341
301 3300044656 Ga0466969_0097949 Ga0466969_0097949_131_1156 341
302 3300044658 Ga0466972_0000845 Ga0466972_0000845_9571_10596 341
303 3300044658 Ga0466972_0021321 Ga0466972_0021321_1278_2303 341
304 3300044683 Ga0466965_0062673 Ga0466965_0062673_798_1823 341
305 3300044684 Ga0466966_0004911 Ga0466966_0004911_2238_3263 341
306 3300044684 Ga0466966_0076552 Ga0466966_0076552_191_1297 341
307 3300044684 Ga0466966_0088664 Ga0466966_0088664_655_1680 341
308 3300044693 Ga0466961_0014295 Ga0466961_0014295_2831_3937 341
309 3300044693 Ga0466961_0021453 Ga0466961_0021453_2237_3262 341
310 3300044693 Ga0466961_0072195 Ga0466961_0072195_703_1728 341
311 3300044694 Ga0466963_0148128 Ga0466963_0148128_132_1157 341
312 3300044719 Ga0466971_0006584 Ga0466971_0006584_21_1046 341
313 3300044719 Ga0466971_0006995 Ga0466971_0006995_1347_2372 341
314 3300044719 Ga0466971_0062135 Ga0466971_0062135_620_1645 341
315 3300044765 Ga0466970_0010967 Ga0466970_0010967_1134_2159 341
316 3300044765 Ga0466970_0013547 Ga0466970_0013547_2532_3557 341
317 3300044765 Ga0466970_0099267 Ga0466970_0099267_330_1355 341
318 3300044842 Ga0466957_0002111 Ga0466957_0002111_4154_5179 341
319 3300044842 Ga0466957_0031460 Ga0466957_0031460_2005_3030 341
320 3300044842 Ga0466957_0238363 Ga0466957_0238363_94_1119 341
321 3300045049 Ga0466959_0083557 Ga0466959_0083557_549_1574 341
322 3300045836 Ga0466958_0016562 Ga0466958_0016562_3110_4135 341
323 3300045836 Ga0466958_0085371 Ga0466958_0085371_95_1120 341
324 3300045836 Ga0466958_0126237 Ga0466958_0126237_221_1246 341
325 3300045836 Ga0466958_0189598 Ga0466958_0189598_219_1259 341
326 3300045976 Ga0466967_0000890 Ga0466967_0000890_9215_10240 341
327 3300045976 Ga0466967_0002084 Ga0466967_0002084_2271_3296 341
328 3300045976 Ga0466967_0004776 Ga0466967_0004776_6275_7300 341
329 3300045976 Ga0466967_0010814 Ga0466967_0010814_2104_3243 341
330 3300045976 Ga0466967_0042536 Ga0466967_0042536_1944_2969 341
331 3300045976 Ga0466967_0115802 Ga0466967_0115802_688_1743 341
332 3300046454 Ga0495592_0008722 Ga0495592_0008722_1371_2411 341
333 3300046511 Ga0495608_0085206 Ga0495608_0085206_731_1771 341
334 3300046514 Ga0495618_0186877 Ga0495618_0186877_244_1284 341
335 3300046516 Ga0495628_0069145 Ga0495628_0069145_124_1164 341
336 3300046642 Ga0495634_0128393 Ga0495634_0128393_395_1423 341
337 3300046663 Ga0495635_0005720 Ga0495635_0005720_3973_5013 341
338 3300046663 Ga0495635_0094184 Ga0495635_0094184_948_1988 341
339 3300046675 Ga0495657_0003587 Ga0495657_0003587_3335_4375 341
340 3300046680 Ga0495646_0022876 Ga0495646_0022876_2708_3748 341
341 3300047317 Ga0495604_0052896 Ga0495604_0052896_1859_2899 341
342 3300047322 Ga0495680_0029036 Ga0495680_0029036_875_1915 341
343 3300047471 Ga0495684_0040441 Ga0495684_0040441_63_1103 341
344 3300047471 Ga0495684_0154516 Ga0495684_0154516_224_1264 341
345 3300048088 Ga0495602_0169059 Ga0495602_0169059_77_1117 341
346 3300048907 Ga0496104_0020111 Ga0496104_0020111_2014_3054 341
347 3300048907 Ga0496104_0075131 Ga0496104_0075131_143_1183 341
348 3300048912 Ga0496109_0223023 Ga0496109_0223023_257_1297 341
349 3300048913 Ga0496110_0012453 Ga0496110_0012453_4034_5062 341
350 3300048914 Ga0496111_0343795 Ga0496111_0343795_50_1078 341
351 3300048915 Ga0496112_0034603 Ga0496112_0034603_3214_4254 341
352 3300048916 Ga0496113_0037302 Ga0496113_0037302_920_1960 341
353 3300049568 Ga0501031_0019663 Ga0501031_0019663_3219_4250 341
354 3300049568 Ga0501031_0047590 Ga0501031_0047590_1253_2290 341
355 3300049569 Ga0501032_0153384 Ga0501032_0153384_395_1432 341
356 3300049570 Ga0501033_0090062 Ga0501033_0090062_1095_2126 341
357 3300049572 Ga0501036_0129473 Ga0501036_0129473_592_1620 341
358 3300049572 Ga0501036_0284519 Ga0501036_0284519_119_1147 341
359 3300049574 Ga0501038_0032117 Ga0501038_0032117_416_1447 341
360 3300049575 Ga0501039_0022359 Ga0501039_0022359_3375_4406 341
361 3300049575 Ga0501039_0074054 Ga0501039_0074054_1406_2434 341
362 3300049576 Ga0501040_0005753 Ga0501040_0005753_2186_3217 341
363 3300049576 Ga0501040_0031560 Ga0501040_0031560_1661_2698 341
364 3300049576 Ga0501040_0087811 Ga0501040_0087811_581_1621 341
365 3300049577 Ga0501041_0007892 Ga0501041_0007892_4330_5361 341
366 3300049577 Ga0501041_0066767 Ga0501041_0066767_123_1160 341
367 3300049578 Ga0501042_0010774 Ga0501042_0010774_3806_4843 341
368 3300049578 Ga0501042_0015127 Ga0501042_0015127_1400_2431 341
369 3300049578 Ga0501042_0169218 Ga0501042_0169218_249_1286 341
370 3300049580 Ga0501046_0256170 Ga0501046_0256170_225_1262 341
371 3300049581 Ga0501047_0116691 Ga0501047_0116691_317_1342 341
372 3300049582 Ga0501048_0157546 Ga0501048_0157546_488_1516 341
373 3300049583 Ga0501067_0048690 Ga0501067_0048690_413_1444 341
374 3300049584 Ga0501068_0026155 Ga0501068_0026155_753_1790 341
375 3300049585 Ga0501069_0005824 Ga0501069_0005824_5131_6162 341
376 3300049586 Ga0501070_0000447 Ga0501070_0000447_18027_19058 341
377 3300049588 Ga0501072_0021813 Ga0501072_0021813_3786_4817 341
378 3300049588 Ga0501072_0134557 Ga0501072_0134557_341_1369 341
379 3300049589 Ga0501073_0011347 Ga0501073_0011347_4965_5996 341
380 3300049590 Ga0501074_0151408 Ga0501074_0151408_573_1604 341
381 3300049590 Ga0501074_0170070 Ga0501074_0170070_63_1139 341
382 3300049591 Ga0501075_0002181 Ga0501075_0002181_3707_4738 341
383 3300049591 Ga0501075_0031747 Ga0501075_0031747_875_1912 341
384 3300049591 Ga0501075_0038180 Ga0501075_0038180_2085_3113 341
385 3300049592 Ga0501076_0010983 Ga0501076_0010983_4443_5474 341
386 3300049592 Ga0501076_0043067 Ga0501076_0043067_119_1159 341
387 3300049592 Ga0501076_0118964 Ga0501076_0118964_1029_2066 341
388 3300049592 Ga0501076_0190827 Ga0501076_0190827_539_1576 341
389 3300049593 Ga0501077_0007641 Ga0501077_0007641_4737_5768 341
390 3300049741 Ga0501079_0069782 Ga0501079_0069782_44_1075 341
391 3300049741 Ga0501079_0170097 Ga0501079_0170097_77_1114 341
392 3300049742 Ga0501080_0037769 Ga0501080_0037769_1468_2499 341
393 3300049743 Ga0501081_0118061 Ga0501081_0118061_332_1390 341
394 3300049743 Ga0501081_0223285 Ga0501081_0223285_59_1087 341
395 3300049744 Ga0501083_0001590 Ga0501083_0001590_5663_6694 341
396 3300049744 Ga0501083_0037183 Ga0501083_0037183_1208_2239 341
397 3300049823 Ga0501044_0085074 Ga0501044_0085074_1362_2387 341
398 3300049824 Ga0501045_0042446 Ga0501045_0042446_1611_2639 341
399 3300049824 Ga0501045_0044067 Ga0501045_0044067_806_1843 341
400 3300050507 nmdc:mga05p37_107986_c1 nmdc:mga05p37_107986_c1_1311_2339 341
401 3300050507 nmdc:mga05p37_134536_c1 nmdc:mga05p37_134536_c1_701_1732 341
402 3300050507 nmdc:mga05p37_184651_c1 nmdc:mga05p37_184651_c1_613_1656 341
403 3300050508 nmdc:mga09592_155051_c1 nmdc:mga09592_155051_c1_285_1328 341
404 3300050508 nmdc:mga09592_33394_c1 nmdc:mga09592_33394_c1_1415_2455 341
405 3300050508 nmdc:mga09592_44410_c1 nmdc:mga09592_44410_c1_639_1670 341
406 3300050508 nmdc:mga09592_7678_c1 nmdc:mga09592_7678_c1_5826_6854 341
407 3300050509 nmdc:mga0qj67_14332_c1 nmdc:mga0qj67_14332_c1_1416_2444 341
408 3300050510 nmdc:mga06r32_103990_c1 nmdc:mga06r32_103990_c1_704_1735 341
409 3300050510 nmdc:mga06r32_778_c1 nmdc:mga06r32_778_c1_26311_27339 341
410 3300050511 nmdc:mga08y16_238061_c1 nmdc:mga08y16_238061_c1_122_1168 341
411 3300050511 nmdc:mga08y16_47420_c1 nmdc:mga08y16_47420_c1_1458_2489 341
412 3300053084 Ga0495595_0007242 Ga0495595_0007242_2730_3770 341
413 3300053084 Ga0495595_0109240 Ga0495595_0109240_117_1145 341
414 3300053085 Ga0495619_0046850 Ga0495619_0046850_1347_2387 341
415 3300054114 Ga0501084_0000071 Ga0501084_0000071_13420_14457 341
416 3300054114 Ga0501084_0001216 Ga0501084_0001216_1166_2197 341
417 3300054114 Ga0501084_0102167 Ga0501084_0102167_1152_2189 341
418 3300054114 Ga0501084_0280553 Ga0501084_0280553_251_1279 341
419 3300059424 Ga0590075_010203 Ga0590075_010203_309_1340 341
420 3300060353 Ga0501082_0038363 Ga0501082_0038363_2755_3792 341
421 3300060353 Ga0501082_0094331 Ga0501082_0094331_503_1531 341
422 3300060353 Ga0501082_0171897 Ga0501082_0171897_181_1212 341
423 3300060353 Ga0501082_0258323 Ga0501082_0258323_27_1058 341
424 3300061719 Ga0466962_0026426 Ga0466962_0026426_33_1073 341
425 3300061719 Ga0466962_0039554 Ga0466962_0039554_94_1119 341
426 3300061734 Ga0530510_0004534 Ga0530510_0004534_2219_3259 341
427 3300061734 Ga0530510_0021739 Ga0530510_0021739_632_1669 341
428 3300061734 Ga0530510_0032310 Ga0530510_0032310_1442_2473 341
429 3300005444 Ga0070694_100007140 Ga0070694_1000071406 342
430 3300013105 Ga0157369_10101056 Ga0157369_101010562 342
431 3300031727 Ga0316576_10025861 Ga0316576_100258613 342
432 3300039437 Ga0436365_1458705 Ga0436365_1458705_3684_4721 342
433 3300044684 Ga0466966_0071830 Ga0466966_0071830_143_1192 342
434 3300044693 Ga0466961_0034536 Ga0466961_0034536_657_1706 342
435 3300045049 Ga0466959_0028607 Ga0466959_0028607_657_1706 342
436 3300047321 Ga0495676_0115101 Ga0495676_0115101_885_1916 342
437 3300005288 Ga0065714_10139371 Ga0065714_101393711 344
438 3300013308 Ga0157375_10542081 Ga0157375_105420811 344
439 3300048921 Ga0496118_0042351 Ga0496118_0042351_1798_2883 344
440 3300049823 Ga0501044_0022158 Ga0501044_0022158_299_1336 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

34

361

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z69-assembly1.cif.gz_B crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 0.8508 1 343
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.8453 1 343
1z69-assembly1.cif.gz_B crystal structure of methylenetetrahydromethanopterin reductase (mer) in complex with coenzyme f420 0.8411 1 343
1f07-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum 0.8355 1 343
1ezw-assembly1.cif.gz_A structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanopyrus kandleri 0.8057 1 343
ID Description Score Start End Superfamily
af_O53565_5_346_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9734 1 341 3.20.20.30
af_O53565_5_346_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9678 1 341 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8529 7 344 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8482 7 344 3.20.20.30
af_P9WM03_11_339_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.835 4 340 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A838FH24-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9806 1 93 GO:0016705
AF-A0A2M8PU18-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9767 223 332 GO:0016705
AF-A0A2V6WRC7-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9715 1 342 GO:0016705
AF-A0A838FH24-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9703 1 93 GO:0016705
AF-A0A3M1L3L2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9686 1 125 GO:0016705

Feature Viewer

pLDDT pTM Quality
93.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map