F444517

General Info

Members Datasets Scaffolds Average Seq Length
440 273 440 124

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0870527|Ga0501037_0870527_47_445
Length 132
Sequence MGDRRQHPGLDLILRRFERPDETREMVKGRFELVRIGGITIGRAAYEPGWKWSEHVGPAVGAERCSVEHVGLVLAGTATVAFADRVIEMRAGDLFYVPPEPHDSWVVGDTPYVSLHFLGADHYATAGGPSPR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
204 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 2.95
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8896741 2162886012 Bacteria 1236
2 JGI24747J21853_1029073 3300001978 Unclassified 627
3 JGI24737J22298_10173423 3300001990 Unclassified 636
4 JGI24743J22301_10022092 3300001991 Bacteria 1218
5 JGI24748J21848_1013433 3300002074 Bacteria 968
6 JGI24749J21850_1024678 3300002076 Bacteria 856
7 JGI24034J26672_10062389 3300002239 Unclassified 657
8 JGI24751J29686_10004470 3300002459 Bacteria 2842
9 JGI25165J46597_1023406 3300003214 Bacteria 803
10 rootL2_10229461 3300003322 Bacteria 1277
11 Ga0065712_10171955 3300005290 Unclassified 1239
12 Ga0065712_10176307 3300005290 Bacteria 1145
13 Ga0070658_10010344 3300005327 Bacteria 7483
14 Ga0070658_11565107 3300005327 Bacteria 571
15 Ga0070676_10001878 3300005328 Bacteria 10675
16 Ga0070683_100027756 3300005329 Bacteria 5108
17 Ga0070683_100053699 3300005329 Bacteria 3734
18 Ga0070690_100002145 3300005330 Bacteria 10531
19 Ga0070690_100164700 3300005330 Bacteria 1522
20 Ga0070670_100031526 3300005331 Bacteria 4566
21 Ga0070677_10001016 3300005333 Bacteria 9061
22 Ga0068869_100038121 3300005334 Bacteria 3422
23 Ga0068869_100358708 3300005334 Unclassified 1190
24 Ga0068869_100448786 3300005334 Bacteria 1069
25 Ga0068869_100838337 3300005334 Unclassified 792
26 Ga0070666_10001413 3300005335 Bacteria 14525
27 Ga0070666_10053027 3300005335 Bacteria 2734
28 Ga0070682_100158630 3300005337 Bacteria 1560
29 Ga0068868_100021228 3300005338 Bacteria 4890
30 Ga0068868_100161902 3300005338 Bacteria 1848
31 Ga0070660_100000446 3300005339 Bacteria 27489
32 Ga0070689_100026056 3300005340 Bacteria 4398
33 Ga0070689_100249244 3300005340 Bacteria 1465
34 Ga0070691_10041504 3300005341 Bacteria 2175
35 Ga0070687_100000065 3300005343 Bacteria 34403
36 Ga0070687_100996344 3300005343 Bacteria 607
37 Ga0070661_100000398 3300005344 Bacteria 33684
38 Ga0070692_10034908 3300005345 Bacteria 2543
39 Ga0070692_10123448 3300005345 Unclassified 1447
40 Ga0070668_100000515 3300005347 Bacteria 25626
41 Ga0070669_100001665 3300005353 Bacteria 16082
42 Ga0070669_100604164 3300005353 Unclassified 919
43 Ga0070675_100171638 3300005354 Bacteria 1870
44 Ga0070675_100468816 3300005354 Unclassified 1131
45 Ga0070675_100841430 3300005354 Bacteria 839
46 Ga0070671_100003853 3300005355 Bacteria 11790
47 Ga0070671_100119687 3300005355 Bacteria 2215
48 Ga0070674_100002251 3300005356 Bacteria 10638
49 Ga0070673_101807540 3300005364 Bacteria 579
50 Ga0070688_100007745 3300005365 Bacteria 5799
51 Ga0070659_100001135 3300005366 Bacteria 19415
52 Ga0070667_100005215 3300005367 Bacteria 10861
53 Ga0070667_100051788 3300005367 Bacteria 3462
54 Ga0070703_10028229 3300005406 Bacteria 1676
55 Ga0070714_100000827 3300005435 Bacteria 21893
56 Ga0070714_100001989 3300005435 Bacteria 14930
57 Ga0070714_100488345 3300005435 Unclassified 1173
58 Ga0070713_100225334 3300005436 Bacteria 1702
59 Ga0070713_101636915 3300005436 Unclassified 625
60 Ga0070701_10004832 3300005438 Bacteria 5508
61 Ga0070711_100020346 3300005439 Bacteria 4276
62 Ga0070705_100003520 3300005440 Bacteria 7664
63 Ga0070705_100015204 3300005440 Bacteria 3973
64 Ga0070700_100052544 3300005441 Bacteria 2541
65 Ga0070694_100101634 3300005444 Bacteria 2034
66 Ga0070708_100171191 3300005445 Bacteria 2027
67 Ga0070708_100461848 3300005445 Bacteria 1198
68 Ga0070708_100664550 3300005445 Bacteria 981
69 Ga0070663_100000459 3300005455 Bacteria 21594
70 Ga0070663_100654588 3300005455 Bacteria 889
71 Ga0070678_100007124 3300005456 Bacteria 6611
72 Ga0070678_100277387 3300005456 Bacteria 1416
73 Ga0070678_100318839 3300005456 Bacteria 1327
74 Ga0070662_100001745 3300005457 Bacteria 13376
75 Ga0070681_10515514 3300005458 Unclassified 1109
76 Ga0070681_10518331 3300005458 Unclassified 1105
77 Ga0070685_10000852 3300005466 Bacteria 16605
78 Ga0070706_100063032 3300005467 Unclassified 3425
79 Ga0070706_100105519 3300005467 Bacteria 2621
80 Ga0070707_100114993 3300005468 Bacteria 2611
81 Ga0070707_100178595 3300005468 Unclassified 2069
82 Ga0070698_100008164 3300005471 Bacteria 11319
83 Ga0070698_100106076 3300005471 Unclassified 2779
84 Ga0070698_100287263 3300005471 Bacteria 1576
85 Ga0070679_100341408 3300005530 Unclassified 1446
86 Ga0070684_100004761 3300005535 Bacteria 10370
87 Ga0070684_100553633 3300005535 Bacteria 1067
88 Ga0070697_100032863 3300005536 Bacteria 4177
89 Ga0070697_100053091 3300005536 Bacteria 3294
90 Ga0070697_100100480 3300005536 Bacteria 2402
91 Ga0070697_100585983 3300005536 Bacteria 979
92 Ga0068853_100000254 3300005539 Bacteria 37416
93 Ga0068853_101749058 3300005539 Bacteria 603
94 Ga0070672_100017468 3300005543 Bacteria 5165
95 Ga0070672_101555013 3300005543 Bacteria 593
96 Ga0070686_100013239 3300005544 Bacteria 4717
97 Ga0070695_100282253 3300005545 Bacteria 1221
98 Ga0070695_100814642 3300005545 Unclassified 749
99 Ga0070696_100004255 3300005546 Bacteria 9548
100 Ga0070696_101082787 3300005546 Bacteria 673
101 Ga0070693_100088515 3300005547 Bacteria 1862
102 Ga0070693_101099132 3300005547 Unclassified 606
103 Ga0070665_100031443 3300005548 Bacteria 5343
104 Ga0070704_100030294 3300005549 Bacteria 3624
105 Ga0068855_100001561 3300005563 Bacteria 28787
106 Ga0070664_100000108 3300005564 Bacteria 53982
107 Ga0070664_100009997 3300005564 Bacteria 7690
108 Ga0068857_100006613 3300005577 Bacteria 9955
109 Ga0068857_100006654 3300005577 Bacteria 9931
110 Ga0068854_100003994 3300005578 Bacteria 9256
111 Ga0070702_100048996 3300005615 Bacteria 2407
112 Ga0068859_100066599 3300005617 Bacteria 3637
113 Ga0068859_100788171 3300005617 Bacteria 1038
114 Ga0068859_101761310 3300005617 Bacteria 684
115 Ga0068859_102608625 3300005617 Unclassified 556
116 Ga0068864_100000877 3300005618 Bacteria 25308
117 Ga0068864_100054278 3300005618 Bacteria 3458
118 Ga0068864_100258635 3300005618 Bacteria 1619
119 Ga0068864_100796416 3300005618 Bacteria 928
120 Ga0068866_10000784 3300005718 Bacteria 14226
121 Ga0068866_10905053 3300005718 Bacteria 621
122 Ga0068861_100003250 3300005719 Bacteria 10757
123 Ga0068851_10000329 3300005834 Bacteria 21551
124 Ga0068870_10066844 3300005840 Bacteria 1949
125 Ga0068863_100004462 3300005841 Bacteria 13798
126 Ga0068863_100098597 3300005841 Bacteria 2775
127 Ga0068858_100081776 3300005842 Bacteria 3002
128 Ga0068858_100708089 3300005842 Bacteria 980
129 Ga0068858_100803205 3300005842 Unclassified 918
130 Ga0068860_100003535 3300005843 Bacteria 16077
131 Ga0068860_100149349 3300005843 Bacteria 2250
132 Ga0068862_100165808 3300005844 Bacteria 1975
133 Ga0068862_100324583 3300005844 Bacteria 1422
134 Ga0081540_1000069 3300005983 Bacteria 111562
135 Ga0081540_1000351 3300005983 Bacteria 46620
136 Ga0081540_1000908 3300005983 Bacteria 26739
137 Ga0070717_10075826 3300006028 Bacteria 2813
138 Ga0070715_10222664 3300006163 Unclassified 971
139 Ga0070716_100095523 3300006173 Bacteria 1809
140 Ga0070716_100560975 3300006173 Bacteria 853
141 Ga0070712_100577697 3300006175 Bacteria 949
142 Ga0097621_100142411 3300006237 Bacteria 2049
143 Ga0097621_100403993 3300006237 Unclassified 1223
144 Ga0097621_101561094 3300006237 Bacteria 627
145 Ga0068871_100005856 3300006358 Bacteria 8642
146 Ga0075428_100078846 3300006844 Bacteria 3595
147 Ga0075430_100108827 3300006846 Bacteria 2312
148 Ga0075430_100112294 3300006846 Bacteria 2272
149 Ga0075430_100454008 3300006846 Unclassified 1058
150 Ga0075431_100067561 3300006847 Bacteria 3690
151 Ga0075431_100068840 3300006847 Bacteria 3652
152 Ga0075431_100106757 3300006847 Bacteria 2889
153 Ga0075431_100773047 3300006847 Unclassified 935
154 Ga0075431_101705831 3300006847 Unclassified 587
155 Ga0075433_10133962 3300006852 Unclassified 2202
156 Ga0075433_11750611 3300006852 Unclassified 535
157 Ga0075434_100270328 3300006871 Bacteria 1719
158 Ga0075429_100065688 3300006880 Bacteria 3159
159 Ga0068865_100000473 3300006881 Bacteria 22470
160 Ga0068865_101281852 3300006881 Unclassified 651
161 Ga0097620_100066599 3300006931 Bacteria 3637
162 Ga0097620_100788176 3300006931 Bacteria 1038
163 Ga0097620_101761718 3300006931 Bacteria 684
164 Ga0097620_102608492 3300006931 Unclassified 556
165 Ga0075435_100873173 3300007076 Unclassified 784
166 Ga0105250_10006035 3300009092 Bacteria 5339
167 Ga0105240_10001833 3300009093 Bacteria 35581
168 Ga0111539_10148236 3300009094 Unclassified 2747
169 Ga0111539_10836121 3300009094 Unclassified 1071
170 Ga0105245_10000280 3300009098 Bacteria 48458
171 Ga0105247_10004247 3300009101 Bacteria 9182
172 Ga0114129_10161816 3300009147 Unclassified 3057
173 Ga0114129_10291382 3300009147 Bacteria 2178
174 Ga0114129_11788832 3300009147 Unclassified 747
175 Ga0105243_10003914 3300009148 Bacteria 11880
176 Ga0105241_10005517 3300009174 Bacteria 9347
177 Ga0105241_10054222 3300009174 Bacteria 3068
178 Ga0105242_10002486 3300009176 Bacteria 14444
179 Ga0105242_10213582 3300009176 Bacteria 1721
180 Ga0105248_10001972 3300009177 Bacteria 22812
181 Ga0105248_10077218 3300009177 Bacteria 3744
182 Ga0105248_10628098 3300009177 Unclassified 1212
183 Ga0105248_11109561 3300009177 Unclassified 894
184 Ga0105237_10000240 3300009545 Bacteria 77901
185 Ga0105238_10012454 3300009551 Bacteria 8578
186 Ga0105249_10000800 3300009553 Bacteria 28288
187 Ga0105249_11091725 3300009553 Bacteria 868
188 Ga0105249_12765492 3300009553 Unclassified 562
189 Ga0105239_10011098 3300010375 Bacteria 10054
190 Ga0105246_10019689 3300011119 Bacteria 4318
191 Ga0105246_10082264 3300011119 Bacteria 2297
192 Ga0157373_10001623 3300013100 Bacteria 17156
193 Ga0157373_10002100 3300013100 Bacteria 15087
194 Ga0157371_10000524 3300013102 Bacteria 45827
195 Ga0157369_10000929 3300013105 Bacteria 37254
196 Ga0157369_10463004 3300013105 Bacteria 1313
197 Ga0157374_10002830 3300013296 Bacteria 14551
198 Ga0157374_10256465 3300013296 Bacteria 1721
199 Ga0157378_10000561 3300013297 Bacteria 35280
200 Ga0157378_10001713 3300013297 Bacteria 19722
201 Ga0157378_10574186 3300013297 Bacteria 1136
202 Ga0157378_10956952 3300013297 Bacteria 889
203 Ga0163162_10047795 3300013306 Bacteria 4287
204 Ga0163162_10074354 3300013306 Bacteria 3457
205 Ga0157372_10009352 3300013307 Bacteria 10432
206 Ga0157375_10047235 3300013308 Bacteria 4203
207 Ga0157375_11854433 3300013308 Bacteria 715
208 Ga0163163_10002780 3300014325 Bacteria 14778
209 Ga0163163_10280333 3300014325 Bacteria 1718
210 Ga0157380_10073165 3300014326 Bacteria 2778
211 Ga0157380_10923600 3300014326 Unclassified 900
212 Ga0157380_11113597 3300014326 Bacteria 829
213 Ga0157377_10000250 3300014745 Bacteria 26631
214 Ga0157377_10062023 3300014745 Bacteria 2138
215 Ga0157379_10000550 3300014968 Bacteria 30219
216 Ga0157379_10178303 3300014968 Bacteria 1919
217 Ga0157376_10006402 3300014969 Bacteria 8319
218 Ga0157376_10127805 3300014969 Bacteria 2263
219 Ga0157376_10716179 3300014969 Bacteria 1007
220 Ga0163161_10013772 3300017792 Bacteria 5634
221 Ga0213872_10068210 3300021361 Bacteria 1605
222 Ga0213874_10013658 3300021377 Bacteria 2109
223 Ga0213874_10014689 3300021377 Bacteria 2052
224 Ga0207697_10001133 3300025315 Bacteria 14684
225 Ga0207656_10001117 3300025321 Bacteria 8811
226 Ga0207653_10094241 3300025885 Bacteria 1052
227 Ga0207653_10101129 3300025885 Bacteria 1020
228 Ga0207682_10000080 3300025893 Bacteria 42569
229 Ga0207642_10000482 3300025899 Bacteria 12241
230 Ga0207710_10003374 3300025900 Bacteria 7138
231 Ga0207688_10000125 3300025901 Bacteria 31897
232 Ga0207680_10133324 3300025903 Bacteria 1639
233 Ga0207647_10000872 3300025904 Bacteria 23363
234 Ga0207699_11054359 3300025906 Unclassified 601
235 Ga0207645_10000201 3300025907 Bacteria 48793
236 Ga0207643_10000288 3300025908 Bacteria 35045
237 Ga0207643_10002691 3300025908 Bacteria 9602
238 Ga0207705_10005646 3300025909 Bacteria 9341
239 Ga0207684_10017342 3300025910 Bacteria 6177
240 Ga0207684_10034603 3300025910 Unclassified 4292
241 Ga0207654_10010212 3300025911 Bacteria 4778
242 Ga0207707_10330013 3300025912 Bacteria 1316
243 Ga0207695_10026878 3300025913 Bacteria 6416
244 Ga0207671_10004945 3300025914 Bacteria 12499
245 Ga0207663_10043358 3300025916 Bacteria 2754
246 Ga0207662_10000010 3300025918 Bacteria 91647
247 Ga0207657_10000355 3300025919 Bacteria 48874
248 Ga0207649_10009702 3300025920 Bacteria 5272
249 Ga0207649_10067055 3300025920 Bacteria 2277
250 Ga0207652_10306993 3300025921 Unclassified 1432
251 Ga0207646_10020688 3300025922 Bacteria 6094
252 Ga0207646_10302342 3300025922 Bacteria 1445
253 Ga0207681_10000442 3300025923 Bacteria 28975
254 Ga0207694_10888964 3300025924 Unclassified 753
255 Ga0207650_10000488 3300025925 Bacteria 33011
256 Ga0207650_10008495 3300025925 Bacteria 7011
257 Ga0207659_10000546 3300025926 Bacteria 22479
258 Ga0207659_10030545 3300025926 Bacteria 3683
259 Ga0207687_10001978 3300025927 Bacteria 14083
260 Ga0207700_10280784 3300025928 Bacteria 1432
261 Ga0207664_10001586 3300025929 Bacteria 14949
262 Ga0207664_10008277 3300025929 Bacteria 7245
263 Ga0207644_10000338 3300025931 Bacteria 30378
264 Ga0207644_10151091 3300025931 Bacteria 1797
265 Ga0207644_10438934 3300025931 Bacteria 1071
266 Ga0207690_10001586 3300025932 Bacteria 14202
267 Ga0207690_10843061 3300025932 Bacteria 759
268 Ga0207706_10000077 3300025933 Bacteria 102336
269 Ga0207686_10012626 3300025934 Bacteria 4647
270 Ga0207709_10002081 3300025935 Bacteria 12906
271 Ga0207670_10014426 3300025936 Bacteria 4690
272 Ga0207670_10453257 3300025936 Bacteria 1035
273 Ga0207669_10001938 3300025937 Bacteria 8775
274 Ga0207704_10001771 3300025938 Bacteria 9668
275 Ga0207704_10284905 3300025938 Bacteria 1258
276 Ga0207665_10023985 3300025939 Bacteria 4020
277 Ga0207691_10000033 3300025940 Bacteria 115126
278 Ga0207691_10540095 3300025940 Bacteria 989
279 Ga0207711_10000361 3300025941 Bacteria 48220
280 Ga0207711_10111359 3300025941 Unclassified 2435
281 Ga0207711_10161687 3300025941 Bacteria 2027
282 Ga0207711_10436122 3300025941 Bacteria 1219
283 Ga0207689_10000232 3300025942 Bacteria 49618
284 Ga0207689_10135553 3300025942 Bacteria 2027
285 Ga0207661_10001691 3300025944 Bacteria 15054
286 Ga0207661_10046826 3300025944 Bacteria 3430
287 Ga0207679_10000113 3300025945 Bacteria 65633
288 Ga0207679_10013720 3300025945 Bacteria 5313
289 Ga0207667_10019545 3300025949 Bacteria 7559
290 Ga0207651_10000848 3300025960 Bacteria 13311
291 Ga0207712_10001542 3300025961 Bacteria 15583
292 Ga0207712_10898816 3300025961 Bacteria 782
293 Ga0207712_11482540 3300025961 Unclassified 607
294 Ga0207668_10084871 3300025972 Bacteria 2308
295 Ga0207640_10023407 3300025981 Bacteria 3711
296 Ga0207658_10004325 3300025986 Bacteria 9886
297 Ga0207677_10000346 3300026023 Bacteria 32732
298 Ga0207677_10156326 3300026023 Bacteria 1766
299 Ga0207703_10000293 3300026035 Bacteria 54982
300 Ga0207703_10175164 3300026035 Bacteria 1889
301 Ga0207703_10830728 3300026035 Unclassified 883
302 Ga0207639_10000799 3300026041 Bacteria 21367
303 Ga0207678_10000135 3300026067 Bacteria 61373
304 Ga0207678_10029873 3300026067 Bacteria 4759
305 Ga0207708_10060165 3300026075 Bacteria 2899
306 Ga0207702_10011434 3300026078 Bacteria 7398
307 Ga0207641_10001355 3300026088 Bacteria 24285
308 Ga0207641_10026746 3300026088 Bacteria 4762
309 Ga0207648_10000387 3300026089 Bacteria 48794
310 Ga0207676_10001108 3300026095 Bacteria 20366
311 Ga0207676_10127824 3300026095 Bacteria 2155
312 Ga0207676_10138099 3300026095 Bacteria 2083
313 Ga0207676_10679306 3300026095 Bacteria 996
314 Ga0207674_10000224 3300026116 Bacteria 70660
315 Ga0207674_10042479 3300026116 Bacteria 4696
316 Ga0207675_100000043 3300026118 Bacteria 89667
317 Ga0207675_100119582 3300026118 Bacteria 2492
318 Ga0207683_10000232 3300026121 Bacteria 49365
319 Ga0207683_10006158 3300026121 Bacteria 10283
320 Ga0207683_10109256 3300026121 Bacteria 2475
321 Ga0207698_10006893 3300026142 Bacteria 7108
322 Ga0268266_10001211 3300028379 Bacteria 31826
323 Ga0268266_10064111 3300028379 Bacteria 3173
324 Ga0268265_10000746 3300028380 Bacteria 31751
325 Ga0268265_10158914 3300028380 Bacteria 1917
326 Ga0268264_10000771 3300028381 Bacteria 35394
327 Ga0268264_10311179 3300028381 Bacteria 1486
328 Ga0265338_10001847 3300028800 Bacteria 33253
329 Ga0307405_10214784 3300031731 Bacteria 1407
330 Ga0307405_10373112 3300031731 Bacteria 1108
331 Ga0307413_10543279 3300031824 Bacteria 941
332 Ga0307410_10080265 3300031852 Bacteria 2288
333 Ga0307406_10597980 3300031901 Bacteria 909
334 Ga0307409_100186186 3300031995 Bacteria 1843
335 Ga0307416_100179430 3300032002 Unclassified 1983
336 Ga0307416_100375629 3300032002 Bacteria 1449
337 Ga0307411_10208764 3300032005 Bacteria 1506
338 Ga0307411_11002925 3300032005 Bacteria 748
339 Ga0307415_100462348 3300032126 Bacteria 1100
340 Ga0373959_0140214 3300034820 Bacteria 605
341 Ga0373938_0023777 3300034957 Unclassified 1262
342 Ga0373926_0070979 3300035083 Bacteria 1280
343 Ga0373939_0394368 3300035114 Bacteria 572
344 Ga0373935_0197998 3300035692 Bacteria 1387
345 Ga0373933_0047967 3300035724 Bacteria 2542
346 Ga0373947_0449330 3300035725 Bacteria 873
347 Ga0373937_0290861 3300036401 Bacteria 1544
348 Ga0373925_0787453 3300037068 Bacteria 784
349 Ga0395905_0034871 3300037471 Bacteria 4724
350 Ga0395905_1336262 3300037471 Bacteria 621
351 Ga0395901_0437981 3300038443 Bacteria 1338
352 Ga0436365_1844273 3300039437 Bacteria 1631
353 Ga0436360_0251032 3300039438 Bacteria 1428
354 Ga0436360_0629082 3300039438 Bacteria 1631
355 Ga0436360_1101180 3300039438 Unclassified 926
356 Ga0436361_0526570 3300039447 Bacteria 8269
357 Ga0436361_1189375 3300039447 Unclassified 582
358 Ga0436363_0096207 3300039450 Bacteria 13251
359 Ga0436363_0869252 3300039450 Bacteria 1347
360 Ga0436363_1602129 3300039450 Bacteria 16779
361 Ga0436363_1628994 3300039450 Bacteria 2566
362 Ga0436362_0544676 3300039453 Bacteria 2630
363 Ga0451851_0515393 3300041507 Bacteria 534
364 Ga0439448_0041485 3300042005 Bacteria 1489
365 Ga0439435_0096213 3300042436 Bacteria 905
366 Ga0451577_0110730 3300042876 Bacteria 2456
367 Ga0466963_0902647 3300044694 Bacteria 623
368 Ga0451576_0097744 3300045051 Bacteria 3053
369 Ga0495580_0930191 3300046472 Bacteria 557
370 Ga0495639_0295719 3300046475 Bacteria 807
371 Ga0495662_0678235 3300046476 Bacteria 503
372 Ga0495628_0500401 3300046516 Bacteria 878
373 Ga0495630_0659664 3300046517 Bacteria 801
374 Ga0495598_0273690 3300046537 Unclassified 632
375 Ga0495658_0135934 3300046683 Bacteria 1500
376 Ga0495658_0200915 3300046683 Bacteria 1242
377 Ga0495676_0126262 3300047321 Bacteria 1854
378 Ga0496100_0108790 3300048903 Bacteria 1923
379 Ga0496102_0008372 3300048905 Bacteria 8857
380 Ga0496102_1292634 3300048905 Bacteria 649
381 Ga0496103_0026912 3300048906 Bacteria 3482
382 Ga0496106_0009616 3300048909 Bacteria 7140
383 Ga0496107_0159158 3300048910 Unclassified 1673
384 Ga0496108_0109373 3300048911 Bacteria 2362
385 Ga0496109_0008472 3300048912 Bacteria 8742
386 Ga0496109_1299000 3300048912 Bacteria 664
387 Ga0496112_0005154 3300048915 Bacteria 11239
388 Ga0496112_0125228 3300048915 Bacteria 2541
389 Ga0496113_0066086 3300048916 Bacteria 2738
390 Ga0496114_1287930 3300048917 Unclassified 618
391 Ga0501031_0551789 3300049568 Bacteria 742
392 Ga0501033_0313818 3300049570 Bacteria 1102
393 Ga0501036_0342788 3300049572 Bacteria 1248
394 Ga0501037_0870527 3300049573 Bacteria 592
395 Ga0501040_0055397 3300049576 Bacteria 2719
396 Ga0501040_0420731 3300049576 Unclassified 960
397 Ga0501041_0280539 3300049577 Unclassified 1048
398 Ga0501042_0352432 3300049578 Bacteria 1065
399 Ga0501048_0038591 3300049582 Unclassified 3427
400 Ga0501048_0185132 3300049582 Bacteria 1476
401 Ga0501070_0459725 3300049586 Bacteria 1026
402 Ga0501072_0794902 3300049588 Bacteria 741
403 Ga0501073_0098738 3300049589 Bacteria 2028
404 Ga0501074_0120538 3300049590 Bacteria 1876
405 Ga0501074_0199778 3300049590 Bacteria 1425
406 Ga0501075_0064951 3300049591 Bacteria 2753
407 Ga0501075_0286024 3300049591 Bacteria 1256
408 Ga0501076_0093581 3300049592 Bacteria 2419
409 Ga0501076_0224037 3300049592 Bacteria 1537
410 Ga0501076_0503135 3300049592 Bacteria 999
411 Ga0501076_0799069 3300049592 Bacteria 778
412 Ga0501077_0003564 3300049593 Bacteria 9357
413 Ga0501079_0253882 3300049741 Bacteria 1374
414 Ga0501080_0152861 3300049742 Bacteria 2133
415 Ga0501081_0068653 3300049743 Bacteria 2468
416 Ga0501283_082707 3300049779 Bacteria 606
417 Ga0501045_0126875 3300049824 Bacteria 1896
418 Ga0501045_1144921 3300049824 Bacteria 568
419 nmdc:mga05p37_1247831_c1 3300050507 Unclassified 763
420 nmdc:mga05p37_409495_c1 3300050507 Unclassified 1581
421 nmdc:mga09592_618288_c1 3300050508 Bacteria 927
422 nmdc:mga09592_8979_c1 3300050508 Bacteria 8128
423 nmdc:mga0qj67_25877_c1 3300050509 Bacteria 4538
424 nmdc:mga0qj67_420714_c1 3300050509 Unclassified 1077
425 nmdc:mga06r32_1022840_c1 3300050510 Unclassified 778
426 nmdc:mga06r32_1404892_c1 3300050510 Unclassified 640
427 nmdc:mga06r32_1538483_c1 3300050510 Unclassified 605
428 nmdc:mga06r32_53263_c1 3300050510 Bacteria 3877
429 nmdc:mga0n895_217921_c1 3300050512 Unclassified 1938
430 nmdc:mga0n895_294771_c1 3300050512 Bacteria 1644
431 nmdc:mga0rr50_903597_c1 3300050513 Unclassified 753
432 nmdc:mga0a205_1467076_c1 3300050515 Unclassified 530
433 nmdc:mga0a205_21850_c1 3300050515 Bacteria 6051
434 Ga0495619_0269510 3300053085 Bacteria 1180
435 Ga0495619_0484967 3300053085 Bacteria 851
436 Ga0501084_0006340 3300054114 Bacteria 9719
437 Ga0590077_004265 3300059426 Bacteria 2944
438 Ga0501082_0025649 3300060353 Bacteria 5079
439 Ga0501082_0056453 3300060353 Bacteria 3383
440 Ga0501082_0244874 3300060353 Bacteria 1560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_101636915 Ga0070713_1016369151 104
2 3300005536 Ga0070697_100585983 Ga0070697_1005859832 104
3 3300006173 Ga0070716_100095523 Ga0070716_1000955233 104
4 3300025939 Ga0207665_10023985 Ga0207665_100239854 104
5 3300037471 Ga0395905_1336262 Ga0395905_1336262_109_471 104
6 3300036401 Ga0373937_0290861 Ga0373937_0290861_1211_1528 105
7 3300005539 Ga0068853_101749058 Ga0068853_1017490581 109
8 3300005842 Ga0068858_100803205 Ga0068858_1008032052 114
9 3300025941 Ga0207711_10111359 Ga0207711_101113592 114
10 3300025942 Ga0207689_10135553 Ga0207689_101355533 114
11 3300026035 Ga0207703_10175164 Ga0207703_101751642 114
12 3300026118 Ga0207675_100119582 Ga0207675_1001195823 114
13 3300021377 Ga0213874_10014689 Ga0213874_100146892 115
14 3300005334 Ga0068869_100358708 Ga0068869_1003587083 117
15 3300005467 Ga0070706_100063032 Ga0070706_1000630325 117
16 3300005468 Ga0070707_100178595 Ga0070707_1001785953 117
17 3300005471 Ga0070698_100008164 Ga0070698_10000816411 117
18 3300006028 Ga0070717_10075826 Ga0070717_100758263 117
19 3300009176 Ga0105242_10213582 Ga0105242_102135822 117
20 3300009177 Ga0105248_10628098 Ga0105248_106280982 117
21 3300014326 Ga0157380_11113597 Ga0157380_111135972 117
22 3300021361 Ga0213872_10068210 Ga0213872_100682102 117
23 3300025910 Ga0207684_10034603 Ga0207684_100346037 117
24 3300039438 Ga0436360_0629082 Ga0436360_0629082_465_818 117
25 3300039438 Ga0436360_1101180 Ga0436360_1101180_336_689 117
26 3300039447 Ga0436361_0526570 Ga0436361_0526570_6680_7033 117
27 3300039453 Ga0436362_0544676 Ga0436362_0544676_2123_2476 117
28 3300046683 Ga0495658_0135934 Ga0495658_0135934_369_725 117
29 3300003322 rootL2_10229461 rootL2_102294611 118
30 3300005331 Ga0070670_100031526 Ga0070670_1000315262 118
31 3300005334 Ga0068869_100448786 Ga0068869_1004487862 118
32 3300005345 Ga0070692_10123448 Ga0070692_101234482 118
33 3300005353 Ga0070669_100604164 Ga0070669_1006041641 118
34 3300005435 Ga0070714_100488345 Ga0070714_1004883452 118
35 3300005456 Ga0070678_100277387 Ga0070678_1002773872 118
36 3300005458 Ga0070681_10518331 Ga0070681_105183312 118
37 3300005536 Ga0070697_100100480 Ga0070697_1001004802 118
38 3300005546 Ga0070696_101082787 Ga0070696_1010827871 118
39 3300005547 Ga0070693_101099132 Ga0070693_1010991321 118
40 3300005617 Ga0068859_100066599 Ga0068859_1000665997 118
41 3300005617 Ga0068859_101761310 Ga0068859_1017613101 118
42 3300005617 Ga0068859_102608625 Ga0068859_1026086252 118
43 3300005618 Ga0068864_100258635 Ga0068864_1002586353 118
44 3300005618 Ga0068864_100796416 Ga0068864_1007964162 118
45 3300005840 Ga0068870_10066844 Ga0068870_100668443 118
46 3300005844 Ga0068862_100165808 Ga0068862_1001658082 118
47 3300006237 Ga0097621_101561094 Ga0097621_1015610942 118
48 3300006847 Ga0075431_100067561 Ga0075431_1000675614 118
49 3300006847 Ga0075431_100773047 Ga0075431_1007730471 118
50 3300006852 Ga0075433_10133962 Ga0075433_101339622 118
51 3300006852 Ga0075433_11750611 Ga0075433_117506111 118
52 3300006871 Ga0075434_100270328 Ga0075434_1002703282 118
53 3300006931 Ga0097620_100066599 Ga0097620_1000665997 118
54 3300006931 Ga0097620_101761718 Ga0097620_1017617181 118
55 3300006931 Ga0097620_102608492 Ga0097620_1026084922 118
56 3300009094 Ga0111539_10836121 Ga0111539_108361212 118
57 3300009147 Ga0114129_10161816 Ga0114129_101618165 118
58 3300009147 Ga0114129_10291382 Ga0114129_102913822 118
59 3300009174 Ga0105241_10054222 Ga0105241_100542223 118
60 3300011119 Ga0105246_10082264 Ga0105246_100822642 118
61 3300013100 Ga0157373_10002100 Ga0157373_1000210011 118
62 3300013306 Ga0163162_10074354 Ga0163162_100743542 118
63 3300014326 Ga0157380_10923600 Ga0157380_109236002 118
64 3300025908 Ga0207643_10002691 Ga0207643_100026918 118
65 3300025925 Ga0207650_10008495 Ga0207650_100084957 118
66 3300026095 Ga0207676_10138099 Ga0207676_101380992 118
67 3300026095 Ga0207676_10679306 Ga0207676_106793061 118
68 3300026121 Ga0207683_10109256 Ga0207683_101092563 118
69 3300028380 Ga0268265_10158914 Ga0268265_101589142 118
70 3300032002 Ga0307416_100179430 Ga0307416_1001794302 118
71 3300037471 Ga0395905_0034871 Ga0395905_0034871_3114_3470 118
72 3300038443 Ga0395901_0437981 Ga0395901_0437981_945_1301 118
73 3300044694 Ga0466963_0902647 Ga0466963_0902647_77_433 118
74 3300049568 Ga0501031_0551789 Ga0501031_0551789_28_384 118
75 3300049570 Ga0501033_0313818 Ga0501033_0313818_445_801 118
76 3300049572 Ga0501036_0342788 Ga0501036_0342788_722_1078 118
77 3300049576 Ga0501040_0420731 Ga0501040_0420731_35_391 118
78 3300049577 Ga0501041_0280539 Ga0501041_0280539_620_976 118
79 3300049578 Ga0501042_0352432 Ga0501042_0352432_505_861 118
80 3300049582 Ga0501048_0038591 Ga0501048_0038591_757_1113 118
81 3300049582 Ga0501048_0185132 Ga0501048_0185132_1021_1377 118
82 3300049586 Ga0501070_0459725 Ga0501070_0459725_216_572 118
83 3300049590 Ga0501074_0120538 Ga0501074_0120538_324_680 118
84 3300049590 Ga0501074_0199778 Ga0501074_0199778_623_979 118
85 3300049591 Ga0501075_0064951 Ga0501075_0064951_2301_2657 118
86 3300049591 Ga0501075_0286024 Ga0501075_0286024_595_951 118
87 3300049592 Ga0501076_0093581 Ga0501076_0093581_1546_1902 118
88 3300049592 Ga0501076_0224037 Ga0501076_0224037_193_549 118
89 3300049593 Ga0501077_0003564 Ga0501077_0003564_1816_2172 118
90 3300049741 Ga0501079_0253882 Ga0501079_0253882_433_789 118
91 3300049742 Ga0501080_0152861 Ga0501080_0152861_1168_1524 118
92 3300049743 Ga0501081_0068653 Ga0501081_0068653_94_450 118
93 3300049824 Ga0501045_1144921 Ga0501045_1144921_136_492 118
94 3300050507 nmdc:mga05p37_409495_c1 nmdc:mga05p37_409495_c1_604_960 118
95 3300050510 nmdc:mga06r32_1022840_c1 nmdc:mga06r32_1022840_c1_366_722 118
96 3300050510 nmdc:mga06r32_1404892_c1 nmdc:mga06r32_1404892_c1_190_546 118
97 3300050510 nmdc:mga06r32_53263_c1 nmdc:mga06r32_53263_c1_2992_3348 118
98 3300050512 nmdc:mga0n895_294771_c1 nmdc:mga0n895_294771_c1_234_590 118
99 3300050515 nmdc:mga0a205_1467076_c1 nmdc:mga0a205_1467076_c1_74_430 118
100 3300050515 nmdc:mga0a205_21850_c1 nmdc:mga0a205_21850_c1_1417_1773 118
101 3300054114 Ga0501084_0006340 Ga0501084_0006340_1772_2128 118
102 3300060353 Ga0501082_0025649 Ga0501082_0025649_3327_3683 118
103 3300060353 Ga0501082_0056453 Ga0501082_0056453_2736_3092 118
104 3300005290 Ga0065712_10171955 Ga0065712_101719553 119
105 3300005327 Ga0070658_11565107 Ga0070658_115651071 119
106 3300005330 Ga0070690_100164700 Ga0070690_1001647002 119
107 3300005334 Ga0068869_100838337 Ga0068869_1008383372 119
108 3300005335 Ga0070666_10053027 Ga0070666_100530272 119
109 3300005338 Ga0068868_100021228 Ga0068868_1000212286 119
110 3300005340 Ga0070689_100249244 Ga0070689_1002492441 119
111 3300005343 Ga0070687_100996344 Ga0070687_1009963442 119
112 3300005354 Ga0070675_100468816 Ga0070675_1004688161 119
113 3300005354 Ga0070675_100841430 Ga0070675_1008414301 119
114 3300005355 Ga0070671_100119687 Ga0070671_1001196872 119
115 3300005367 Ga0070667_100051788 Ga0070667_1000517883 119
116 3300005455 Ga0070663_100654588 Ga0070663_1006545881 119
117 3300005456 Ga0070678_100318839 Ga0070678_1003188393 119
118 3300005543 Ga0070672_101555013 Ga0070672_1015550131 119
119 3300005548 Ga0070665_100031443 Ga0070665_1000314436 119
120 3300005617 Ga0068859_100788171 Ga0068859_1007881712 119
121 3300005618 Ga0068864_100054278 Ga0068864_1000542786 119
122 3300005718 Ga0068866_10905053 Ga0068866_109050531 119
123 3300005841 Ga0068863_100098597 Ga0068863_1000985975 119
124 3300005842 Ga0068858_100708089 Ga0068858_1007080892 119
125 3300005843 Ga0068860_100149349 Ga0068860_1001493495 119
126 3300006237 Ga0097621_100142411 Ga0097621_1001424114 119
127 3300006846 Ga0075430_100112294 Ga0075430_1001122942 119
128 3300006847 Ga0075431_101705831 Ga0075431_1017058311 119
129 3300006880 Ga0075429_100065688 Ga0075429_1000656883 119
130 3300006881 Ga0068865_101281852 Ga0068865_1012818522 119
131 3300006931 Ga0097620_100788176 Ga0097620_1007881762 119
132 3300009177 Ga0105248_10077218 Ga0105248_100772186 119
133 3300013297 Ga0157378_10956952 Ga0157378_109569521 119
134 3300014325 Ga0163163_10280333 Ga0163163_102803332 119
135 3300014745 Ga0157377_10062023 Ga0157377_100620231 119
136 3300014968 Ga0157379_10178303 Ga0157379_101783034 119
137 3300014969 Ga0157376_10716179 Ga0157376_107161793 119
138 3300025926 Ga0207659_10030545 Ga0207659_100305456 119
139 3300025931 Ga0207644_10151091 Ga0207644_101510914 119
140 3300025931 Ga0207644_10438934 Ga0207644_104389342 119
141 3300025932 Ga0207690_10843061 Ga0207690_108430612 119
142 3300025936 Ga0207670_10453257 Ga0207670_104532572 119
143 3300025938 Ga0207704_10284905 Ga0207704_102849051 119
144 3300025940 Ga0207691_10540095 Ga0207691_105400952 119
145 3300025941 Ga0207711_10161687 Ga0207711_101616872 119
146 3300025941 Ga0207711_10436122 Ga0207711_104361222 119
147 3300026023 Ga0207677_10156326 Ga0207677_101563262 119
148 3300026035 Ga0207703_10830728 Ga0207703_108307282 119
149 3300026067 Ga0207678_10029873 Ga0207678_100298736 119
150 3300026088 Ga0207641_10026746 Ga0207641_100267464 119
151 3300026095 Ga0207676_10127824 Ga0207676_101278244 119
152 3300026121 Ga0207683_10006158 Ga0207683_100061589 119
153 3300028379 Ga0268266_10064111 Ga0268266_100641113 119
154 3300028381 Ga0268264_10311179 Ga0268264_103111791 119
155 3300028800 Ga0265338_10001847 Ga0265338_100018478 119
156 3300039437 Ga0436365_1844273 Ga0436365_1844273_785_1144 119
157 3300039450 Ga0436363_0096207 Ga0436363_0096207_4559_4918 119
158 3300041507 Ga0451851_0515393 Ga0451851_0515393_107_466 119
159 3300046537 Ga0495598_0273690 Ga0495598_0273690_140_499 119
160 3300048912 Ga0496109_1299000 Ga0496109_1299000_242_601 119
161 3300049779 Ga0501283_082707 Ga0501283_082707_126_485 119
162 3300050508 nmdc:mga09592_8979_c1 nmdc:mga09592_8979_c1_4882_5241 119
163 3300050509 nmdc:mga0qj67_25877_c1 nmdc:mga0qj67_25877_c1_2661_3020 119
164 3300005435 Ga0070714_100000827 Ga0070714_10000082720 120
165 3300005436 Ga0070713_100225334 Ga0070713_1002253342 120
166 3300005445 Ga0070708_100171191 Ga0070708_1001711912 120
167 3300005445 Ga0070708_100664550 Ga0070708_1006645502 120
168 3300005468 Ga0070707_100114993 Ga0070707_1001149933 120
169 3300005471 Ga0070698_100287263 Ga0070698_1002872632 120
170 3300005536 Ga0070697_100053091 Ga0070697_1000530912 120
171 3300013105 Ga0157369_10463004 Ga0157369_104630042 120
172 3300025922 Ga0207646_10302342 Ga0207646_103023422 120
173 3300025928 Ga0207700_10280784 Ga0207700_102807843 120
174 3300025929 Ga0207664_10008277 Ga0207664_100082772 120
175 3300031731 Ga0307405_10373112 Ga0307405_103731121 120
176 3300031852 Ga0307410_10080265 Ga0307410_100802654 120
177 3300032005 Ga0307411_10208764 Ga0307411_102087643 120
178 3300032126 Ga0307415_100462348 Ga0307415_1004623482 120
179 3300049592 Ga0501076_0799069 Ga0501076_0799069_203_565 120
180 3300005364 Ga0070673_101807540 Ga0070673_1018075401 121
181 3300006844 Ga0075428_100078846 Ga0075428_1000788465 121
182 3300006846 Ga0075430_100108827 Ga0075430_1001088274 121
183 3300006846 Ga0075430_100454008 Ga0075430_1004540082 121
184 3300006847 Ga0075431_100068840 Ga0075431_1000688405 121
185 3300013297 Ga0157378_10001713 Ga0157378_1000171314 121
186 3300025885 Ga0207653_10094241 Ga0207653_100942413 121
187 3300035724 Ga0373933_0047967 Ga0373933_0047967_1412_1777 121
188 3300042005 Ga0439448_0041485 Ga0439448_0041485_189_554 121
189 3300046472 Ga0495580_0930191 Ga0495580_0930191_80_445 121
190 3300050508 nmdc:mga09592_618288_c1 nmdc:mga09592_618288_c1_180_545 121
191 3300005290 Ga0065712_10176307 Ga0065712_101763072 122
192 3300005471 Ga0070698_100106076 Ga0070698_1001060762 122
193 3300021377 Ga0213874_10013658 Ga0213874_100136582 122
194 3300025906 Ga0207699_11054359 Ga0207699_110543591 122
195 3300031824 Ga0307413_10543279 Ga0307413_105432792 122
196 3300031995 Ga0307409_100186186 Ga0307409_1001861863 122
197 3300032005 Ga0307411_11002925 Ga0307411_110029252 122
198 3300039438 Ga0436360_0251032 Ga0436360_0251032_1037_1405 122
199 3300039447 Ga0436361_1189375 Ga0436361_1189375_119_487 122
200 3300039450 Ga0436363_1602129 Ga0436363_1602129_9007_9375 122
201 3300003214 JGI25165J46597_1023406 JGI25165J46597_10234062 123
202 3300005440 Ga0070705_100015204 Ga0070705_1000152043 123
203 3300005444 Ga0070694_100101634 Ga0070694_1001016343 123
204 3300005445 Ga0070708_100461848 Ga0070708_1004618483 123
205 3300005467 Ga0070706_100105519 Ga0070706_1001055193 123
206 3300005536 Ga0070697_100032863 Ga0070697_1000328633 123
207 3300005545 Ga0070695_100282253 Ga0070695_1002822533 123
208 3300005844 Ga0068862_100324583 Ga0068862_1003245832 123
209 3300009094 Ga0111539_10148236 Ga0111539_101482362 123
210 3300009177 Ga0105248_11109561 Ga0105248_111095612 123
211 3300009553 Ga0105249_11091725 Ga0105249_110917252 123
212 3300009553 Ga0105249_12765492 Ga0105249_127654922 123
213 3300013296 Ga0157374_10256465 Ga0157374_102564652 123
214 3300013297 Ga0157378_10574186 Ga0157378_105741863 123
215 3300013308 Ga0157375_11854433 Ga0157375_118544332 123
216 3300025910 Ga0207684_10017342 Ga0207684_100173425 123
217 3300025922 Ga0207646_10020688 Ga0207646_100206883 123
218 3300025961 Ga0207712_10898816 Ga0207712_108988162 123
219 3300025961 Ga0207712_11482540 Ga0207712_114825402 123
220 3300031731 Ga0307405_10214784 Ga0307405_102147842 123
221 3300035083 Ga0373926_0070979 Ga0373926_0070979_56_430 123
222 3300035692 Ga0373935_0197998 Ga0373935_0197998_351_722 123
223 3300035725 Ga0373947_0449330 Ga0373947_0449330_73_444 123
224 3300046475 Ga0495639_0295719 Ga0495639_0295719_145_516 123
225 3300046476 Ga0495662_0678235 Ga0495662_0678235_86_457 123
226 3300046516 Ga0495628_0500401 Ga0495628_0500401_82_453 123
227 3300046517 Ga0495630_0659664 Ga0495630_0659664_138_509 123
228 3300047321 Ga0495676_0126262 Ga0495676_0126262_1312_1683 123
229 3300048905 Ga0496102_1292634 Ga0496102_1292634_218_589 123
230 3300048915 Ga0496112_0125228 Ga0496112_0125228_2095_2466 123
231 3300050507 nmdc:mga05p37_1247831_c1 nmdc:mga05p37_1247831_c1_280_672 123
232 3300050509 nmdc:mga0qj67_420714_c1 nmdc:mga0qj67_420714_c1_97_489 123
233 3300050510 nmdc:mga06r32_1538483_c1 nmdc:mga06r32_1538483_c1_80_472 123
234 3300050512 nmdc:mga0n895_217921_c1 nmdc:mga0n895_217921_c1_1092_1505 123
235 3300053085 Ga0495619_0269510 Ga0495619_0269510_486_857 123
236 3300053085 Ga0495619_0484967 Ga0495619_0484967_371_742 123
237 3300005435 Ga0070714_100001989 Ga0070714_10000198911 124
238 3300025929 Ga0207664_10001586 Ga0207664_1000158611 124
239 3300042436 Ga0439435_0096213 Ga0439435_0096213_14_397 124
240 3300049589 Ga0501073_0098738 Ga0501073_0098738_668_1042 124
241 3300059426 Ga0590077_004265 Ga0590077_004265_2457_2834 124
242 3300006173 Ga0070716_100560975 Ga0070716_1005609751 125
243 3300025885 Ga0207653_10101129 Ga0207653_101011292 125
244 3300031901 Ga0307406_10597980 Ga0307406_105979802 125
245 3300032002 Ga0307416_100375629 Ga0307416_1003756292 125
246 3300049592 Ga0501076_0503135 Ga0501076_0503135_334_711 125
247 3300006847 Ga0075431_100106757 Ga0075431_1001067573 126
248 3300037068 Ga0373925_0787453 Ga0373925_0787453_128_508 126
249 3300046683 Ga0495658_0200915 Ga0495658_0200915_235_615 126
250 3300049573 Ga0501037_0870527 Ga0501037_0870527_47_445 126
251 3300049576 Ga0501040_0055397 Ga0501040_0055397_1507_1905 126
252 3300049588 Ga0501072_0794902 Ga0501072_0794902_287_685 126
253 3300049824 Ga0501045_0126875 Ga0501045_0126875_575_973 126
254 3300060353 Ga0501082_0244874 Ga0501082_0244874_464_862 126
255 3300005329 Ga0070683_100053699 Ga0070683_1000536995 127
256 3300005535 Ga0070684_100553633 Ga0070684_1005536332 127
257 3300005564 Ga0070664_100000108 Ga0070664_1000001088 127
258 3300005577 Ga0068857_100006613 Ga0068857_1000066135 127
259 3300005983 Ga0081540_1000069 Ga0081540_100006921 127
260 3300005983 Ga0081540_1000351 Ga0081540_100035127 127
261 3300005983 Ga0081540_1000908 Ga0081540_100090817 127
262 3300009147 Ga0114129_11788832 Ga0114129_117888321 127
263 3300014969 Ga0157376_10127805 Ga0157376_101278055 127
264 3300025920 Ga0207649_10009702 Ga0207649_100097025 127
265 3300025944 Ga0207661_10046826 Ga0207661_100468262 127
266 3300025945 Ga0207679_10000113 Ga0207679_1000011346 127
267 3300026116 Ga0207674_10042479 Ga0207674_100424797 127
268 3300034820 Ga0373959_0140214 Ga0373959_0140214_202_585 127
269 3300034957 Ga0373938_0023777 Ga0373938_0023777_146_529 127
270 3300035114 Ga0373939_0394368 Ga0373939_0394368_152_535 127
271 3300039450 Ga0436363_0869252 Ga0436363_0869252_788_1171 127
272 3300039450 Ga0436363_1628994 Ga0436363_1628994_38_421 127
273 3300042876 Ga0451577_0110730 Ga0451577_0110730_1876_2259 127
274 3300045051 Ga0451576_0097744 Ga0451576_0097744_1431_1814 127
275 2162886012 MBSR1b_contig_8896741 MBSR1b_0370.00002690 130
276 3300001978 JGI24747J21853_1029073 JGI24747J21853_10290732 130
277 3300001990 JGI24737J22298_10173423 JGI24737J22298_101734232 130
278 3300001991 JGI24743J22301_10022092 JGI24743J22301_100220921 130
279 3300002074 JGI24748J21848_1013433 JGI24748J21848_10134332 130
280 3300002076 JGI24749J21850_1024678 JGI24749J21850_10246781 130
281 3300002239 JGI24034J26672_10062389 JGI24034J26672_100623891 130
282 3300002459 JGI24751J29686_10004470 JGI24751J29686_100044703 130
283 3300005327 Ga0070658_10010344 Ga0070658_100103441 130
284 3300005328 Ga0070676_10001878 Ga0070676_100018784 130
285 3300005329 Ga0070683_100027756 Ga0070683_1000277567 130
286 3300005330 Ga0070690_100002145 Ga0070690_1000021459 130
287 3300005333 Ga0070677_10001016 Ga0070677_100010166 130
288 3300005334 Ga0068869_100038121 Ga0068869_1000381214 130
289 3300005335 Ga0070666_10001413 Ga0070666_1000141311 130
290 3300005337 Ga0070682_100158630 Ga0070682_1001586302 130
291 3300005338 Ga0068868_100161902 Ga0068868_1001619024 130
292 3300005339 Ga0070660_100000446 Ga0070660_1000004467 130
293 3300005340 Ga0070689_100026056 Ga0070689_1000260561 130
294 3300005341 Ga0070691_10041504 Ga0070691_100415044 130
295 3300005343 Ga0070687_100000065 Ga0070687_10000006533 130
296 3300005344 Ga0070661_100000398 Ga0070661_1000003989 130
297 3300005345 Ga0070692_10034908 Ga0070692_100349083 130
298 3300005347 Ga0070668_100000515 Ga0070668_10000051515 130
299 3300005353 Ga0070669_100001665 Ga0070669_1000016659 130
300 3300005354 Ga0070675_100171638 Ga0070675_1001716384 130
301 3300005355 Ga0070671_100003853 Ga0070671_1000038539 130
302 3300005356 Ga0070674_100002251 Ga0070674_1000022519 130
303 3300005365 Ga0070688_100007745 Ga0070688_1000077451 130
304 3300005366 Ga0070659_100001135 Ga0070659_10000113511 130
305 3300005367 Ga0070667_100005215 Ga0070667_1000052159 130
306 3300005406 Ga0070703_10028229 Ga0070703_100282294 130
307 3300005438 Ga0070701_10004832 Ga0070701_100048325 130
308 3300005439 Ga0070711_100020346 Ga0070711_1000203463 130
309 3300005440 Ga0070705_100003520 Ga0070705_1000035203 130
310 3300005441 Ga0070700_100052544 Ga0070700_1000525444 130
311 3300005455 Ga0070663_100000459 Ga0070663_1000004599 130
312 3300005456 Ga0070678_100007124 Ga0070678_1000071249 130
313 3300005457 Ga0070662_100001745 Ga0070662_1000017456 130
314 3300005458 Ga0070681_10515514 Ga0070681_105155142 130
315 3300005466 Ga0070685_10000852 Ga0070685_100008529 130
316 3300005530 Ga0070679_100341408 Ga0070679_1003414082 130
317 3300005535 Ga0070684_100004761 Ga0070684_1000047619 130
318 3300005539 Ga0068853_100000254 Ga0068853_10000025432 130
319 3300005543 Ga0070672_100017468 Ga0070672_1000174686 130
320 3300005544 Ga0070686_100013239 Ga0070686_1000132396 130
321 3300005545 Ga0070695_100814642 Ga0070695_1008146422 130
322 3300005546 Ga0070696_100004255 Ga0070696_1000042559 130
323 3300005547 Ga0070693_100088515 Ga0070693_1000885154 130
324 3300005549 Ga0070704_100030294 Ga0070704_1000302944 130
325 3300005563 Ga0068855_100001561 Ga0068855_10000156124 130
326 3300005564 Ga0070664_100009997 Ga0070664_1000099973 130
327 3300005577 Ga0068857_100006654 Ga0068857_1000066547 130
328 3300005578 Ga0068854_100003994 Ga0068854_1000039946 130
329 3300005615 Ga0070702_100048996 Ga0070702_1000489961 130
330 3300005618 Ga0068864_100000877 Ga0068864_10000087723 130
331 3300005718 Ga0068866_10000784 Ga0068866_100007844 130
332 3300005719 Ga0068861_100003250 Ga0068861_1000032506 130
333 3300005834 Ga0068851_10000329 Ga0068851_1000032921 130
334 3300005841 Ga0068863_100004462 Ga0068863_1000044624 130
335 3300005842 Ga0068858_100081776 Ga0068858_1000817764 130
336 3300005843 Ga0068860_100003535 Ga0068860_1000035359 130
337 3300006163 Ga0070715_10222664 Ga0070715_102226642 130
338 3300006175 Ga0070712_100577697 Ga0070712_1005776971 130
339 3300006237 Ga0097621_100403993 Ga0097621_1004039933 130
340 3300006358 Ga0068871_100005856 Ga0068871_1000058562 130
341 3300006881 Ga0068865_100000473 Ga0068865_1000004733 130
342 3300007076 Ga0075435_100873173 Ga0075435_1008731731 130
343 3300009092 Ga0105250_10006035 Ga0105250_100060355 130
344 3300009093 Ga0105240_10001833 Ga0105240_100018331 130
345 3300009098 Ga0105245_10000280 Ga0105245_1000028030 130
346 3300009101 Ga0105247_10004247 Ga0105247_100042474 130
347 3300009148 Ga0105243_10003914 Ga0105243_1000391410 130
348 3300009174 Ga0105241_10005517 Ga0105241_100055178 130
349 3300009176 Ga0105242_10002486 Ga0105242_100024864 130
350 3300009177 Ga0105248_10001972 Ga0105248_1000197214 130
351 3300009545 Ga0105237_10000240 Ga0105237_1000024035 130
352 3300009551 Ga0105238_10012454 Ga0105238_100124544 130
353 3300009553 Ga0105249_10000800 Ga0105249_100008009 130
354 3300010375 Ga0105239_10011098 Ga0105239_1001109811 130
355 3300011119 Ga0105246_10019689 Ga0105246_100196891 130
356 3300013100 Ga0157373_10001623 Ga0157373_100016239 130
357 3300013102 Ga0157371_10000524 Ga0157371_1000052443 130
358 3300013105 Ga0157369_10000929 Ga0157369_100009297 130
359 3300013296 Ga0157374_10002830 Ga0157374_100028307 130
360 3300013297 Ga0157378_10000561 Ga0157378_1000056132 130
361 3300013306 Ga0163162_10047795 Ga0163162_100477952 130
362 3300013307 Ga0157372_10009352 Ga0157372_100093527 130
363 3300013308 Ga0157375_10047235 Ga0157375_100472351 130
364 3300014325 Ga0163163_10002780 Ga0163163_100027808 130
365 3300014326 Ga0157380_10073165 Ga0157380_100731654 130
366 3300014745 Ga0157377_10000250 Ga0157377_1000025022 130
367 3300014968 Ga0157379_10000550 Ga0157379_1000055024 130
368 3300014969 Ga0157376_10006402 Ga0157376_100064029 130
369 3300017792 Ga0163161_10013772 Ga0163161_100137725 130
370 3300025315 Ga0207697_10001133 Ga0207697_100011336 130
371 3300025321 Ga0207656_10001117 Ga0207656_100011175 130
372 3300025893 Ga0207682_10000080 Ga0207682_100000806 130
373 3300025899 Ga0207642_10000482 Ga0207642_100004825 130
374 3300025900 Ga0207710_10003374 Ga0207710_100033749 130
375 3300025901 Ga0207688_10000125 Ga0207688_1000012531 130
376 3300025903 Ga0207680_10133324 Ga0207680_101333241 130
377 3300025904 Ga0207647_10000872 Ga0207647_100008727 130
378 3300025907 Ga0207645_10000201 Ga0207645_100002019 130
379 3300025908 Ga0207643_10000288 Ga0207643_1000028832 130
380 3300025909 Ga0207705_10005646 Ga0207705_100056464 130
381 3300025911 Ga0207654_10010212 Ga0207654_100102122 130
382 3300025912 Ga0207707_10330013 Ga0207707_103300131 130
383 3300025913 Ga0207695_10026878 Ga0207695_100268781 130
384 3300025914 Ga0207671_10004945 Ga0207671_100049457 130
385 3300025916 Ga0207663_10043358 Ga0207663_100433582 130
386 3300025918 Ga0207662_10000010 Ga0207662_1000001041 130
387 3300025919 Ga0207657_10000355 Ga0207657_1000035510 130
388 3300025920 Ga0207649_10067055 Ga0207649_100670554 130
389 3300025921 Ga0207652_10306993 Ga0207652_103069932 130
390 3300025923 Ga0207681_10000442 Ga0207681_1000044224 130
391 3300025924 Ga0207694_10888964 Ga0207694_108889641 130
392 3300025925 Ga0207650_10000488 Ga0207650_1000048811 130
393 3300025926 Ga0207659_10000546 Ga0207659_1000054614 130
394 3300025927 Ga0207687_10001978 Ga0207687_100019786 130
395 3300025931 Ga0207644_10000338 Ga0207644_1000033829 130
396 3300025932 Ga0207690_10001586 Ga0207690_100015869 130
397 3300025933 Ga0207706_10000077 Ga0207706_1000007741 130
398 3300025934 Ga0207686_10012626 Ga0207686_100126267 130
399 3300025935 Ga0207709_10002081 Ga0207709_1000208110 130
400 3300025936 Ga0207670_10014426 Ga0207670_100144265 130
401 3300025937 Ga0207669_10001938 Ga0207669_100019384 130
402 3300025938 Ga0207704_10001771 Ga0207704_100017714 130
403 3300025940 Ga0207691_10000033 Ga0207691_1000003343 130
404 3300025941 Ga0207711_10000361 Ga0207711_1000036141 130
405 3300025942 Ga0207689_10000232 Ga0207689_100002329 130
406 3300025944 Ga0207661_10001691 Ga0207661_1000169110 130
407 3300025945 Ga0207679_10013720 Ga0207679_100137202 130
408 3300025949 Ga0207667_10019545 Ga0207667_100195455 130
409 3300025960 Ga0207651_10000848 Ga0207651_100008489 130
410 3300025961 Ga0207712_10001542 Ga0207712_1000154210 130
411 3300025972 Ga0207668_10084871 Ga0207668_100848714 130
412 3300025981 Ga0207640_10023407 Ga0207640_100234071 130
413 3300025986 Ga0207658_10004325 Ga0207658_100043259 130
414 3300026023 Ga0207677_10000346 Ga0207677_1000034624 130
415 3300026035 Ga0207703_10000293 Ga0207703_1000029332 130
416 3300026041 Ga0207639_10000799 Ga0207639_1000079916 130
417 3300026067 Ga0207678_10000135 Ga0207678_1000013534 130
418 3300026075 Ga0207708_10060165 Ga0207708_100601652 130
419 3300026078 Ga0207702_10011434 Ga0207702_100114341 130
420 3300026088 Ga0207641_10001355 Ga0207641_100013559 130
421 3300026089 Ga0207648_10000387 Ga0207648_100003879 130
422 3300026095 Ga0207676_10001108 Ga0207676_100011087 130
423 3300026116 Ga0207674_10000224 Ga0207674_1000022467 130
424 3300026118 Ga0207675_100000043 Ga0207675_10000004342 130
425 3300026121 Ga0207683_10000232 Ga0207683_1000023241 130
426 3300026142 Ga0207698_10006893 Ga0207698_100068937 130
427 3300028379 Ga0268266_10001211 Ga0268266_1000121124 130
428 3300028380 Ga0268265_10000746 Ga0268265_1000074624 130
429 3300028381 Ga0268264_10000771 Ga0268264_100007714 130
430 3300048903 Ga0496100_0108790 Ga0496100_0108790_609_1001 130
431 3300048905 Ga0496102_0008372 Ga0496102_0008372_1983_2375 130
432 3300048906 Ga0496103_0026912 Ga0496103_0026912_1513_1905 130
433 3300048909 Ga0496106_0009616 Ga0496106_0009616_5072_5464 130
434 3300048910 Ga0496107_0159158 Ga0496107_0159158_604_996 130
435 3300048911 Ga0496108_0109373 Ga0496108_0109373_660_1052 130
436 3300048912 Ga0496109_0008472 Ga0496109_0008472_6698_7090 130
437 3300048915 Ga0496112_0005154 Ga0496112_0005154_6212_6604 130
438 3300048916 Ga0496113_0066086 Ga0496113_0066086_395_787 130
439 3300048917 Ga0496114_1287930 Ga0496114_1287930_17_409 130
440 3300050513 nmdc:mga0rr50_903597_c1 nmdc:mga0rr50_903597_c1_76_468 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

64

123

0.88

PF07883

Cupin_2

Cupin domain

46

117

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o5u-assembly2.cif.gz_B crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution 0.8124 40 116
3lwc-assembly1.cif.gz_A-2 crystal structure of structural genomics, unknown function (yp_766765.1) from rhizobium leguminosarum bv. viciae 3841 at 1.40 a resolution 0.8103 25 114
4zua-assembly2.cif.gz_B-2 crystal structure of the exsa regulatory domain 0.8066 38 116
2i45-assembly1.cif.gz_B crystal structure of protein nmb1881 from neisseria meningitidis 0.7977 28 114
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.7871 25 116
ID Description Score Start End Superfamily
af_F1RAQ6_211_524_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8776 18 43 2.130.10.10
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8124 40 116 2.60.120.10
5zbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7927 19 114 2.60.120.10
af_Q59WJ5_1_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7863 61 117 2.60.120.10
af_O48852_32_133_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7851 40 114 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1Q7DU16-F1-model_v4 Cupin 1 21 123
AF-A0A1Q7Y7E0-F1-model_v4 Cupin 0.9945 7 123
AF-A0A382FK91-F1-model_v4 Cupin type-2 domain-containing protein 0.9938 36 123
AF-A0A2V7M3S0-F1-model_v4 Cupin 0.9927 9 123
AF-A0A2V6L6K4-F1-model_v4 Cupin 0.9887 8 123

Feature Viewer

pLDDT pTM Quality
92.15 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map