F444523

General Info

Members Datasets Scaffolds Average Seq Length
440 238 440 143

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0292437|Ga0501072_0292437_531_1067
Length 161
Sequence MTIAMLSLVGILIALYLTLYKLGVIGGLTCTVGSCETVNTSRWATFLGLPVAAWGVGAYVALFALSLAGTADRHAGSQTISVLLVAIAAWSVLFSAWLTYLELFVIRAICIWCVASAVLLVAILVVSVMDWRGSSRDSGFRVASLPQNDRSDQAVNLPGVV

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
209 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
212 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
213 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
214 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
215 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
216 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
217 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
218 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
221 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
224 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
227 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
228 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
229 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
230 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.05
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10014827 3300005293 Bacteria 2936
2 Ga0070658_10121793 3300005327 Bacteria 2168
3 Ga0070658_10391916 3300005327 Bacteria 1192
4 Ga0070676_10789300 3300005328 Unclassified 700
5 Ga0070683_100041829 3300005329 Bacteria 4218
6 Ga0070683_100172572 3300005329 Bacteria 2053
7 Ga0070690_100029945 3300005330 Unclassified 3380
8 Ga0070690_100266149 3300005330 Unclassified 1218
9 Ga0070680_100004892 3300005336 Bacteria 10087
10 Ga0070680_100015411 3300005336 Bacteria 5992
11 Ga0070680_100066980 3300005336 Bacteria 2945
12 Ga0070680_100076663 3300005336 Bacteria 2752
13 Ga0070680_100094998 3300005336 Unclassified 2471
14 Ga0070680_100166474 3300005336 Bacteria 1854
15 Ga0070680_100285456 3300005336 Unclassified 1399
16 Ga0070680_100488600 3300005336 Bacteria 1053
17 Ga0070680_101219620 3300005336 Unclassified 651
18 Ga0070680_101407908 3300005336 Unclassified 604
19 Ga0070682_100017291 3300005337 Bacteria 4203
20 Ga0070682_100031567 3300005337 Bacteria 3204
21 Ga0070660_100113720 3300005339 Bacteria 2155
22 Ga0070660_100230675 3300005339 Bacteria 1506
23 Ga0070660_101481681 3300005339 Unclassified 577
24 Ga0070691_10097617 3300005341 Bacteria 1456
25 Ga0070687_100011484 3300005343 Unclassified 3876
26 Ga0070661_100011269 3300005344 Bacteria 6228
27 Ga0070692_10055637 3300005345 Bacteria 2069
28 Ga0070692_10098136 3300005345 Bacteria 1602
29 Ga0070692_10678694 3300005345 Bacteria 691
30 Ga0070692_11231511 3300005345 Bacteria 534
31 Ga0070668_100005834 3300005347 Bacteria 9130
32 Ga0070669_100000545 3300005353 Bacteria 28111
33 Ga0070669_100057586 3300005353 Bacteria 2851
34 Ga0070669_100213283 3300005353 Bacteria 1524
35 Ga0070669_100623916 3300005353 Bacteria 905
36 Ga0070675_100084217 3300005354 Unclassified 2655
37 Ga0070675_100453012 3300005354 Bacteria 1151
38 Ga0070675_100826472 3300005354 Bacteria 847
39 Ga0070671_100140409 3300005355 Bacteria 2038
40 Ga0070671_100209644 3300005355 Bacteria 1653
41 Ga0070671_100424931 3300005355 Unclassified 1138
42 Ga0070674_100039135 3300005356 Bacteria 3201
43 Ga0070674_100067621 3300005356 Unclassified 2514
44 Ga0070674_100187102 3300005356 Unclassified 1590
45 Ga0070673_100005173 3300005364 Bacteria 8329
46 Ga0070673_100088923 3300005364 Bacteria 2520
47 Ga0070673_101031482 3300005364 Unclassified 767
48 Ga0070659_101132670 3300005366 Unclassified 690
49 Ga0070667_100272632 3300005367 Bacteria 1517
50 Ga0070709_10004734 3300005434 Bacteria 7347
51 Ga0070700_100060809 3300005441 Bacteria 2381
52 Ga0070700_100151994 3300005441 Unclassified 1584
53 Ga0070700_100483432 3300005441 Bacteria 949
54 Ga0070694_100053647 3300005444 Unclassified 2729
55 Ga0070694_100072992 3300005444 Bacteria 2369
56 Ga0070708_100000089 3300005445 Bacteria 59378
57 Ga0070708_100795324 3300005445 Unclassified 889
58 Ga0070663_100004710 3300005455 Bacteria 8045
59 Ga0070663_100388274 3300005455 Bacteria 1138
60 Ga0070663_100389379 3300005455 Unclassified 1137
61 Ga0070678_100031309 3300005456 Bacteria 3668
62 Ga0070678_100410239 3300005456 Bacteria 1179
63 Ga0070678_101095705 3300005456 Bacteria 735
64 Ga0070662_100061960 3300005457 Bacteria 2732
65 Ga0070662_100067676 3300005457 Bacteria 2623
66 Ga0070662_101238847 3300005457 Bacteria 642
67 Ga0070681_10005428 3300005458 Bacteria 12316
68 Ga0070681_10005852 3300005458 Bacteria 11906
69 Ga0070681_10034253 3300005458 Bacteria 5100
70 Ga0070681_10103126 3300005458 Bacteria 2797
71 Ga0070681_10119705 3300005458 Unclassified 2569
72 Ga0070681_10127990 3300005458 Bacteria 2472
73 Ga0070681_10250758 3300005458 Bacteria 1683
74 Ga0070681_10301221 3300005458 Bacteria 1513
75 Ga0068867_100006955 3300005459 Bacteria 8003
76 Ga0068867_100019919 3300005459 Bacteria 4782
77 Ga0068867_100281493 3300005459 Bacteria 1364
78 Ga0070685_10324717 3300005466 Bacteria 1044
79 Ga0070706_100070190 3300005467 Unclassified 3240
80 Ga0070706_100145916 3300005467 Unclassified 2209
81 Ga0070707_100000317 3300005468 Bacteria 47396
82 Ga0070707_100149248 3300005468 Bacteria 2276
83 Ga0070707_100477540 3300005468 Unclassified 1208
84 Ga0070698_100082823 3300005471 Bacteria 3199
85 Ga0070698_100105365 3300005471 Bacteria 2790
86 Ga0070698_100669170 3300005471 Bacteria 980
87 Ga0070699_100219094 3300005518 Bacteria 1696
88 Ga0070699_100381950 3300005518 Unclassified 1272
89 Ga0070679_100002058 3300005530 Bacteria 18073
90 Ga0070679_100010345 3300005530 Bacteria 8846
91 Ga0070679_100011408 3300005530 Bacteria 8468
92 Ga0070679_100033707 3300005530 Bacteria 5070
93 Ga0070679_100061906 3300005530 Bacteria 3730
94 Ga0070679_100312231 3300005530 Unclassified 1522
95 Ga0070679_100545123 3300005530 Bacteria 1103
96 Ga0070684_100191373 3300005535 Bacteria 1862
97 Ga0070684_100368976 3300005535 Unclassified 1321
98 Ga0070684_100371625 3300005535 Bacteria 1316
99 Ga0068853_100106514 3300005539 Bacteria 2485
100 Ga0068853_102236669 3300005539 Unclassified 530
101 Ga0070672_100107245 3300005543 Bacteria 2273
102 Ga0070672_100348271 3300005543 Bacteria 1262
103 Ga0070672_100820522 3300005543 Bacteria 819
104 Ga0070686_100137723 3300005544 Bacteria 1696
105 Ga0070695_100466729 3300005545 Bacteria 970
106 Ga0070696_100001495 3300005546 Bacteria 15335
107 Ga0070696_100101259 3300005546 Bacteria 2064
108 Ga0070696_100148596 3300005546 Bacteria 1718
109 Ga0070696_100473597 3300005546 Bacteria 992
110 Ga0070696_100820015 3300005546 Bacteria 767
111 Ga0070693_100000716 3300005547 Bacteria 14629
112 Ga0070693_100154676 3300005547 Bacteria 1455
113 Ga0070693_100318246 3300005547 Bacteria 1055
114 Ga0070665_100022326 3300005548 Bacteria 6368
115 Ga0070704_100005456 3300005549 Bacteria 7409
116 Ga0068855_100181738 3300005563 Bacteria 2377
117 Ga0068855_100768670 3300005563 Bacteria 1026
118 Ga0070664_100020777 3300005564 Bacteria 5409
119 Ga0070664_100078786 3300005564 Bacteria 2834
120 Ga0070664_100307199 3300005564 Unclassified 1434
121 Ga0070664_100307498 3300005564 Unclassified 1434
122 Ga0070664_100384982 3300005564 Unclassified 1281
123 Ga0068857_100673466 3300005577 Bacteria 981
124 Ga0068854_100061187 3300005578 Bacteria 2726
125 Ga0068854_100393007 3300005578 Bacteria 1146
126 Ga0068854_101131591 3300005578 Bacteria 699
127 Ga0068854_101610370 3300005578 Unclassified 592
128 Ga0068856_100600505 3300005614 Unclassified 1122
129 Ga0068856_100784203 3300005614 Bacteria 973
130 Ga0068856_101237792 3300005614 Bacteria 762
131 Ga0068852_100073153 3300005616 Bacteria 3015
132 Ga0068859_100288454 3300005617 Bacteria 1734
133 Ga0068866_10007089 3300005718 Unclassified 4687
134 Ga0068861_100005892 3300005719 Bacteria 8330
135 Ga0068861_100678634 3300005719 Bacteria 955
136 Ga0068861_101003083 3300005719 Bacteria 797
137 Ga0068870_10012072 3300005840 Bacteria 4025
138 Ga0068862_100003812 3300005844 Bacteria 12844
139 Ga0081539_10000087 3300005985 Bacteria 214031
140 Ga0070716_100004829 3300006173 Bacteria 6477
141 Ga0097621_100747595 3300006237 Unclassified 903
142 Ga0097621_100818413 3300006237 Bacteria 864
143 Ga0075430_100006591 3300006846 Bacteria 9786
144 Ga0075430_100022145 3300006846 Bacteria 5402
145 Ga0075430_100080153 3300006846 Unclassified 2735
146 Ga0075431_100017492 3300006847 Bacteria 7287
147 Ga0075431_100102838 3300006847 Bacteria 2948
148 Ga0075431_100143347 3300006847 Bacteria 2462
149 Ga0075431_100357662 3300006847 Bacteria 1467
150 Ga0075431_100458407 3300006847 Unclassified 1270
151 Ga0075433_10001700 3300006852 Bacteria 16419
152 Ga0075433_11029587 3300006852 Bacteria 717
153 Ga0075434_100025029 3300006871 Bacteria 5838
154 Ga0075434_100914598 3300006871 Bacteria 892
155 Ga0075429_100049305 3300006880 Bacteria 3661
156 Ga0068865_100087136 3300006881 Bacteria 2256
157 Ga0068865_100346171 3300006881 Bacteria 1203
158 Ga0075436_100023633 3300006914 Unclassified 4222
159 Ga0097620_100288492 3300006931 Bacteria 1734
160 Ga0075435_100123621 3300007076 Bacteria 2161
161 Ga0075435_100215649 3300007076 Unclassified 1629
162 Ga0105240_10294011 3300009093 Bacteria 1861
163 Ga0105245_10109011 3300009098 Bacteria 2572
164 Ga0105245_11184414 3300009098 Bacteria 812
165 Ga0114129_10024727 3300009147 Bacteria 8514
166 Ga0114129_12100924 3300009147 Unclassified 681
167 Ga0105243_10221340 3300009148 Unclassified 1673
168 Ga0105241_10092049 3300009174 Bacteria 2394
169 Ga0105241_10164209 3300009174 Unclassified 1828
170 Ga0105248_10029350 3300009177 Bacteria 6136
171 Ga0105248_10253623 3300009177 Bacteria 1980
172 Ga0105248_10421611 3300009177 Unclassified 1503
173 Ga0105237_10071082 3300009545 Bacteria 3475
174 Ga0105238_10083430 3300009551 Bacteria 3185
175 Ga0105249_10000224 3300009553 Bacteria 64572
176 Ga0105249_10543240 3300009553 Bacteria 1212
177 Ga0157373_10195577 3300013100 Bacteria 1425
178 Ga0157371_10065245 3300013102 Bacteria 2579
179 Ga0157370_10061254 3300013104 Bacteria 3572
180 Ga0157369_10156137 3300013105 Bacteria 2410
181 Ga0157369_10285076 3300013105 Bacteria 1720
182 Ga0157374_10037521 3300013296 Bacteria 4448
183 Ga0157378_10029438 3300013297 Bacteria 4848
184 Ga0157378_10053531 3300013297 Unclassified 3593
185 Ga0157378_10240040 3300013297 Bacteria 1731
186 Ga0157378_10410427 3300013297 Bacteria 1336
187 Ga0157378_11840499 3300013297 Bacteria 654
188 Ga0163162_11164852 3300013306 Bacteria 874
189 Ga0163162_11677557 3300013306 Bacteria 726
190 Ga0157372_11346359 3300013307 Unclassified 823
191 Ga0157372_11654575 3300013307 Bacteria 737
192 Ga0157372_12646437 3300013307 Unclassified 576
193 Ga0157375_10056671 3300013308 Unclassified 3871
194 Ga0157375_10249624 3300013308 Bacteria 1935
195 Ga0157380_10043849 3300014326 Bacteria 3503
196 Ga0157380_12246359 3300014326 Unclassified 610
197 Ga0182008_10003068 3300014497 Bacteria 10259
198 Ga0157377_10523751 3300014745 Unclassified 833
199 Ga0157376_10796867 3300014969 Bacteria 957
200 Ga0163161_10217282 3300017792 Bacteria 1479
201 Ga0207682_10042841 3300025893 Unclassified 1850
202 Ga0207645_10011485 3300025907 Bacteria 6045
203 Ga0207645_10406492 3300025907 Unclassified 916
204 Ga0207643_10009044 3300025908 Bacteria 5349
205 Ga0207705_10031690 3300025909 Bacteria 3775
206 Ga0207705_10150981 3300025909 Bacteria 1741
207 Ga0207705_10223468 3300025909 Bacteria 1431
208 Ga0207684_10106264 3300025910 Bacteria 2401
209 Ga0207707_10004390 3300025912 Bacteria 12455
210 Ga0207707_10026589 3300025912 Bacteria 5058
211 Ga0207707_10057388 3300025912 Bacteria 3389
212 Ga0207707_10064161 3300025912 Bacteria 3197
213 Ga0207707_10103965 3300025912 Unclassified 2482
214 Ga0207707_10208934 3300025912 Bacteria 1701
215 Ga0207707_10258049 3300025912 Bacteria 1513
216 Ga0207707_10594488 3300025912 Bacteria 937
217 Ga0207707_10779064 3300025912 Bacteria 798
218 Ga0207671_10069671 3300025914 Bacteria 2621
219 Ga0207660_10012495 3300025917 Bacteria 5557
220 Ga0207660_10029564 3300025917 Bacteria 3760
221 Ga0207660_10203287 3300025917 Unclassified 1548
222 Ga0207660_10232990 3300025917 Bacteria 1448
223 Ga0207660_10517885 3300025917 Bacteria 968
224 Ga0207660_10550482 3300025917 Bacteria 938
225 Ga0207660_10687864 3300025917 Unclassified 834
226 Ga0207662_10011243 3300025918 Unclassified 4956
227 Ga0207657_10007873 3300025919 Bacteria 10875
228 Ga0207657_10211977 3300025919 Bacteria 1554
229 Ga0207657_10297041 3300025919 Unclassified 1280
230 Ga0207649_10691374 3300025920 Bacteria 790
231 Ga0207652_10003840 3300025921 Bacteria 12319
232 Ga0207652_10005503 3300025921 Bacteria 10272
233 Ga0207652_10010965 3300025921 Bacteria 7307
234 Ga0207652_10129534 3300025921 Unclassified 2249
235 Ga0207652_10144191 3300025921 Bacteria 2130
236 Ga0207652_10248074 3300025921 Bacteria 1605
237 Ga0207652_10970349 3300025921 Unclassified 748
238 Ga0207646_10007348 3300025922 Bacteria 11219
239 Ga0207646_10072200 3300025922 Bacteria 3083
240 Ga0207681_10006965 3300025923 Bacteria 6937
241 Ga0207681_10045151 3300025923 Unclassified 2957
242 Ga0207681_10047918 3300025923 Bacteria 2882
243 Ga0207694_10303214 3300025924 Bacteria 1315
244 Ga0207650_10135536 3300025925 Bacteria 1931
245 Ga0207650_10443055 3300025925 Bacteria 1080
246 Ga0207650_10895453 3300025925 Unclassified 753
247 Ga0207687_10970106 3300025927 Bacteria 728
248 Ga0207644_10174915 3300025931 Bacteria 1679
249 Ga0207644_10289985 3300025931 Unclassified 1316
250 Ga0207644_10294379 3300025931 Bacteria 1306
251 Ga0207690_11499802 3300025932 Unclassified 564
252 Ga0207706_10028510 3300025933 Unclassified 4987
253 Ga0207706_10051857 3300025933 Bacteria 3622
254 Ga0207706_10115919 3300025933 Bacteria 2356
255 Ga0207706_10282178 3300025933 Bacteria 1448
256 Ga0207669_10263207 3300025937 Bacteria 1291
257 Ga0207669_10961406 3300025937 Bacteria 716
258 Ga0207665_10003155 3300025939 Bacteria 11051
259 Ga0207691_10005767 3300025940 Bacteria 11986
260 Ga0207691_10014209 3300025940 Bacteria 7595
261 Ga0207691_10142599 3300025940 Bacteria 2110
262 Ga0207711_10060616 3300025941 Bacteria 3261
263 Ga0207711_10154976 3300025941 Bacteria 2070
264 Ga0207661_10012961 3300025944 Bacteria 6082
265 Ga0207679_10008649 3300025945 Bacteria 6489
266 Ga0207679_10016157 3300025945 Bacteria 4950
267 Ga0207667_10100833 3300025949 Bacteria 2978
268 Ga0207667_10117222 3300025949 Bacteria 2744
269 Ga0207667_10680977 3300025949 Bacteria 1032
270 Ga0207651_10216522 3300025960 Bacteria 1545
271 Ga0207651_10324964 3300025960 Bacteria 1287
272 Ga0207668_10397470 3300025972 Unclassified 1164
273 Ga0207640_10017898 3300025981 Bacteria 4153
274 Ga0207658_10191515 3300025986 Bacteria 1700
275 Ga0207677_10155156 3300026023 Bacteria 1772
276 Ga0207677_10324373 3300026023 Unclassified 1281
277 Ga0207677_10569492 3300026023 Bacteria 990
278 Ga0207639_10107835 3300026041 Unclassified 2263
279 Ga0207678_10001013 3300026067 Bacteria 25635
280 Ga0207678_10497476 3300026067 Bacteria 1062
281 Ga0207708_10025034 3300026075 Unclassified 4515
282 Ga0207708_10063233 3300026075 Unclassified 2827
283 Ga0207708_10226129 3300026075 Bacteria 1501
284 Ga0207702_10524895 3300026078 Bacteria 1156
285 Ga0207702_12421567 3300026078 Bacteria 512
286 Ga0207648_10015820 3300026089 Bacteria 6916
287 Ga0207648_10035536 3300026089 Bacteria 4389
288 Ga0207648_10193515 3300026089 Bacteria 1803
289 Ga0207674_10024667 3300026116 Bacteria 6421
290 Ga0207675_100037472 3300026118 Bacteria 4523
291 Ga0207675_100261230 3300026118 Bacteria 1678
292 Ga0207683_10020772 3300026121 Bacteria 5618
293 Ga0207683_10050924 3300026121 Bacteria 3628
294 Ga0207683_10503961 3300026121 Bacteria 1118
295 Ga0207698_10197656 3300026142 Bacteria 1798
296 Ga0209995_1027947 3300027471 Bacteria 942
297 Ga0209968_1053732 3300027526 Bacteria 703
298 Ga0209998_10000439 3300027717 Bacteria 11589
299 Ga0268265_10546903 3300028380 Unclassified 1098
300 Ga0316182_1453216 3300030745 Unclassified 676
301 Ga0307408_100016682 3300031548 Bacteria 4909
302 Ga0307408_100017172 3300031548 Bacteria 4842
303 Ga0307408_101119593 3300031548 Unclassified 731
304 Ga0307405_10020682 3300031731 Unclassified 3682
305 Ga0307405_10076275 3300031731 Bacteria 2174
306 Ga0307405_10106039 3300031731 Bacteria 1894
307 Ga0307405_10407906 3300031731 Unclassified 1066
308 Ga0307405_10456253 3300031731 Unclassified 1015
309 Ga0307413_10208145 3300031824 Unclassified 1418
310 Ga0307410_10071664 3300031852 Bacteria 2404
311 Ga0307410_10082370 3300031852 Unclassified 2263
312 Ga0307410_11077647 3300031852 Unclassified 696
313 Ga0307406_10012171 3300031901 Bacteria 4900
314 Ga0307406_10127740 3300031901 Bacteria 1779
315 Ga0307406_10842359 3300031901 Unclassified 777
316 Ga0307406_11420300 3300031901 Bacteria 609
317 Ga0307407_10047340 3300031903 Unclassified 2440
318 Ga0307407_10340988 3300031903 Bacteria 1058
319 Ga0307412_10001454 3300031911 Bacteria 13172
320 Ga0307412_10097386 3300031911 Bacteria 2073
321 Ga0307412_10511122 3300031911 Bacteria 1002
322 Ga0307409_100098185 3300031995 Unclassified 2421
323 Ga0307409_100150158 3300031995 Unclassified 2021
324 Ga0307409_100845347 3300031995 Unclassified 926
325 Ga0307409_101266934 3300031995 Bacteria 762
326 Ga0307416_100023331 3300032002 Bacteria 4488
327 Ga0307416_100430207 3300032002 Bacteria 1367
328 Ga0307416_100492025 3300032002 Unclassified 1289
329 Ga0307416_101611775 3300032002 Bacteria 754
330 Ga0307414_10533034 3300032004 Unclassified 1044
331 Ga0307414_11033356 3300032004 Unclassified 757
332 Ga0307414_11641385 3300032004 Bacteria 599
333 Ga0307411_10070923 3300032005 Bacteria 2359
334 Ga0307411_10197426 3300032005 Unclassified 1542
335 Ga0307411_10514309 3300032005 Unclassified 1015
336 Ga0307411_11246358 3300032005 Unclassified 676
337 Ga0307411_11804574 3300032005 Bacteria 568
338 Ga0307415_100415779 3300032126 Bacteria 1152
339 Ga0373948_0113402 3300034817 Unclassified 649
340 Ga0373938_0027790 3300034957 Bacteria 1192
341 Ga0373938_0053137 3300034957 Bacteria 930
342 Ga0373929_0072474 3300035085 Unclassified 826
343 Ga0373932_0038140 3300035112 Unclassified 1373
344 Ga0373941_0006802 3300035115 Bacteria 2771
345 Ga0373941_0037548 3300035115 Bacteria 1479
346 Ga0373961_0172223 3300035241 Unclassified 749
347 Ga0373931_1097297 3300035691 Bacteria 542
348 Ga0373935_0051582 3300035692 Bacteria 2613
349 Ga0373937_0081792 3300036401 Bacteria 2988
350 Ga0395905_0184750 3300037471 Bacteria 1957
351 Ga0451789_0453464 3300041443 Unclassified 717
352 Ga0451807_2654675 3300041486 Bacteria 863
353 Ga0451853_1790155 3300041512 Unclassified 610
354 Ga0439431_0137152 3300041997 Bacteria 689
355 Ga0439462_0008661 3300042015 Bacteria 2569
356 Ga0451577_0235323 3300042876 Bacteria 1656
357 Ga0466966_0003349 3300044684 Bacteria 10566
358 Ga0453684_0039035 3300044712 Bacteria 6476
359 Ga0466959_0016914 3300045049 Bacteria 5338
360 Ga0495592_0379690 3300046454 Bacteria 899
361 Ga0495629_0334247 3300046459 Bacteria 1035
362 Ga0495651_0050922 3300046462 Bacteria 3194
363 Ga0495653_0039030 3300046463 Bacteria 3723
364 Ga0495662_0024415 3300046476 Bacteria 2917
365 Ga0495664_0054570 3300046477 Bacteria 2376
366 Ga0495608_0012134 3300046511 Bacteria 5990
367 Ga0495618_0084845 3300046514 Bacteria 2024
368 Ga0495628_0054636 3300046516 Bacteria 3147
369 Ga0495630_0380310 3300046517 Bacteria 1081
370 Ga0495586_0042220 3300046535 Bacteria 2456
371 Ga0495645_0061830 3300046543 Bacteria 2713
372 Ga0495667_0055940 3300046559 Bacteria 2594
373 Ga0495634_0111517 3300046642 Bacteria 1758
374 Ga0495635_0016810 3300046663 Bacteria 5110
375 Ga0495588_0005752 3300046674 Bacteria 5538
376 Ga0495657_0051287 3300046675 Bacteria 2770
377 Ga0495599_0003880 3300046678 Bacteria 8795
378 Ga0495646_0111359 3300046680 Bacteria 1558
379 Ga0495613_0157297 3300046689 Bacteria 1618
380 Ga0495600_0025018 3300046809 Bacteria 3846
381 Ga0495604_0074359 3300047317 Bacteria 2561
382 Ga0495674_0037313 3300047319 Bacteria 4366
383 Ga0495680_0033910 3300047322 Bacteria 4129
384 Ga0495675_0221018 3300047444 Bacteria 1146
385 Ga0495684_0015430 3300047471 Bacteria 5879
386 Ga0495602_0071561 3300048088 Bacteria 2961
387 Ga0496101_0103371 3300048904 Bacteria 2135
388 Ga0496102_0259047 3300048905 Bacteria 1640
389 Ga0496112_0006291 3300048915 Bacteria 10415
390 Ga0496112_0065790 3300048915 Bacteria 3577
391 Ga0496112_0829345 3300048915 Bacteria 849
392 Ga0496114_0053689 3300048917 Bacteria 3359
393 Ga0496115_0016184 3300048918 Bacteria 5674
394 Ga0501292_002287 3300049515 Bacteria 2456
395 Ga0501038_1270147 3300049574 Unclassified 532
396 Ga0501040_0150826 3300049576 Unclassified 1640
397 Ga0501072_0292437 3300049588 Bacteria 1295
398 Ga0501198_010109 3300049649 Unclassified 1391
399 Ga0501202_002632 3300049652 Bacteria 3028
400 Ga0501216_001187 3300049660 Bacteria 3443
401 Ga0501217_008845 3300049661 Unclassified 2182
402 Ga0501224_004861 3300049664 Bacteria 1917
403 Ga0501227_019690 3300049665 Unclassified 1541
404 Ga0501233_001385 3300049668 Unclassified 4145
405 Ga0501236_041315 3300049670 Unclassified 765
406 Ga0501240_010216 3300049673 Unclassified 1243
407 Ga0501242_005807 3300049674 Unclassified 1397
408 Ga0501249_009311 3300049679 Unclassified 2043
409 Ga0501250_002574 3300049680 Bacteria 1656
410 Ga0501251_114378 3300049681 Unclassified 505
411 Ga0501252_008866 3300049682 Unclassified 1164
412 Ga0501253_202506 3300049683 Unclassified 525
413 Ga0501257_014120 3300049686 Unclassified 1834
414 Ga0501259_012103 3300049688 Unclassified 1436
415 Ga0501259_081531 3300049688 Unclassified 712
416 Ga0501260_002878 3300049689 Unclassified 1515
417 Ga0501225_0006893 3300049705 Bacteria 3312
418 Ga0501234_000983 3300049707 Bacteria 4514
419 Ga0501245_045978 3300049708 Unclassified 762
420 Ga0501079_0575335 3300049741 Unclassified 886
421 Ga0501268_001833 3300049765 Bacteria 2711
422 Ga0501274_007886 3300049771 Unclassified 945
423 Ga0501276_002834 3300049773 Unclassified 1238
424 Ga0501283_011735 3300049779 Unclassified 1308
425 Ga0501212_010470 3300049851 Unclassified 1322
426 nmdc:mga05p37_1238314_c1 3300050507 Bacteria 767
427 nmdc:mga05p37_2196450_c1 3300050507 Bacteria 513
428 nmdc:mga05p37_363794_c1 3300050507 Bacteria 1700
429 nmdc:mga09592_107763_c1 3300050508 Bacteria 2390
430 nmdc:mga0qj67_3770_c1 3300050509 Bacteria 10941
431 nmdc:mga0qj67_93381_c1 3300050509 Bacteria 2419
432 nmdc:mga0qj67_98074_c1 3300050509 Bacteria 2361
433 nmdc:mga06r32_151911_c1 3300050510 Bacteria 2294
434 nmdc:mga06r32_251903_c1 3300050510 Bacteria 1753
435 nmdc:mga06r32_886577_c1 3300050510 Bacteria 849
436 nmdc:mga0n895_884952_c1 3300050512 Bacteria 879
437 nmdc:mga0rr50_1156206_c1 3300050513 Unclassified 658
438 nmdc:mga08x19_220266_c1 3300050514 Bacteria 1304
439 nmdc:mga0a205_11578_c1 3300050515 Bacteria 8126
440 nmdc:mga0a205_61581_c1 3300050515 Bacteria 3624

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100430207 Ga0307416_1004302072 118
2 3300031911 Ga0307412_10097386 Ga0307412_100973863 119
3 3300032002 Ga0307416_101611775 Ga0307416_1016117752 119
4 3300032005 Ga0307411_11804574 Ga0307411_118045741 119
5 3300032126 Ga0307415_100415779 Ga0307415_1004157791 119
6 3300050507 nmdc:mga05p37_2196450_c1 nmdc:mga05p37_2196450_c1_104_499 119
7 3300005445 Ga0070708_100795324 Ga0070708_1007953241 122
8 3300049574 Ga0501038_1270147 Ga0501038_1270147_13_474 125
9 3300049741 Ga0501079_0575335 Ga0501079_0575335_65_526 125
10 3300005985 Ga0081539_10000087 Ga0081539_1000008745 126
11 3300005545 Ga0070695_100466729 Ga0070695_1004667292 127
12 3300025912 Ga0207707_10258049 Ga0207707_102580492 127
13 3300025945 Ga0207679_10008649 Ga0207679_100086496 127
14 3300025912 Ga0207707_10208934 Ga0207707_102089343 128
15 3300005356 Ga0070674_100187102 Ga0070674_1001871023 130
16 3300005564 Ga0070664_100384982 Ga0070664_1003849822 130
17 3300005578 Ga0068854_101131591 Ga0068854_1011315911 130
18 3300025893 Ga0207682_10042841 Ga0207682_100428411 130
19 3300025907 Ga0207645_10406492 Ga0207645_104064921 130
20 3300032004 Ga0307414_11641385 Ga0307414_116413852 130
21 3300025927 Ga0207687_10970106 Ga0207687_109701062 131
22 3300025972 Ga0207668_10397470 Ga0207668_103974702 131
23 3300005353 Ga0070669_100623916 Ga0070669_1006239162 133
24 3300005355 Ga0070671_100140409 Ga0070671_1001404093 133
25 3300005364 Ga0070673_100088923 Ga0070673_1000889231 133
26 3300005367 Ga0070667_100272632 Ga0070667_1002726322 133
27 3300005458 Ga0070681_10103126 Ga0070681_101031262 133
28 3300005544 Ga0070686_100137723 Ga0070686_1001377232 133
29 3300013307 Ga0157372_11346359 Ga0157372_113463592 133
30 3300025908 Ga0207643_10009044 Ga0207643_100090446 133
31 3300025912 Ga0207707_10594488 Ga0207707_105944882 133
32 3300025923 Ga0207681_10006965 Ga0207681_100069655 133
33 3300025925 Ga0207650_10895453 Ga0207650_108954532 133
34 3300028380 Ga0268265_10546903 Ga0268265_105469031 133
35 3300005330 Ga0070690_100029945 Ga0070690_1000299453 134
36 3300005354 Ga0070675_100084217 Ga0070675_1000842171 134
37 3300005456 Ga0070678_100410239 Ga0070678_1004102391 134
38 3300005844 Ga0068862_100003812 Ga0068862_10000381217 134
39 3300006914 Ga0075436_100023633 Ga0075436_1000236336 134
40 3300014326 Ga0157380_12246359 Ga0157380_122463592 134
41 3300025940 Ga0207691_10142599 Ga0207691_101425991 134
42 3300005336 Ga0070680_100066980 Ga0070680_1000669802 135
43 3300005345 Ga0070692_10678694 Ga0070692_106786941 135
44 3300005347 Ga0070668_100005834 Ga0070668_1000058343 135
45 3300005456 Ga0070678_101095705 Ga0070678_1010957052 135
46 3300005457 Ga0070662_101238847 Ga0070662_1012388471 135
47 3300005458 Ga0070681_10301221 Ga0070681_103012212 135
48 3300005530 Ga0070679_100010345 Ga0070679_1000103457 135
49 3300005539 Ga0068853_102236669 Ga0068853_1022366691 135
50 3300005543 Ga0070672_100107245 Ga0070672_1001072453 135
51 3300005578 Ga0068854_100393007 Ga0068854_1003930072 135
52 3300006237 Ga0097621_100818413 Ga0097621_1008184131 135
53 3300006846 Ga0075430_100080153 Ga0075430_1000801532 135
54 3300006847 Ga0075431_100357662 Ga0075431_1003576623 135
55 3300006847 Ga0075431_100458407 Ga0075431_1004584072 135
56 3300009098 Ga0105245_11184414 Ga0105245_111844142 135
57 3300009177 Ga0105248_10029350 Ga0105248_100293504 135
58 3300013296 Ga0157374_10037521 Ga0157374_100375211 135
59 3300013297 Ga0157378_10240040 Ga0157378_102400402 135
60 3300013297 Ga0157378_10410427 Ga0157378_104104271 135
61 3300013297 Ga0157378_11840499 Ga0157378_118404991 135
62 3300013307 Ga0157372_11654575 Ga0157372_116545751 135
63 3300013308 Ga0157375_10249624 Ga0157375_102496243 135
64 3300017792 Ga0163161_10217282 Ga0163161_102172821 135
65 3300025917 Ga0207660_10687864 Ga0207660_106878641 135
66 3300025921 Ga0207652_10129534 Ga0207652_101295343 135
67 3300025931 Ga0207644_10294379 Ga0207644_102943792 135
68 3300025933 Ga0207706_10115919 Ga0207706_101159192 135
69 3300025940 Ga0207691_10014209 Ga0207691_100142092 135
70 3300025941 Ga0207711_10060616 Ga0207711_100606163 135
71 3300025986 Ga0207658_10191515 Ga0207658_101915152 135
72 3300026023 Ga0207677_10155156 Ga0207677_101551563 135
73 3300026121 Ga0207683_10503961 Ga0207683_105039612 135
74 3300048915 Ga0496112_0829345 Ga0496112_0829345_125_562 135
75 3300050509 nmdc:mga0qj67_93381_c1 nmdc:mga0qj67_93381_c1_1591_2025 135
76 3300050510 nmdc:mga06r32_251903_c1 nmdc:mga06r32_251903_c1_1016_1450 135
77 3300005327 Ga0070658_10391916 Ga0070658_103919162 136
78 3300005328 Ga0070676_10789300 Ga0070676_107893002 136
79 3300005329 Ga0070683_100041829 Ga0070683_1000418294 136
80 3300005329 Ga0070683_100172572 Ga0070683_1001725723 136
81 3300005330 Ga0070690_100266149 Ga0070690_1002661492 136
82 3300005336 Ga0070680_100004892 Ga0070680_10000489210 136
83 3300005336 Ga0070680_100015411 Ga0070680_1000154113 136
84 3300005336 Ga0070680_100094998 Ga0070680_1000949982 136
85 3300005336 Ga0070680_100166474 Ga0070680_1001664743 136
86 3300005336 Ga0070680_100285456 Ga0070680_1002854562 136
87 3300005336 Ga0070680_101407908 Ga0070680_1014079081 136
88 3300005337 Ga0070682_100017291 Ga0070682_1000172913 136
89 3300005337 Ga0070682_100031567 Ga0070682_1000315675 136
90 3300005339 Ga0070660_100113720 Ga0070660_1001137203 136
91 3300005339 Ga0070660_100230675 Ga0070660_1002306752 136
92 3300005339 Ga0070660_101481681 Ga0070660_1014816811 136
93 3300005341 Ga0070691_10097617 Ga0070691_100976171 136
94 3300005343 Ga0070687_100011484 Ga0070687_1000114845 136
95 3300005344 Ga0070661_100011269 Ga0070661_1000112697 136
96 3300005345 Ga0070692_10055637 Ga0070692_100556373 136
97 3300005345 Ga0070692_10098136 Ga0070692_100981361 136
98 3300005345 Ga0070692_11231511 Ga0070692_112315111 136
99 3300005353 Ga0070669_100057586 Ga0070669_1000575862 136
100 3300005353 Ga0070669_100213283 Ga0070669_1002132832 136
101 3300005354 Ga0070675_100453012 Ga0070675_1004530122 136
102 3300005354 Ga0070675_100826472 Ga0070675_1008264721 136
103 3300005355 Ga0070671_100209644 Ga0070671_1002096442 136
104 3300005355 Ga0070671_100424931 Ga0070671_1004249312 136
105 3300005356 Ga0070674_100039135 Ga0070674_1000391352 136
106 3300005356 Ga0070674_100067621 Ga0070674_1000676211 136
107 3300005364 Ga0070673_100005173 Ga0070673_1000051733 136
108 3300005364 Ga0070673_101031482 Ga0070673_1010314822 136
109 3300005434 Ga0070709_10004734 Ga0070709_100047348 136
110 3300005441 Ga0070700_100060809 Ga0070700_1000608092 136
111 3300005441 Ga0070700_100151994 Ga0070700_1001519941 136
112 3300005444 Ga0070694_100053647 Ga0070694_1000536474 136
113 3300005445 Ga0070708_100000089 Ga0070708_10000008911 136
114 3300005455 Ga0070663_100004710 Ga0070663_1000047103 136
115 3300005455 Ga0070663_100388274 Ga0070663_1003882742 136
116 3300005455 Ga0070663_100389379 Ga0070663_1003893791 136
117 3300005456 Ga0070678_100031309 Ga0070678_1000313094 136
118 3300005457 Ga0070662_100061960 Ga0070662_1000619601 136
119 3300005458 Ga0070681_10005428 Ga0070681_100054289 136
120 3300005458 Ga0070681_10005852 Ga0070681_100058522 136
121 3300005458 Ga0070681_10034253 Ga0070681_100342534 136
122 3300005458 Ga0070681_10250758 Ga0070681_102507583 136
123 3300005459 Ga0068867_100006955 Ga0068867_1000069556 136
124 3300005459 Ga0068867_100019919 Ga0068867_1000199195 136
125 3300005459 Ga0068867_100281493 Ga0068867_1002814931 136
126 3300005466 Ga0070685_10324717 Ga0070685_103247172 136
127 3300005467 Ga0070706_100145916 Ga0070706_1001459163 136
128 3300005468 Ga0070707_100000317 Ga0070707_10000031741 136
129 3300005471 Ga0070698_100082823 Ga0070698_1000828233 136
130 3300005471 Ga0070698_100105365 Ga0070698_1001053653 136
131 3300005530 Ga0070679_100002058 Ga0070679_1000020583 136
132 3300005530 Ga0070679_100011408 Ga0070679_1000114088 136
133 3300005530 Ga0070679_100033707 Ga0070679_1000337075 136
134 3300005530 Ga0070679_100312231 Ga0070679_1003122313 136
135 3300005530 Ga0070679_100545123 Ga0070679_1005451232 136
136 3300005535 Ga0070684_100191373 Ga0070684_1001913733 136
137 3300005535 Ga0070684_100368976 Ga0070684_1003689762 136
138 3300005535 Ga0070684_100371625 Ga0070684_1003716252 136
139 3300005539 Ga0068853_100106514 Ga0068853_1001065143 136
140 3300005543 Ga0070672_100348271 Ga0070672_1003482712 136
141 3300005546 Ga0070696_100101259 Ga0070696_1001012592 136
142 3300005546 Ga0070696_100148596 Ga0070696_1001485963 136
143 3300005546 Ga0070696_100473597 Ga0070696_1004735972 136
144 3300005546 Ga0070696_100820015 Ga0070696_1008200151 136
145 3300005547 Ga0070693_100000716 Ga0070693_10000071613 136
146 3300005547 Ga0070693_100154676 Ga0070693_1001546761 136
147 3300005547 Ga0070693_100318246 Ga0070693_1003182462 136
148 3300005549 Ga0070704_100005456 Ga0070704_1000054568 136
149 3300005563 Ga0068855_100181738 Ga0068855_1001817383 136
150 3300005563 Ga0068855_100768670 Ga0068855_1007686701 136
151 3300005564 Ga0070664_100020777 Ga0070664_1000207773 136
152 3300005564 Ga0070664_100078786 Ga0070664_1000787862 136
153 3300005564 Ga0070664_100307498 Ga0070664_1003074981 136
154 3300005577 Ga0068857_100673466 Ga0068857_1006734661 136
155 3300005578 Ga0068854_100061187 Ga0068854_1000611873 136
156 3300005578 Ga0068854_101610370 Ga0068854_1016103702 136
157 3300005614 Ga0068856_100600505 Ga0068856_1006005053 136
158 3300005614 Ga0068856_100784203 Ga0068856_1007842031 136
159 3300005616 Ga0068852_100073153 Ga0068852_1000731533 136
160 3300005718 Ga0068866_10007089 Ga0068866_100070894 136
161 3300005719 Ga0068861_100678634 Ga0068861_1006786341 136
162 3300005719 Ga0068861_101003083 Ga0068861_1010030832 136
163 3300006173 Ga0070716_100004829 Ga0070716_1000048298 136
164 3300006237 Ga0097621_100747595 Ga0097621_1007475952 136
165 3300006846 Ga0075430_100006591 Ga0075430_10000659110 136
166 3300006846 Ga0075430_100022145 Ga0075430_1000221457 136
167 3300006847 Ga0075431_100102838 Ga0075431_1001028382 136
168 3300006852 Ga0075433_10001700 Ga0075433_1000170014 136
169 3300006852 Ga0075433_11029587 Ga0075433_110295872 136
170 3300006871 Ga0075434_100025029 Ga0075434_1000250297 136
171 3300006871 Ga0075434_100914598 Ga0075434_1009145981 136
172 3300006880 Ga0075429_100049305 Ga0075429_1000493053 136
173 3300006881 Ga0068865_100087136 Ga0068865_1000871362 136
174 3300006881 Ga0068865_100346171 Ga0068865_1003461712 136
175 3300007076 Ga0075435_100123621 Ga0075435_1001236212 136
176 3300007076 Ga0075435_100215649 Ga0075435_1002156492 136
177 3300009098 Ga0105245_10109011 Ga0105245_101090112 136
178 3300009147 Ga0114129_10024727 Ga0114129_100247276 136
179 3300009174 Ga0105241_10092049 Ga0105241_100920493 136
180 3300009174 Ga0105241_10164209 Ga0105241_101642091 136
181 3300009177 Ga0105248_10253623 Ga0105248_102536233 136
182 3300009177 Ga0105248_10421611 Ga0105248_104216112 136
183 3300009551 Ga0105238_10083430 Ga0105238_100834302 136
184 3300009553 Ga0105249_10543240 Ga0105249_105432402 136
185 3300013100 Ga0157373_10195577 Ga0157373_101955771 136
186 3300013102 Ga0157371_10065245 Ga0157371_100652453 136
187 3300013104 Ga0157370_10061254 Ga0157370_100612543 136
188 3300013105 Ga0157369_10156137 Ga0157369_101561373 136
189 3300013105 Ga0157369_10285076 Ga0157369_102850762 136
190 3300013297 Ga0157378_10029438 Ga0157378_100294383 136
191 3300013297 Ga0157378_10053531 Ga0157378_100535315 136
192 3300013306 Ga0163162_11164852 Ga0163162_111648522 136
193 3300013306 Ga0163162_11677557 Ga0163162_116775571 136
194 3300013307 Ga0157372_12646437 Ga0157372_126464372 136
195 3300014745 Ga0157377_10523751 Ga0157377_105237512 136
196 3300014969 Ga0157376_10796867 Ga0157376_107968672 136
197 3300025907 Ga0207645_10011485 Ga0207645_100114854 136
198 3300025909 Ga0207705_10031690 Ga0207705_100316903 136
199 3300025909 Ga0207705_10223468 Ga0207705_102234682 136
200 3300025912 Ga0207707_10026589 Ga0207707_100265896 136
201 3300025912 Ga0207707_10057388 Ga0207707_100573881 136
202 3300025912 Ga0207707_10064161 Ga0207707_100641611 136
203 3300025912 Ga0207707_10103965 Ga0207707_101039653 136
204 3300025917 Ga0207660_10012495 Ga0207660_100124954 136
205 3300025917 Ga0207660_10029564 Ga0207660_100295641 136
206 3300025917 Ga0207660_10203287 Ga0207660_102032872 136
207 3300025917 Ga0207660_10550482 Ga0207660_105504822 136
208 3300025918 Ga0207662_10011243 Ga0207662_100112437 136
209 3300025919 Ga0207657_10007873 Ga0207657_100078733 136
210 3300025919 Ga0207657_10211977 Ga0207657_102119772 136
211 3300025919 Ga0207657_10297041 Ga0207657_102970412 136
212 3300025920 Ga0207649_10691374 Ga0207649_106913741 136
213 3300025921 Ga0207652_10005503 Ga0207652_100055039 136
214 3300025921 Ga0207652_10010965 Ga0207652_100109654 136
215 3300025921 Ga0207652_10144191 Ga0207652_101441913 136
216 3300025921 Ga0207652_10970349 Ga0207652_109703492 136
217 3300025922 Ga0207646_10007348 Ga0207646_100073487 136
218 3300025923 Ga0207681_10045151 Ga0207681_100451514 136
219 3300025923 Ga0207681_10047918 Ga0207681_100479184 136
220 3300025924 Ga0207694_10303214 Ga0207694_103032142 136
221 3300025925 Ga0207650_10135536 Ga0207650_101355361 136
222 3300025925 Ga0207650_10443055 Ga0207650_104430551 136
223 3300025931 Ga0207644_10174915 Ga0207644_101749152 136
224 3300025931 Ga0207644_10289985 Ga0207644_102899852 136
225 3300025932 Ga0207690_11499802 Ga0207690_114998021 136
226 3300025933 Ga0207706_10028510 Ga0207706_100285105 136
227 3300025933 Ga0207706_10051857 Ga0207706_100518574 136
228 3300025937 Ga0207669_10263207 Ga0207669_102632072 136
229 3300025937 Ga0207669_10961406 Ga0207669_109614061 136
230 3300025939 Ga0207665_10003155 Ga0207665_1000315512 136
231 3300025940 Ga0207691_10005767 Ga0207691_1000576711 136
232 3300025941 Ga0207711_10154976 Ga0207711_101549762 136
233 3300025944 Ga0207661_10012961 Ga0207661_100129613 136
234 3300025945 Ga0207679_10016157 Ga0207679_100161574 136
235 3300025949 Ga0207667_10100833 Ga0207667_101008333 136
236 3300025949 Ga0207667_10117222 Ga0207667_101172223 136
237 3300025949 Ga0207667_10680977 Ga0207667_106809772 136
238 3300025960 Ga0207651_10216522 Ga0207651_102165223 136
239 3300025960 Ga0207651_10324964 Ga0207651_103249642 136
240 3300025981 Ga0207640_10017898 Ga0207640_100178985 136
241 3300026023 Ga0207677_10324373 Ga0207677_103243732 136
242 3300026023 Ga0207677_10569492 Ga0207677_105694922 136
243 3300026041 Ga0207639_10107835 Ga0207639_101078353 136
244 3300026067 Ga0207678_10001013 Ga0207678_100010132 136
245 3300026067 Ga0207678_10497476 Ga0207678_104974762 136
246 3300026075 Ga0207708_10025034 Ga0207708_100250343 136
247 3300026075 Ga0207708_10063233 Ga0207708_100632331 136
248 3300026075 Ga0207708_10226129 Ga0207708_102261292 136
249 3300026078 Ga0207702_10524895 Ga0207702_105248952 136
250 3300026089 Ga0207648_10015820 Ga0207648_100158205 136
251 3300026089 Ga0207648_10035536 Ga0207648_100355362 136
252 3300026089 Ga0207648_10193515 Ga0207648_101935151 136
253 3300026116 Ga0207674_10024667 Ga0207674_100246676 136
254 3300026118 Ga0207675_100261230 Ga0207675_1002612303 136
255 3300026121 Ga0207683_10020772 Ga0207683_100207727 136
256 3300026121 Ga0207683_10050924 Ga0207683_100509243 136
257 3300026142 Ga0207698_10197656 Ga0207698_101976561 136
258 3300031901 Ga0307406_10842359 Ga0307406_108423592 136
259 3300031995 Ga0307409_101266934 Ga0307409_1012669341 136
260 3300034817 Ga0373948_0113402 Ga0373948_0113402_77_544 136
261 3300034957 Ga0373938_0027790 Ga0373938_0027790_590_1057 136
262 3300034957 Ga0373938_0053137 Ga0373938_0053137_102_530 136
263 3300035085 Ga0373929_0072474 Ga0373929_0072474_253_720 136
264 3300035112 Ga0373932_0038140 Ga0373932_0038140_234_701 136
265 3300035115 Ga0373941_0006802 Ga0373941_0006802_1533_2000 136
266 3300035115 Ga0373941_0037548 Ga0373941_0037548_543_971 136
267 3300035241 Ga0373961_0172223 Ga0373961_0172223_85_552 136
268 3300035691 Ga0373931_1097297 Ga0373931_1097297_79_507 136
269 3300035692 Ga0373935_0051582 Ga0373935_0051582_182_625 136
270 3300037471 Ga0395905_0184750 Ga0395905_0184750_315_728 136
271 3300041443 Ga0451789_0453464 Ga0451789_0453464_11_430 136
272 3300041486 Ga0451807_2654675 Ga0451807_2654675_340_771 136
273 3300041512 Ga0451853_1790155 Ga0451853_1790155_74_505 136
274 3300041997 Ga0439431_0137152 Ga0439431_0137152_239_661 136
275 3300042015 Ga0439462_0008661 Ga0439462_0008661_1942_2364 136
276 3300042876 Ga0451577_0235323 Ga0451577_0235323_587_1000 136
277 3300044712 Ga0453684_0039035 Ga0453684_0039035_3744_4157 136
278 3300046674 Ga0495588_0005752 Ga0495588_0005752_4569_4985 136
279 3300048915 Ga0496112_0006291 Ga0496112_0006291_9773_10240 136
280 3300048915 Ga0496112_0065790 Ga0496112_0065790_1656_2093 136
281 3300050508 nmdc:mga09592_107763_c1 nmdc:mga09592_107763_c1_1205_1618 136
282 3300050509 nmdc:mga0qj67_3770_c1 nmdc:mga0qj67_3770_c1_672_1133 136
283 3300050509 nmdc:mga0qj67_98074_c1 nmdc:mga0qj67_98074_c1_1485_1898 136
284 3300050512 nmdc:mga0n895_884952_c1 nmdc:mga0n895_884952_c1_338_757 136
285 3300050513 nmdc:mga0rr50_1156206_c1 nmdc:mga0rr50_1156206_c1_175_642 136
286 3300050514 nmdc:mga08x19_220266_c1 nmdc:mga08x19_220266_c1_215_643 136
287 3300050515 nmdc:mga0a205_11578_c1 nmdc:mga0a205_11578_c1_4937_5404 136
288 3300050515 nmdc:mga0a205_61581_c1 nmdc:mga0a205_61581_c1_2079_2513 136
289 3300005293 Ga0065715_10014827 Ga0065715_100148273 137
290 3300005327 Ga0070658_10121793 Ga0070658_101217933 137
291 3300005336 Ga0070680_100076663 Ga0070680_1000766632 137
292 3300005336 Ga0070680_100488600 Ga0070680_1004886002 137
293 3300005336 Ga0070680_101219620 Ga0070680_1012196201 137
294 3300005353 Ga0070669_100000545 Ga0070669_10000054523 137
295 3300005366 Ga0070659_101132670 Ga0070659_1011326701 137
296 3300005441 Ga0070700_100483432 Ga0070700_1004834322 137
297 3300005444 Ga0070694_100072992 Ga0070694_1000729923 137
298 3300005457 Ga0070662_100067676 Ga0070662_1000676763 137
299 3300005458 Ga0070681_10119705 Ga0070681_101197053 137
300 3300005458 Ga0070681_10127990 Ga0070681_101279903 137
301 3300005467 Ga0070706_100070190 Ga0070706_1000701905 137
302 3300005468 Ga0070707_100149248 Ga0070707_1001492482 137
303 3300005468 Ga0070707_100477540 Ga0070707_1004775402 137
304 3300005471 Ga0070698_100669170 Ga0070698_1006691701 137
305 3300005518 Ga0070699_100219094 Ga0070699_1002190943 137
306 3300005518 Ga0070699_100381950 Ga0070699_1003819502 137
307 3300005530 Ga0070679_100061906 Ga0070679_1000619064 137
308 3300005543 Ga0070672_100820522 Ga0070672_1008205221 137
309 3300005546 Ga0070696_100001495 Ga0070696_1000014951 137
310 3300005548 Ga0070665_100022326 Ga0070665_1000223266 137
311 3300005564 Ga0070664_100307199 Ga0070664_1003071992 137
312 3300005614 Ga0068856_101237792 Ga0068856_1012377922 137
313 3300005617 Ga0068859_100288454 Ga0068859_1002884543 137
314 3300005719 Ga0068861_100005892 Ga0068861_10000589211 137
315 3300005840 Ga0068870_10012072 Ga0068870_100120721 137
316 3300006847 Ga0075431_100017492 Ga0075431_1000174923 137
317 3300006847 Ga0075431_100143347 Ga0075431_1001433473 137
318 3300006931 Ga0097620_100288492 Ga0097620_1002884922 137
319 3300009093 Ga0105240_10294011 Ga0105240_102940113 137
320 3300009147 Ga0114129_12100924 Ga0114129_121009242 137
321 3300009148 Ga0105243_10221340 Ga0105243_102213403 137
322 3300009545 Ga0105237_10071082 Ga0105237_100710823 137
323 3300009553 Ga0105249_10000224 Ga0105249_1000022429 137
324 3300013308 Ga0157375_10056671 Ga0157375_100566711 137
325 3300014326 Ga0157380_10043849 Ga0157380_100438493 137
326 3300014497 Ga0182008_10003068 Ga0182008_100030684 137
327 3300025909 Ga0207705_10150981 Ga0207705_101509813 137
328 3300025910 Ga0207684_10106264 Ga0207684_101062642 137
329 3300025912 Ga0207707_10004390 Ga0207707_1000439011 137
330 3300025912 Ga0207707_10779064 Ga0207707_107790642 137
331 3300025914 Ga0207671_10069671 Ga0207671_100696713 137
332 3300025917 Ga0207660_10232990 Ga0207660_102329901 137
333 3300025917 Ga0207660_10517885 Ga0207660_105178852 137
334 3300025921 Ga0207652_10003840 Ga0207652_1000384010 137
335 3300025921 Ga0207652_10248074 Ga0207652_102480742 137
336 3300025922 Ga0207646_10072200 Ga0207646_100722003 137
337 3300025933 Ga0207706_10282178 Ga0207706_102821782 137
338 3300026078 Ga0207702_12421567 Ga0207702_124215671 137
339 3300026118 Ga0207675_100037472 Ga0207675_1000374726 137
340 3300027471 Ga0209995_1027947 Ga0209995_10279472 137
341 3300027526 Ga0209968_1053732 Ga0209968_10537322 137
342 3300027717 Ga0209998_10000439 Ga0209998_100004399 137
343 3300030745 Ga0316182_1453216 Ga0316182_14532162 137
344 3300031548 Ga0307408_100016682 Ga0307408_1000166827 137
345 3300031548 Ga0307408_100017172 Ga0307408_1000171722 137
346 3300031548 Ga0307408_101119593 Ga0307408_1011195931 137
347 3300031731 Ga0307405_10020682 Ga0307405_100206822 137
348 3300031731 Ga0307405_10076275 Ga0307405_100762753 137
349 3300031731 Ga0307405_10106039 Ga0307405_101060392 137
350 3300031731 Ga0307405_10407906 Ga0307405_104079062 137
351 3300031731 Ga0307405_10456253 Ga0307405_104562532 137
352 3300031824 Ga0307413_10208145 Ga0307413_102081452 137
353 3300031852 Ga0307410_10071664 Ga0307410_100716642 137
354 3300031852 Ga0307410_10082370 Ga0307410_100823703 137
355 3300031852 Ga0307410_11077647 Ga0307410_110776471 137
356 3300031901 Ga0307406_10012171 Ga0307406_100121712 137
357 3300031901 Ga0307406_10127740 Ga0307406_101277402 137
358 3300031901 Ga0307406_11420300 Ga0307406_114203002 137
359 3300031903 Ga0307407_10047340 Ga0307407_100473402 137
360 3300031903 Ga0307407_10340988 Ga0307407_103409882 137
361 3300031911 Ga0307412_10001454 Ga0307412_100014547 137
362 3300031911 Ga0307412_10511122 Ga0307412_105111221 137
363 3300031995 Ga0307409_100098185 Ga0307409_1000981853 137
364 3300031995 Ga0307409_100150158 Ga0307409_1001501583 137
365 3300031995 Ga0307409_100845347 Ga0307409_1008453472 137
366 3300032002 Ga0307416_100023331 Ga0307416_1000233313 137
367 3300032002 Ga0307416_100492025 Ga0307416_1004920252 137
368 3300032004 Ga0307414_10533034 Ga0307414_105330342 137
369 3300032004 Ga0307414_11033356 Ga0307414_110333561 137
370 3300032005 Ga0307411_10070923 Ga0307411_100709233 137
371 3300032005 Ga0307411_10197426 Ga0307411_101974262 137
372 3300032005 Ga0307411_10514309 Ga0307411_105143092 137
373 3300032005 Ga0307411_11246358 Ga0307411_112463581 137
374 3300036401 Ga0373937_0081792 Ga0373937_0081792_13_447 137
375 3300044684 Ga0466966_0003349 Ga0466966_0003349_116_556 137
376 3300045049 Ga0466959_0016914 Ga0466959_0016914_3651_4082 137
377 3300046454 Ga0495592_0379690 Ga0495592_0379690_291_728 137
378 3300046459 Ga0495629_0334247 Ga0495629_0334247_11_445 137
379 3300046462 Ga0495651_0050922 Ga0495651_0050922_2716_3150 137
380 3300046463 Ga0495653_0039030 Ga0495653_0039030_502_936 137
381 3300046476 Ga0495662_0024415 Ga0495662_0024415_2428_2862 137
382 3300046477 Ga0495664_0054570 Ga0495664_0054570_74_508 137
383 3300046511 Ga0495608_0012134 Ga0495608_0012134_4511_4945 137
384 3300046514 Ga0495618_0084845 Ga0495618_0084845_291_725 137
385 3300046516 Ga0495628_0054636 Ga0495628_0054636_13_447 137
386 3300046517 Ga0495630_0380310 Ga0495630_0380310_585_1019 137
387 3300046535 Ga0495586_0042220 Ga0495586_0042220_45_479 137
388 3300046543 Ga0495645_0061830 Ga0495645_0061830_669_1106 137
389 3300046559 Ga0495667_0055940 Ga0495667_0055940_1152_1586 137
390 3300046642 Ga0495634_0111517 Ga0495634_0111517_1245_1679 137
391 3300046663 Ga0495635_0016810 Ga0495635_0016810_80_514 137
392 3300046675 Ga0495657_0051287 Ga0495657_0051287_2297_2731 137
393 3300046678 Ga0495599_0003880 Ga0495599_0003880_7657_8094 137
394 3300046680 Ga0495646_0111359 Ga0495646_0111359_1102_1536 137
395 3300046689 Ga0495613_0157297 Ga0495613_0157297_1008_1442 137
396 3300046809 Ga0495600_0025018 Ga0495600_0025018_3133_3567 137
397 3300047317 Ga0495604_0074359 Ga0495604_0074359_2094_2528 137
398 3300047319 Ga0495674_0037313 Ga0495674_0037313_1025_1459 137
399 3300047322 Ga0495680_0033910 Ga0495680_0033910_22_456 137
400 3300047444 Ga0495675_0221018 Ga0495675_0221018_700_1134 137
401 3300047471 Ga0495684_0015430 Ga0495684_0015430_5390_5824 137
402 3300048088 Ga0495602_0071561 Ga0495602_0071561_2478_2912 137
403 3300048904 Ga0496101_0103371 Ga0496101_0103371_273_689 137
404 3300048905 Ga0496102_0259047 Ga0496102_0259047_321_737 137
405 3300048917 Ga0496114_0053689 Ga0496114_0053689_1039_1455 137
406 3300048918 Ga0496115_0016184 Ga0496115_0016184_2442_2858 137
407 3300049515 Ga0501292_002287 Ga0501292_002287_124_549 137
408 3300049576 Ga0501040_0150826 Ga0501040_0150826_1169_1630 137
409 3300049588 Ga0501072_0292437 Ga0501072_0292437_531_1067 137
410 3300049649 Ga0501198_010109 Ga0501198_010109_864_1289 137
411 3300049652 Ga0501202_002632 Ga0501202_002632_255_680 137
412 3300049660 Ga0501216_001187 Ga0501216_001187_2758_3183 137
413 3300049661 Ga0501217_008845 Ga0501217_008845_1381_1806 137
414 3300049664 Ga0501224_004861 Ga0501224_004861_728_1153 137
415 3300049665 Ga0501227_019690 Ga0501227_019690_62_487 137
416 3300049668 Ga0501233_001385 Ga0501233_001385_1588_2013 137
417 3300049670 Ga0501236_041315 Ga0501236_041315_81_506 137
418 3300049673 Ga0501240_010216 Ga0501240_010216_113_538 137
419 3300049674 Ga0501242_005807 Ga0501242_005807_903_1328 137
420 3300049679 Ga0501249_009311 Ga0501249_009311_1058_1483 137
421 3300049680 Ga0501250_002574 Ga0501250_002574_783_1208 137
422 3300049681 Ga0501251_114378 Ga0501251_114378_33_458 137
423 3300049682 Ga0501252_008866 Ga0501252_008866_420_845 137
424 3300049683 Ga0501253_202506 Ga0501253_202506_59_484 137
425 3300049686 Ga0501257_014120 Ga0501257_014120_1210_1635 137
426 3300049688 Ga0501259_012103 Ga0501259_012103_279_704 137
427 3300049688 Ga0501259_081531 Ga0501259_081531_32_466 137
428 3300049689 Ga0501260_002878 Ga0501260_002878_534_959 137
429 3300049705 Ga0501225_0006893 Ga0501225_0006893_1507_1932 137
430 3300049707 Ga0501234_000983 Ga0501234_000983_3978_4403 137
431 3300049708 Ga0501245_045978 Ga0501245_045978_225_650 137
432 3300049765 Ga0501268_001833 Ga0501268_001833_1406_1831 137
433 3300049771 Ga0501274_007886 Ga0501274_007886_405_830 137
434 3300049773 Ga0501276_002834 Ga0501276_002834_369_794 137
435 3300049779 Ga0501283_011735 Ga0501283_011735_51_476 137
436 3300049851 Ga0501212_010470 Ga0501212_010470_884_1309 137
437 3300050507 nmdc:mga05p37_1238314_c1 nmdc:mga05p37_1238314_c1_37_498 137
438 3300050507 nmdc:mga05p37_363794_c1 nmdc:mga05p37_363794_c1_794_1231 137
439 3300050510 nmdc:mga06r32_151911_c1 nmdc:mga06r32_151911_c1_1066_1542 137
440 3300050510 nmdc:mga06r32_886577_c1 nmdc:mga06r32_886577_c1_359_796 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07884

VKOR

Vitamin K epoxide reductase family

1

128

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nv5-assembly2.cif.gz_B c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.8916 2 128
4nv5-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.8896 4 129
4nv2-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2221 crystal form 0.8826 1 128
6wvh-assembly1.cif.gz_A human vkor with brodifacoum 0.8158 5 132
4nv2-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2221 crystal form 0.8096 1 128
ID Description Score Start End Superfamily
4nv5A01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8896 4 129 1.20.1440.130
af_Q54V87_14_188_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8715 2 131 1.20.1440.130
af_Q10S76_73_247_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.866 3 136 1.20.1440.130
af_A1ZAJ5_3_151_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8557 3 133 1.20.1440.130
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8443 2 131 1.20.1440.130
ID Description Score Start End GO Terms
AF-A0A7Y5PBN3-F1-model_v4 Vitamin K epoxide reductase family protein 0.9946 3 136 GO:0016020
GO:0016491
GO:0048038
AF-A0A2V7GHQ1-F1-model_v4 Vitamin K epoxide reductase 0.9901 2 134 GO:0016020
GO:0016491
GO:0048038
AF-A0A7Y5QL11-F1-model_v4 Vitamin K epoxide reductase family protein 0.9891 1 132 GO:0016020
GO:0016491
GO:0048038
AF-A0A2V7QJY1-F1-model_v4 Vitamin K epoxide reductase 0.9868 1 135 GO:0016020
GO:0016491
GO:0048038
AF-A0A7W1UIM1-F1-model_v4 Vitamin K epoxide reductase family protein 0.9846 1 136 GO:0016020
GO:0016491
GO:0048038

Feature Viewer

pLDDT pTM Quality
88.07 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map