F444523
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 440 | 238 | 440 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0292437|Ga0501072_0292437_531_1067 |
| Length | 161 |
| Sequence | MTIAMLSLVGILIALYLTLYKLGVIGGLTCTVGSCETVNTSRWATFLGLPVAAWGVGAYVALFALSLAGTADRHAGSQTISVLLVAIAAWSVLFSAWLTYLELFVIRAICIWCVASAVLLVAILVVSVMDWRGSSRDSGFRVASLPQNDRSDQAVNLPGVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 150 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 151 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 152 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 163 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 166 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 167 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 168 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 205 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 206 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 207 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 208 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 213 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 214 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 216 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 217 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 218 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 219 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 220 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 221 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 222 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 225 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 227 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 228 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 229 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 230 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 231 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.05 |
| Rhizosphere | 97.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10014827 | 3300005293 | Bacteria | 2936 |
| 2 | Ga0070658_10121793 | 3300005327 | Bacteria | 2168 |
| 3 | Ga0070658_10391916 | 3300005327 | Bacteria | 1192 |
| 4 | Ga0070676_10789300 | 3300005328 | Unclassified | 700 |
| 5 | Ga0070683_100041829 | 3300005329 | Bacteria | 4218 |
| 6 | Ga0070683_100172572 | 3300005329 | Bacteria | 2053 |
| 7 | Ga0070690_100029945 | 3300005330 | Unclassified | 3380 |
| 8 | Ga0070690_100266149 | 3300005330 | Unclassified | 1218 |
| 9 | Ga0070680_100004892 | 3300005336 | Bacteria | 10087 |
| 10 | Ga0070680_100015411 | 3300005336 | Bacteria | 5992 |
| 11 | Ga0070680_100066980 | 3300005336 | Bacteria | 2945 |
| 12 | Ga0070680_100076663 | 3300005336 | Bacteria | 2752 |
| 13 | Ga0070680_100094998 | 3300005336 | Unclassified | 2471 |
| 14 | Ga0070680_100166474 | 3300005336 | Bacteria | 1854 |
| 15 | Ga0070680_100285456 | 3300005336 | Unclassified | 1399 |
| 16 | Ga0070680_100488600 | 3300005336 | Bacteria | 1053 |
| 17 | Ga0070680_101219620 | 3300005336 | Unclassified | 651 |
| 18 | Ga0070680_101407908 | 3300005336 | Unclassified | 604 |
| 19 | Ga0070682_100017291 | 3300005337 | Bacteria | 4203 |
| 20 | Ga0070682_100031567 | 3300005337 | Bacteria | 3204 |
| 21 | Ga0070660_100113720 | 3300005339 | Bacteria | 2155 |
| 22 | Ga0070660_100230675 | 3300005339 | Bacteria | 1506 |
| 23 | Ga0070660_101481681 | 3300005339 | Unclassified | 577 |
| 24 | Ga0070691_10097617 | 3300005341 | Bacteria | 1456 |
| 25 | Ga0070687_100011484 | 3300005343 | Unclassified | 3876 |
| 26 | Ga0070661_100011269 | 3300005344 | Bacteria | 6228 |
| 27 | Ga0070692_10055637 | 3300005345 | Bacteria | 2069 |
| 28 | Ga0070692_10098136 | 3300005345 | Bacteria | 1602 |
| 29 | Ga0070692_10678694 | 3300005345 | Bacteria | 691 |
| 30 | Ga0070692_11231511 | 3300005345 | Bacteria | 534 |
| 31 | Ga0070668_100005834 | 3300005347 | Bacteria | 9130 |
| 32 | Ga0070669_100000545 | 3300005353 | Bacteria | 28111 |
| 33 | Ga0070669_100057586 | 3300005353 | Bacteria | 2851 |
| 34 | Ga0070669_100213283 | 3300005353 | Bacteria | 1524 |
| 35 | Ga0070669_100623916 | 3300005353 | Bacteria | 905 |
| 36 | Ga0070675_100084217 | 3300005354 | Unclassified | 2655 |
| 37 | Ga0070675_100453012 | 3300005354 | Bacteria | 1151 |
| 38 | Ga0070675_100826472 | 3300005354 | Bacteria | 847 |
| 39 | Ga0070671_100140409 | 3300005355 | Bacteria | 2038 |
| 40 | Ga0070671_100209644 | 3300005355 | Bacteria | 1653 |
| 41 | Ga0070671_100424931 | 3300005355 | Unclassified | 1138 |
| 42 | Ga0070674_100039135 | 3300005356 | Bacteria | 3201 |
| 43 | Ga0070674_100067621 | 3300005356 | Unclassified | 2514 |
| 44 | Ga0070674_100187102 | 3300005356 | Unclassified | 1590 |
| 45 | Ga0070673_100005173 | 3300005364 | Bacteria | 8329 |
| 46 | Ga0070673_100088923 | 3300005364 | Bacteria | 2520 |
| 47 | Ga0070673_101031482 | 3300005364 | Unclassified | 767 |
| 48 | Ga0070659_101132670 | 3300005366 | Unclassified | 690 |
| 49 | Ga0070667_100272632 | 3300005367 | Bacteria | 1517 |
| 50 | Ga0070709_10004734 | 3300005434 | Bacteria | 7347 |
| 51 | Ga0070700_100060809 | 3300005441 | Bacteria | 2381 |
| 52 | Ga0070700_100151994 | 3300005441 | Unclassified | 1584 |
| 53 | Ga0070700_100483432 | 3300005441 | Bacteria | 949 |
| 54 | Ga0070694_100053647 | 3300005444 | Unclassified | 2729 |
| 55 | Ga0070694_100072992 | 3300005444 | Bacteria | 2369 |
| 56 | Ga0070708_100000089 | 3300005445 | Bacteria | 59378 |
| 57 | Ga0070708_100795324 | 3300005445 | Unclassified | 889 |
| 58 | Ga0070663_100004710 | 3300005455 | Bacteria | 8045 |
| 59 | Ga0070663_100388274 | 3300005455 | Bacteria | 1138 |
| 60 | Ga0070663_100389379 | 3300005455 | Unclassified | 1137 |
| 61 | Ga0070678_100031309 | 3300005456 | Bacteria | 3668 |
| 62 | Ga0070678_100410239 | 3300005456 | Bacteria | 1179 |
| 63 | Ga0070678_101095705 | 3300005456 | Bacteria | 735 |
| 64 | Ga0070662_100061960 | 3300005457 | Bacteria | 2732 |
| 65 | Ga0070662_100067676 | 3300005457 | Bacteria | 2623 |
| 66 | Ga0070662_101238847 | 3300005457 | Bacteria | 642 |
| 67 | Ga0070681_10005428 | 3300005458 | Bacteria | 12316 |
| 68 | Ga0070681_10005852 | 3300005458 | Bacteria | 11906 |
| 69 | Ga0070681_10034253 | 3300005458 | Bacteria | 5100 |
| 70 | Ga0070681_10103126 | 3300005458 | Bacteria | 2797 |
| 71 | Ga0070681_10119705 | 3300005458 | Unclassified | 2569 |
| 72 | Ga0070681_10127990 | 3300005458 | Bacteria | 2472 |
| 73 | Ga0070681_10250758 | 3300005458 | Bacteria | 1683 |
| 74 | Ga0070681_10301221 | 3300005458 | Bacteria | 1513 |
| 75 | Ga0068867_100006955 | 3300005459 | Bacteria | 8003 |
| 76 | Ga0068867_100019919 | 3300005459 | Bacteria | 4782 |
| 77 | Ga0068867_100281493 | 3300005459 | Bacteria | 1364 |
| 78 | Ga0070685_10324717 | 3300005466 | Bacteria | 1044 |
| 79 | Ga0070706_100070190 | 3300005467 | Unclassified | 3240 |
| 80 | Ga0070706_100145916 | 3300005467 | Unclassified | 2209 |
| 81 | Ga0070707_100000317 | 3300005468 | Bacteria | 47396 |
| 82 | Ga0070707_100149248 | 3300005468 | Bacteria | 2276 |
| 83 | Ga0070707_100477540 | 3300005468 | Unclassified | 1208 |
| 84 | Ga0070698_100082823 | 3300005471 | Bacteria | 3199 |
| 85 | Ga0070698_100105365 | 3300005471 | Bacteria | 2790 |
| 86 | Ga0070698_100669170 | 3300005471 | Bacteria | 980 |
| 87 | Ga0070699_100219094 | 3300005518 | Bacteria | 1696 |
| 88 | Ga0070699_100381950 | 3300005518 | Unclassified | 1272 |
| 89 | Ga0070679_100002058 | 3300005530 | Bacteria | 18073 |
| 90 | Ga0070679_100010345 | 3300005530 | Bacteria | 8846 |
| 91 | Ga0070679_100011408 | 3300005530 | Bacteria | 8468 |
| 92 | Ga0070679_100033707 | 3300005530 | Bacteria | 5070 |
| 93 | Ga0070679_100061906 | 3300005530 | Bacteria | 3730 |
| 94 | Ga0070679_100312231 | 3300005530 | Unclassified | 1522 |
| 95 | Ga0070679_100545123 | 3300005530 | Bacteria | 1103 |
| 96 | Ga0070684_100191373 | 3300005535 | Bacteria | 1862 |
| 97 | Ga0070684_100368976 | 3300005535 | Unclassified | 1321 |
| 98 | Ga0070684_100371625 | 3300005535 | Bacteria | 1316 |
| 99 | Ga0068853_100106514 | 3300005539 | Bacteria | 2485 |
| 100 | Ga0068853_102236669 | 3300005539 | Unclassified | 530 |
| 101 | Ga0070672_100107245 | 3300005543 | Bacteria | 2273 |
| 102 | Ga0070672_100348271 | 3300005543 | Bacteria | 1262 |
| 103 | Ga0070672_100820522 | 3300005543 | Bacteria | 819 |
| 104 | Ga0070686_100137723 | 3300005544 | Bacteria | 1696 |
| 105 | Ga0070695_100466729 | 3300005545 | Bacteria | 970 |
| 106 | Ga0070696_100001495 | 3300005546 | Bacteria | 15335 |
| 107 | Ga0070696_100101259 | 3300005546 | Bacteria | 2064 |
| 108 | Ga0070696_100148596 | 3300005546 | Bacteria | 1718 |
| 109 | Ga0070696_100473597 | 3300005546 | Bacteria | 992 |
| 110 | Ga0070696_100820015 | 3300005546 | Bacteria | 767 |
| 111 | Ga0070693_100000716 | 3300005547 | Bacteria | 14629 |
| 112 | Ga0070693_100154676 | 3300005547 | Bacteria | 1455 |
| 113 | Ga0070693_100318246 | 3300005547 | Bacteria | 1055 |
| 114 | Ga0070665_100022326 | 3300005548 | Bacteria | 6368 |
| 115 | Ga0070704_100005456 | 3300005549 | Bacteria | 7409 |
| 116 | Ga0068855_100181738 | 3300005563 | Bacteria | 2377 |
| 117 | Ga0068855_100768670 | 3300005563 | Bacteria | 1026 |
| 118 | Ga0070664_100020777 | 3300005564 | Bacteria | 5409 |
| 119 | Ga0070664_100078786 | 3300005564 | Bacteria | 2834 |
| 120 | Ga0070664_100307199 | 3300005564 | Unclassified | 1434 |
| 121 | Ga0070664_100307498 | 3300005564 | Unclassified | 1434 |
| 122 | Ga0070664_100384982 | 3300005564 | Unclassified | 1281 |
| 123 | Ga0068857_100673466 | 3300005577 | Bacteria | 981 |
| 124 | Ga0068854_100061187 | 3300005578 | Bacteria | 2726 |
| 125 | Ga0068854_100393007 | 3300005578 | Bacteria | 1146 |
| 126 | Ga0068854_101131591 | 3300005578 | Bacteria | 699 |
| 127 | Ga0068854_101610370 | 3300005578 | Unclassified | 592 |
| 128 | Ga0068856_100600505 | 3300005614 | Unclassified | 1122 |
| 129 | Ga0068856_100784203 | 3300005614 | Bacteria | 973 |
| 130 | Ga0068856_101237792 | 3300005614 | Bacteria | 762 |
| 131 | Ga0068852_100073153 | 3300005616 | Bacteria | 3015 |
| 132 | Ga0068859_100288454 | 3300005617 | Bacteria | 1734 |
| 133 | Ga0068866_10007089 | 3300005718 | Unclassified | 4687 |
| 134 | Ga0068861_100005892 | 3300005719 | Bacteria | 8330 |
| 135 | Ga0068861_100678634 | 3300005719 | Bacteria | 955 |
| 136 | Ga0068861_101003083 | 3300005719 | Bacteria | 797 |
| 137 | Ga0068870_10012072 | 3300005840 | Bacteria | 4025 |
| 138 | Ga0068862_100003812 | 3300005844 | Bacteria | 12844 |
| 139 | Ga0081539_10000087 | 3300005985 | Bacteria | 214031 |
| 140 | Ga0070716_100004829 | 3300006173 | Bacteria | 6477 |
| 141 | Ga0097621_100747595 | 3300006237 | Unclassified | 903 |
| 142 | Ga0097621_100818413 | 3300006237 | Bacteria | 864 |
| 143 | Ga0075430_100006591 | 3300006846 | Bacteria | 9786 |
| 144 | Ga0075430_100022145 | 3300006846 | Bacteria | 5402 |
| 145 | Ga0075430_100080153 | 3300006846 | Unclassified | 2735 |
| 146 | Ga0075431_100017492 | 3300006847 | Bacteria | 7287 |
| 147 | Ga0075431_100102838 | 3300006847 | Bacteria | 2948 |
| 148 | Ga0075431_100143347 | 3300006847 | Bacteria | 2462 |
| 149 | Ga0075431_100357662 | 3300006847 | Bacteria | 1467 |
| 150 | Ga0075431_100458407 | 3300006847 | Unclassified | 1270 |
| 151 | Ga0075433_10001700 | 3300006852 | Bacteria | 16419 |
| 152 | Ga0075433_11029587 | 3300006852 | Bacteria | 717 |
| 153 | Ga0075434_100025029 | 3300006871 | Bacteria | 5838 |
| 154 | Ga0075434_100914598 | 3300006871 | Bacteria | 892 |
| 155 | Ga0075429_100049305 | 3300006880 | Bacteria | 3661 |
| 156 | Ga0068865_100087136 | 3300006881 | Bacteria | 2256 |
| 157 | Ga0068865_100346171 | 3300006881 | Bacteria | 1203 |
| 158 | Ga0075436_100023633 | 3300006914 | Unclassified | 4222 |
| 159 | Ga0097620_100288492 | 3300006931 | Bacteria | 1734 |
| 160 | Ga0075435_100123621 | 3300007076 | Bacteria | 2161 |
| 161 | Ga0075435_100215649 | 3300007076 | Unclassified | 1629 |
| 162 | Ga0105240_10294011 | 3300009093 | Bacteria | 1861 |
| 163 | Ga0105245_10109011 | 3300009098 | Bacteria | 2572 |
| 164 | Ga0105245_11184414 | 3300009098 | Bacteria | 812 |
| 165 | Ga0114129_10024727 | 3300009147 | Bacteria | 8514 |
| 166 | Ga0114129_12100924 | 3300009147 | Unclassified | 681 |
| 167 | Ga0105243_10221340 | 3300009148 | Unclassified | 1673 |
| 168 | Ga0105241_10092049 | 3300009174 | Bacteria | 2394 |
| 169 | Ga0105241_10164209 | 3300009174 | Unclassified | 1828 |
| 170 | Ga0105248_10029350 | 3300009177 | Bacteria | 6136 |
| 171 | Ga0105248_10253623 | 3300009177 | Bacteria | 1980 |
| 172 | Ga0105248_10421611 | 3300009177 | Unclassified | 1503 |
| 173 | Ga0105237_10071082 | 3300009545 | Bacteria | 3475 |
| 174 | Ga0105238_10083430 | 3300009551 | Bacteria | 3185 |
| 175 | Ga0105249_10000224 | 3300009553 | Bacteria | 64572 |
| 176 | Ga0105249_10543240 | 3300009553 | Bacteria | 1212 |
| 177 | Ga0157373_10195577 | 3300013100 | Bacteria | 1425 |
| 178 | Ga0157371_10065245 | 3300013102 | Bacteria | 2579 |
| 179 | Ga0157370_10061254 | 3300013104 | Bacteria | 3572 |
| 180 | Ga0157369_10156137 | 3300013105 | Bacteria | 2410 |
| 181 | Ga0157369_10285076 | 3300013105 | Bacteria | 1720 |
| 182 | Ga0157374_10037521 | 3300013296 | Bacteria | 4448 |
| 183 | Ga0157378_10029438 | 3300013297 | Bacteria | 4848 |
| 184 | Ga0157378_10053531 | 3300013297 | Unclassified | 3593 |
| 185 | Ga0157378_10240040 | 3300013297 | Bacteria | 1731 |
| 186 | Ga0157378_10410427 | 3300013297 | Bacteria | 1336 |
| 187 | Ga0157378_11840499 | 3300013297 | Bacteria | 654 |
| 188 | Ga0163162_11164852 | 3300013306 | Bacteria | 874 |
| 189 | Ga0163162_11677557 | 3300013306 | Bacteria | 726 |
| 190 | Ga0157372_11346359 | 3300013307 | Unclassified | 823 |
| 191 | Ga0157372_11654575 | 3300013307 | Bacteria | 737 |
| 192 | Ga0157372_12646437 | 3300013307 | Unclassified | 576 |
| 193 | Ga0157375_10056671 | 3300013308 | Unclassified | 3871 |
| 194 | Ga0157375_10249624 | 3300013308 | Bacteria | 1935 |
| 195 | Ga0157380_10043849 | 3300014326 | Bacteria | 3503 |
| 196 | Ga0157380_12246359 | 3300014326 | Unclassified | 610 |
| 197 | Ga0182008_10003068 | 3300014497 | Bacteria | 10259 |
| 198 | Ga0157377_10523751 | 3300014745 | Unclassified | 833 |
| 199 | Ga0157376_10796867 | 3300014969 | Bacteria | 957 |
| 200 | Ga0163161_10217282 | 3300017792 | Bacteria | 1479 |
| 201 | Ga0207682_10042841 | 3300025893 | Unclassified | 1850 |
| 202 | Ga0207645_10011485 | 3300025907 | Bacteria | 6045 |
| 203 | Ga0207645_10406492 | 3300025907 | Unclassified | 916 |
| 204 | Ga0207643_10009044 | 3300025908 | Bacteria | 5349 |
| 205 | Ga0207705_10031690 | 3300025909 | Bacteria | 3775 |
| 206 | Ga0207705_10150981 | 3300025909 | Bacteria | 1741 |
| 207 | Ga0207705_10223468 | 3300025909 | Bacteria | 1431 |
| 208 | Ga0207684_10106264 | 3300025910 | Bacteria | 2401 |
| 209 | Ga0207707_10004390 | 3300025912 | Bacteria | 12455 |
| 210 | Ga0207707_10026589 | 3300025912 | Bacteria | 5058 |
| 211 | Ga0207707_10057388 | 3300025912 | Bacteria | 3389 |
| 212 | Ga0207707_10064161 | 3300025912 | Bacteria | 3197 |
| 213 | Ga0207707_10103965 | 3300025912 | Unclassified | 2482 |
| 214 | Ga0207707_10208934 | 3300025912 | Bacteria | 1701 |
| 215 | Ga0207707_10258049 | 3300025912 | Bacteria | 1513 |
| 216 | Ga0207707_10594488 | 3300025912 | Bacteria | 937 |
| 217 | Ga0207707_10779064 | 3300025912 | Bacteria | 798 |
| 218 | Ga0207671_10069671 | 3300025914 | Bacteria | 2621 |
| 219 | Ga0207660_10012495 | 3300025917 | Bacteria | 5557 |
| 220 | Ga0207660_10029564 | 3300025917 | Bacteria | 3760 |
| 221 | Ga0207660_10203287 | 3300025917 | Unclassified | 1548 |
| 222 | Ga0207660_10232990 | 3300025917 | Bacteria | 1448 |
| 223 | Ga0207660_10517885 | 3300025917 | Bacteria | 968 |
| 224 | Ga0207660_10550482 | 3300025917 | Bacteria | 938 |
| 225 | Ga0207660_10687864 | 3300025917 | Unclassified | 834 |
| 226 | Ga0207662_10011243 | 3300025918 | Unclassified | 4956 |
| 227 | Ga0207657_10007873 | 3300025919 | Bacteria | 10875 |
| 228 | Ga0207657_10211977 | 3300025919 | Bacteria | 1554 |
| 229 | Ga0207657_10297041 | 3300025919 | Unclassified | 1280 |
| 230 | Ga0207649_10691374 | 3300025920 | Bacteria | 790 |
| 231 | Ga0207652_10003840 | 3300025921 | Bacteria | 12319 |
| 232 | Ga0207652_10005503 | 3300025921 | Bacteria | 10272 |
| 233 | Ga0207652_10010965 | 3300025921 | Bacteria | 7307 |
| 234 | Ga0207652_10129534 | 3300025921 | Unclassified | 2249 |
| 235 | Ga0207652_10144191 | 3300025921 | Bacteria | 2130 |
| 236 | Ga0207652_10248074 | 3300025921 | Bacteria | 1605 |
| 237 | Ga0207652_10970349 | 3300025921 | Unclassified | 748 |
| 238 | Ga0207646_10007348 | 3300025922 | Bacteria | 11219 |
| 239 | Ga0207646_10072200 | 3300025922 | Bacteria | 3083 |
| 240 | Ga0207681_10006965 | 3300025923 | Bacteria | 6937 |
| 241 | Ga0207681_10045151 | 3300025923 | Unclassified | 2957 |
| 242 | Ga0207681_10047918 | 3300025923 | Bacteria | 2882 |
| 243 | Ga0207694_10303214 | 3300025924 | Bacteria | 1315 |
| 244 | Ga0207650_10135536 | 3300025925 | Bacteria | 1931 |
| 245 | Ga0207650_10443055 | 3300025925 | Bacteria | 1080 |
| 246 | Ga0207650_10895453 | 3300025925 | Unclassified | 753 |
| 247 | Ga0207687_10970106 | 3300025927 | Bacteria | 728 |
| 248 | Ga0207644_10174915 | 3300025931 | Bacteria | 1679 |
| 249 | Ga0207644_10289985 | 3300025931 | Unclassified | 1316 |
| 250 | Ga0207644_10294379 | 3300025931 | Bacteria | 1306 |
| 251 | Ga0207690_11499802 | 3300025932 | Unclassified | 564 |
| 252 | Ga0207706_10028510 | 3300025933 | Unclassified | 4987 |
| 253 | Ga0207706_10051857 | 3300025933 | Bacteria | 3622 |
| 254 | Ga0207706_10115919 | 3300025933 | Bacteria | 2356 |
| 255 | Ga0207706_10282178 | 3300025933 | Bacteria | 1448 |
| 256 | Ga0207669_10263207 | 3300025937 | Bacteria | 1291 |
| 257 | Ga0207669_10961406 | 3300025937 | Bacteria | 716 |
| 258 | Ga0207665_10003155 | 3300025939 | Bacteria | 11051 |
| 259 | Ga0207691_10005767 | 3300025940 | Bacteria | 11986 |
| 260 | Ga0207691_10014209 | 3300025940 | Bacteria | 7595 |
| 261 | Ga0207691_10142599 | 3300025940 | Bacteria | 2110 |
| 262 | Ga0207711_10060616 | 3300025941 | Bacteria | 3261 |
| 263 | Ga0207711_10154976 | 3300025941 | Bacteria | 2070 |
| 264 | Ga0207661_10012961 | 3300025944 | Bacteria | 6082 |
| 265 | Ga0207679_10008649 | 3300025945 | Bacteria | 6489 |
| 266 | Ga0207679_10016157 | 3300025945 | Bacteria | 4950 |
| 267 | Ga0207667_10100833 | 3300025949 | Bacteria | 2978 |
| 268 | Ga0207667_10117222 | 3300025949 | Bacteria | 2744 |
| 269 | Ga0207667_10680977 | 3300025949 | Bacteria | 1032 |
| 270 | Ga0207651_10216522 | 3300025960 | Bacteria | 1545 |
| 271 | Ga0207651_10324964 | 3300025960 | Bacteria | 1287 |
| 272 | Ga0207668_10397470 | 3300025972 | Unclassified | 1164 |
| 273 | Ga0207640_10017898 | 3300025981 | Bacteria | 4153 |
| 274 | Ga0207658_10191515 | 3300025986 | Bacteria | 1700 |
| 275 | Ga0207677_10155156 | 3300026023 | Bacteria | 1772 |
| 276 | Ga0207677_10324373 | 3300026023 | Unclassified | 1281 |
| 277 | Ga0207677_10569492 | 3300026023 | Bacteria | 990 |
| 278 | Ga0207639_10107835 | 3300026041 | Unclassified | 2263 |
| 279 | Ga0207678_10001013 | 3300026067 | Bacteria | 25635 |
| 280 | Ga0207678_10497476 | 3300026067 | Bacteria | 1062 |
| 281 | Ga0207708_10025034 | 3300026075 | Unclassified | 4515 |
| 282 | Ga0207708_10063233 | 3300026075 | Unclassified | 2827 |
| 283 | Ga0207708_10226129 | 3300026075 | Bacteria | 1501 |
| 284 | Ga0207702_10524895 | 3300026078 | Bacteria | 1156 |
| 285 | Ga0207702_12421567 | 3300026078 | Bacteria | 512 |
| 286 | Ga0207648_10015820 | 3300026089 | Bacteria | 6916 |
| 287 | Ga0207648_10035536 | 3300026089 | Bacteria | 4389 |
| 288 | Ga0207648_10193515 | 3300026089 | Bacteria | 1803 |
| 289 | Ga0207674_10024667 | 3300026116 | Bacteria | 6421 |
| 290 | Ga0207675_100037472 | 3300026118 | Bacteria | 4523 |
| 291 | Ga0207675_100261230 | 3300026118 | Bacteria | 1678 |
| 292 | Ga0207683_10020772 | 3300026121 | Bacteria | 5618 |
| 293 | Ga0207683_10050924 | 3300026121 | Bacteria | 3628 |
| 294 | Ga0207683_10503961 | 3300026121 | Bacteria | 1118 |
| 295 | Ga0207698_10197656 | 3300026142 | Bacteria | 1798 |
| 296 | Ga0209995_1027947 | 3300027471 | Bacteria | 942 |
| 297 | Ga0209968_1053732 | 3300027526 | Bacteria | 703 |
| 298 | Ga0209998_10000439 | 3300027717 | Bacteria | 11589 |
| 299 | Ga0268265_10546903 | 3300028380 | Unclassified | 1098 |
| 300 | Ga0316182_1453216 | 3300030745 | Unclassified | 676 |
| 301 | Ga0307408_100016682 | 3300031548 | Bacteria | 4909 |
| 302 | Ga0307408_100017172 | 3300031548 | Bacteria | 4842 |
| 303 | Ga0307408_101119593 | 3300031548 | Unclassified | 731 |
| 304 | Ga0307405_10020682 | 3300031731 | Unclassified | 3682 |
| 305 | Ga0307405_10076275 | 3300031731 | Bacteria | 2174 |
| 306 | Ga0307405_10106039 | 3300031731 | Bacteria | 1894 |
| 307 | Ga0307405_10407906 | 3300031731 | Unclassified | 1066 |
| 308 | Ga0307405_10456253 | 3300031731 | Unclassified | 1015 |
| 309 | Ga0307413_10208145 | 3300031824 | Unclassified | 1418 |
| 310 | Ga0307410_10071664 | 3300031852 | Bacteria | 2404 |
| 311 | Ga0307410_10082370 | 3300031852 | Unclassified | 2263 |
| 312 | Ga0307410_11077647 | 3300031852 | Unclassified | 696 |
| 313 | Ga0307406_10012171 | 3300031901 | Bacteria | 4900 |
| 314 | Ga0307406_10127740 | 3300031901 | Bacteria | 1779 |
| 315 | Ga0307406_10842359 | 3300031901 | Unclassified | 777 |
| 316 | Ga0307406_11420300 | 3300031901 | Bacteria | 609 |
| 317 | Ga0307407_10047340 | 3300031903 | Unclassified | 2440 |
| 318 | Ga0307407_10340988 | 3300031903 | Bacteria | 1058 |
| 319 | Ga0307412_10001454 | 3300031911 | Bacteria | 13172 |
| 320 | Ga0307412_10097386 | 3300031911 | Bacteria | 2073 |
| 321 | Ga0307412_10511122 | 3300031911 | Bacteria | 1002 |
| 322 | Ga0307409_100098185 | 3300031995 | Unclassified | 2421 |
| 323 | Ga0307409_100150158 | 3300031995 | Unclassified | 2021 |
| 324 | Ga0307409_100845347 | 3300031995 | Unclassified | 926 |
| 325 | Ga0307409_101266934 | 3300031995 | Bacteria | 762 |
| 326 | Ga0307416_100023331 | 3300032002 | Bacteria | 4488 |
| 327 | Ga0307416_100430207 | 3300032002 | Bacteria | 1367 |
| 328 | Ga0307416_100492025 | 3300032002 | Unclassified | 1289 |
| 329 | Ga0307416_101611775 | 3300032002 | Bacteria | 754 |
| 330 | Ga0307414_10533034 | 3300032004 | Unclassified | 1044 |
| 331 | Ga0307414_11033356 | 3300032004 | Unclassified | 757 |
| 332 | Ga0307414_11641385 | 3300032004 | Bacteria | 599 |
| 333 | Ga0307411_10070923 | 3300032005 | Bacteria | 2359 |
| 334 | Ga0307411_10197426 | 3300032005 | Unclassified | 1542 |
| 335 | Ga0307411_10514309 | 3300032005 | Unclassified | 1015 |
| 336 | Ga0307411_11246358 | 3300032005 | Unclassified | 676 |
| 337 | Ga0307411_11804574 | 3300032005 | Bacteria | 568 |
| 338 | Ga0307415_100415779 | 3300032126 | Bacteria | 1152 |
| 339 | Ga0373948_0113402 | 3300034817 | Unclassified | 649 |
| 340 | Ga0373938_0027790 | 3300034957 | Bacteria | 1192 |
| 341 | Ga0373938_0053137 | 3300034957 | Bacteria | 930 |
| 342 | Ga0373929_0072474 | 3300035085 | Unclassified | 826 |
| 343 | Ga0373932_0038140 | 3300035112 | Unclassified | 1373 |
| 344 | Ga0373941_0006802 | 3300035115 | Bacteria | 2771 |
| 345 | Ga0373941_0037548 | 3300035115 | Bacteria | 1479 |
| 346 | Ga0373961_0172223 | 3300035241 | Unclassified | 749 |
| 347 | Ga0373931_1097297 | 3300035691 | Bacteria | 542 |
| 348 | Ga0373935_0051582 | 3300035692 | Bacteria | 2613 |
| 349 | Ga0373937_0081792 | 3300036401 | Bacteria | 2988 |
| 350 | Ga0395905_0184750 | 3300037471 | Bacteria | 1957 |
| 351 | Ga0451789_0453464 | 3300041443 | Unclassified | 717 |
| 352 | Ga0451807_2654675 | 3300041486 | Bacteria | 863 |
| 353 | Ga0451853_1790155 | 3300041512 | Unclassified | 610 |
| 354 | Ga0439431_0137152 | 3300041997 | Bacteria | 689 |
| 355 | Ga0439462_0008661 | 3300042015 | Bacteria | 2569 |
| 356 | Ga0451577_0235323 | 3300042876 | Bacteria | 1656 |
| 357 | Ga0466966_0003349 | 3300044684 | Bacteria | 10566 |
| 358 | Ga0453684_0039035 | 3300044712 | Bacteria | 6476 |
| 359 | Ga0466959_0016914 | 3300045049 | Bacteria | 5338 |
| 360 | Ga0495592_0379690 | 3300046454 | Bacteria | 899 |
| 361 | Ga0495629_0334247 | 3300046459 | Bacteria | 1035 |
| 362 | Ga0495651_0050922 | 3300046462 | Bacteria | 3194 |
| 363 | Ga0495653_0039030 | 3300046463 | Bacteria | 3723 |
| 364 | Ga0495662_0024415 | 3300046476 | Bacteria | 2917 |
| 365 | Ga0495664_0054570 | 3300046477 | Bacteria | 2376 |
| 366 | Ga0495608_0012134 | 3300046511 | Bacteria | 5990 |
| 367 | Ga0495618_0084845 | 3300046514 | Bacteria | 2024 |
| 368 | Ga0495628_0054636 | 3300046516 | Bacteria | 3147 |
| 369 | Ga0495630_0380310 | 3300046517 | Bacteria | 1081 |
| 370 | Ga0495586_0042220 | 3300046535 | Bacteria | 2456 |
| 371 | Ga0495645_0061830 | 3300046543 | Bacteria | 2713 |
| 372 | Ga0495667_0055940 | 3300046559 | Bacteria | 2594 |
| 373 | Ga0495634_0111517 | 3300046642 | Bacteria | 1758 |
| 374 | Ga0495635_0016810 | 3300046663 | Bacteria | 5110 |
| 375 | Ga0495588_0005752 | 3300046674 | Bacteria | 5538 |
| 376 | Ga0495657_0051287 | 3300046675 | Bacteria | 2770 |
| 377 | Ga0495599_0003880 | 3300046678 | Bacteria | 8795 |
| 378 | Ga0495646_0111359 | 3300046680 | Bacteria | 1558 |
| 379 | Ga0495613_0157297 | 3300046689 | Bacteria | 1618 |
| 380 | Ga0495600_0025018 | 3300046809 | Bacteria | 3846 |
| 381 | Ga0495604_0074359 | 3300047317 | Bacteria | 2561 |
| 382 | Ga0495674_0037313 | 3300047319 | Bacteria | 4366 |
| 383 | Ga0495680_0033910 | 3300047322 | Bacteria | 4129 |
| 384 | Ga0495675_0221018 | 3300047444 | Bacteria | 1146 |
| 385 | Ga0495684_0015430 | 3300047471 | Bacteria | 5879 |
| 386 | Ga0495602_0071561 | 3300048088 | Bacteria | 2961 |
| 387 | Ga0496101_0103371 | 3300048904 | Bacteria | 2135 |
| 388 | Ga0496102_0259047 | 3300048905 | Bacteria | 1640 |
| 389 | Ga0496112_0006291 | 3300048915 | Bacteria | 10415 |
| 390 | Ga0496112_0065790 | 3300048915 | Bacteria | 3577 |
| 391 | Ga0496112_0829345 | 3300048915 | Bacteria | 849 |
| 392 | Ga0496114_0053689 | 3300048917 | Bacteria | 3359 |
| 393 | Ga0496115_0016184 | 3300048918 | Bacteria | 5674 |
| 394 | Ga0501292_002287 | 3300049515 | Bacteria | 2456 |
| 395 | Ga0501038_1270147 | 3300049574 | Unclassified | 532 |
| 396 | Ga0501040_0150826 | 3300049576 | Unclassified | 1640 |
| 397 | Ga0501072_0292437 | 3300049588 | Bacteria | 1295 |
| 398 | Ga0501198_010109 | 3300049649 | Unclassified | 1391 |
| 399 | Ga0501202_002632 | 3300049652 | Bacteria | 3028 |
| 400 | Ga0501216_001187 | 3300049660 | Bacteria | 3443 |
| 401 | Ga0501217_008845 | 3300049661 | Unclassified | 2182 |
| 402 | Ga0501224_004861 | 3300049664 | Bacteria | 1917 |
| 403 | Ga0501227_019690 | 3300049665 | Unclassified | 1541 |
| 404 | Ga0501233_001385 | 3300049668 | Unclassified | 4145 |
| 405 | Ga0501236_041315 | 3300049670 | Unclassified | 765 |
| 406 | Ga0501240_010216 | 3300049673 | Unclassified | 1243 |
| 407 | Ga0501242_005807 | 3300049674 | Unclassified | 1397 |
| 408 | Ga0501249_009311 | 3300049679 | Unclassified | 2043 |
| 409 | Ga0501250_002574 | 3300049680 | Bacteria | 1656 |
| 410 | Ga0501251_114378 | 3300049681 | Unclassified | 505 |
| 411 | Ga0501252_008866 | 3300049682 | Unclassified | 1164 |
| 412 | Ga0501253_202506 | 3300049683 | Unclassified | 525 |
| 413 | Ga0501257_014120 | 3300049686 | Unclassified | 1834 |
| 414 | Ga0501259_012103 | 3300049688 | Unclassified | 1436 |
| 415 | Ga0501259_081531 | 3300049688 | Unclassified | 712 |
| 416 | Ga0501260_002878 | 3300049689 | Unclassified | 1515 |
| 417 | Ga0501225_0006893 | 3300049705 | Bacteria | 3312 |
| 418 | Ga0501234_000983 | 3300049707 | Bacteria | 4514 |
| 419 | Ga0501245_045978 | 3300049708 | Unclassified | 762 |
| 420 | Ga0501079_0575335 | 3300049741 | Unclassified | 886 |
| 421 | Ga0501268_001833 | 3300049765 | Bacteria | 2711 |
| 422 | Ga0501274_007886 | 3300049771 | Unclassified | 945 |
| 423 | Ga0501276_002834 | 3300049773 | Unclassified | 1238 |
| 424 | Ga0501283_011735 | 3300049779 | Unclassified | 1308 |
| 425 | Ga0501212_010470 | 3300049851 | Unclassified | 1322 |
| 426 | nmdc:mga05p37_1238314_c1 | 3300050507 | Bacteria | 767 |
| 427 | nmdc:mga05p37_2196450_c1 | 3300050507 | Bacteria | 513 |
| 428 | nmdc:mga05p37_363794_c1 | 3300050507 | Bacteria | 1700 |
| 429 | nmdc:mga09592_107763_c1 | 3300050508 | Bacteria | 2390 |
| 430 | nmdc:mga0qj67_3770_c1 | 3300050509 | Bacteria | 10941 |
| 431 | nmdc:mga0qj67_93381_c1 | 3300050509 | Bacteria | 2419 |
| 432 | nmdc:mga0qj67_98074_c1 | 3300050509 | Bacteria | 2361 |
| 433 | nmdc:mga06r32_151911_c1 | 3300050510 | Bacteria | 2294 |
| 434 | nmdc:mga06r32_251903_c1 | 3300050510 | Bacteria | 1753 |
| 435 | nmdc:mga06r32_886577_c1 | 3300050510 | Bacteria | 849 |
| 436 | nmdc:mga0n895_884952_c1 | 3300050512 | Bacteria | 879 |
| 437 | nmdc:mga0rr50_1156206_c1 | 3300050513 | Unclassified | 658 |
| 438 | nmdc:mga08x19_220266_c1 | 3300050514 | Bacteria | 1304 |
| 439 | nmdc:mga0a205_11578_c1 | 3300050515 | Bacteria | 8126 |
| 440 | nmdc:mga0a205_61581_c1 | 3300050515 | Bacteria | 3624 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032002 | Ga0307416_100430207 | Ga0307416_1004302072 | 118 |
| 2 | 3300031911 | Ga0307412_10097386 | Ga0307412_100973863 | 119 |
| 3 | 3300032002 | Ga0307416_101611775 | Ga0307416_1016117752 | 119 |
| 4 | 3300032005 | Ga0307411_11804574 | Ga0307411_118045741 | 119 |
| 5 | 3300032126 | Ga0307415_100415779 | Ga0307415_1004157791 | 119 |
| 6 | 3300050507 | nmdc:mga05p37_2196450_c1 | nmdc:mga05p37_2196450_c1_104_499 | 119 |
| 7 | 3300005445 | Ga0070708_100795324 | Ga0070708_1007953241 | 122 |
| 8 | 3300049574 | Ga0501038_1270147 | Ga0501038_1270147_13_474 | 125 |
| 9 | 3300049741 | Ga0501079_0575335 | Ga0501079_0575335_65_526 | 125 |
| 10 | 3300005985 | Ga0081539_10000087 | Ga0081539_1000008745 | 126 |
| 11 | 3300005545 | Ga0070695_100466729 | Ga0070695_1004667292 | 127 |
| 12 | 3300025912 | Ga0207707_10258049 | Ga0207707_102580492 | 127 |
| 13 | 3300025945 | Ga0207679_10008649 | Ga0207679_100086496 | 127 |
| 14 | 3300025912 | Ga0207707_10208934 | Ga0207707_102089343 | 128 |
| 15 | 3300005356 | Ga0070674_100187102 | Ga0070674_1001871023 | 130 |
| 16 | 3300005564 | Ga0070664_100384982 | Ga0070664_1003849822 | 130 |
| 17 | 3300005578 | Ga0068854_101131591 | Ga0068854_1011315911 | 130 |
| 18 | 3300025893 | Ga0207682_10042841 | Ga0207682_100428411 | 130 |
| 19 | 3300025907 | Ga0207645_10406492 | Ga0207645_104064921 | 130 |
| 20 | 3300032004 | Ga0307414_11641385 | Ga0307414_116413852 | 130 |
| 21 | 3300025927 | Ga0207687_10970106 | Ga0207687_109701062 | 131 |
| 22 | 3300025972 | Ga0207668_10397470 | Ga0207668_103974702 | 131 |
| 23 | 3300005353 | Ga0070669_100623916 | Ga0070669_1006239162 | 133 |
| 24 | 3300005355 | Ga0070671_100140409 | Ga0070671_1001404093 | 133 |
| 25 | 3300005364 | Ga0070673_100088923 | Ga0070673_1000889231 | 133 |
| 26 | 3300005367 | Ga0070667_100272632 | Ga0070667_1002726322 | 133 |
| 27 | 3300005458 | Ga0070681_10103126 | Ga0070681_101031262 | 133 |
| 28 | 3300005544 | Ga0070686_100137723 | Ga0070686_1001377232 | 133 |
| 29 | 3300013307 | Ga0157372_11346359 | Ga0157372_113463592 | 133 |
| 30 | 3300025908 | Ga0207643_10009044 | Ga0207643_100090446 | 133 |
| 31 | 3300025912 | Ga0207707_10594488 | Ga0207707_105944882 | 133 |
| 32 | 3300025923 | Ga0207681_10006965 | Ga0207681_100069655 | 133 |
| 33 | 3300025925 | Ga0207650_10895453 | Ga0207650_108954532 | 133 |
| 34 | 3300028380 | Ga0268265_10546903 | Ga0268265_105469031 | 133 |
| 35 | 3300005330 | Ga0070690_100029945 | Ga0070690_1000299453 | 134 |
| 36 | 3300005354 | Ga0070675_100084217 | Ga0070675_1000842171 | 134 |
| 37 | 3300005456 | Ga0070678_100410239 | Ga0070678_1004102391 | 134 |
| 38 | 3300005844 | Ga0068862_100003812 | Ga0068862_10000381217 | 134 |
| 39 | 3300006914 | Ga0075436_100023633 | Ga0075436_1000236336 | 134 |
| 40 | 3300014326 | Ga0157380_12246359 | Ga0157380_122463592 | 134 |
| 41 | 3300025940 | Ga0207691_10142599 | Ga0207691_101425991 | 134 |
| 42 | 3300005336 | Ga0070680_100066980 | Ga0070680_1000669802 | 135 |
| 43 | 3300005345 | Ga0070692_10678694 | Ga0070692_106786941 | 135 |
| 44 | 3300005347 | Ga0070668_100005834 | Ga0070668_1000058343 | 135 |
| 45 | 3300005456 | Ga0070678_101095705 | Ga0070678_1010957052 | 135 |
| 46 | 3300005457 | Ga0070662_101238847 | Ga0070662_1012388471 | 135 |
| 47 | 3300005458 | Ga0070681_10301221 | Ga0070681_103012212 | 135 |
| 48 | 3300005530 | Ga0070679_100010345 | Ga0070679_1000103457 | 135 |
| 49 | 3300005539 | Ga0068853_102236669 | Ga0068853_1022366691 | 135 |
| 50 | 3300005543 | Ga0070672_100107245 | Ga0070672_1001072453 | 135 |
| 51 | 3300005578 | Ga0068854_100393007 | Ga0068854_1003930072 | 135 |
| 52 | 3300006237 | Ga0097621_100818413 | Ga0097621_1008184131 | 135 |
| 53 | 3300006846 | Ga0075430_100080153 | Ga0075430_1000801532 | 135 |
| 54 | 3300006847 | Ga0075431_100357662 | Ga0075431_1003576623 | 135 |
| 55 | 3300006847 | Ga0075431_100458407 | Ga0075431_1004584072 | 135 |
| 56 | 3300009098 | Ga0105245_11184414 | Ga0105245_111844142 | 135 |
| 57 | 3300009177 | Ga0105248_10029350 | Ga0105248_100293504 | 135 |
| 58 | 3300013296 | Ga0157374_10037521 | Ga0157374_100375211 | 135 |
| 59 | 3300013297 | Ga0157378_10240040 | Ga0157378_102400402 | 135 |
| 60 | 3300013297 | Ga0157378_10410427 | Ga0157378_104104271 | 135 |
| 61 | 3300013297 | Ga0157378_11840499 | Ga0157378_118404991 | 135 |
| 62 | 3300013307 | Ga0157372_11654575 | Ga0157372_116545751 | 135 |
| 63 | 3300013308 | Ga0157375_10249624 | Ga0157375_102496243 | 135 |
| 64 | 3300017792 | Ga0163161_10217282 | Ga0163161_102172821 | 135 |
| 65 | 3300025917 | Ga0207660_10687864 | Ga0207660_106878641 | 135 |
| 66 | 3300025921 | Ga0207652_10129534 | Ga0207652_101295343 | 135 |
| 67 | 3300025931 | Ga0207644_10294379 | Ga0207644_102943792 | 135 |
| 68 | 3300025933 | Ga0207706_10115919 | Ga0207706_101159192 | 135 |
| 69 | 3300025940 | Ga0207691_10014209 | Ga0207691_100142092 | 135 |
| 70 | 3300025941 | Ga0207711_10060616 | Ga0207711_100606163 | 135 |
| 71 | 3300025986 | Ga0207658_10191515 | Ga0207658_101915152 | 135 |
| 72 | 3300026023 | Ga0207677_10155156 | Ga0207677_101551563 | 135 |
| 73 | 3300026121 | Ga0207683_10503961 | Ga0207683_105039612 | 135 |
| 74 | 3300048915 | Ga0496112_0829345 | Ga0496112_0829345_125_562 | 135 |
| 75 | 3300050509 | nmdc:mga0qj67_93381_c1 | nmdc:mga0qj67_93381_c1_1591_2025 | 135 |
| 76 | 3300050510 | nmdc:mga06r32_251903_c1 | nmdc:mga06r32_251903_c1_1016_1450 | 135 |
| 77 | 3300005327 | Ga0070658_10391916 | Ga0070658_103919162 | 136 |
| 78 | 3300005328 | Ga0070676_10789300 | Ga0070676_107893002 | 136 |
| 79 | 3300005329 | Ga0070683_100041829 | Ga0070683_1000418294 | 136 |
| 80 | 3300005329 | Ga0070683_100172572 | Ga0070683_1001725723 | 136 |
| 81 | 3300005330 | Ga0070690_100266149 | Ga0070690_1002661492 | 136 |
| 82 | 3300005336 | Ga0070680_100004892 | Ga0070680_10000489210 | 136 |
| 83 | 3300005336 | Ga0070680_100015411 | Ga0070680_1000154113 | 136 |
| 84 | 3300005336 | Ga0070680_100094998 | Ga0070680_1000949982 | 136 |
| 85 | 3300005336 | Ga0070680_100166474 | Ga0070680_1001664743 | 136 |
| 86 | 3300005336 | Ga0070680_100285456 | Ga0070680_1002854562 | 136 |
| 87 | 3300005336 | Ga0070680_101407908 | Ga0070680_1014079081 | 136 |
| 88 | 3300005337 | Ga0070682_100017291 | Ga0070682_1000172913 | 136 |
| 89 | 3300005337 | Ga0070682_100031567 | Ga0070682_1000315675 | 136 |
| 90 | 3300005339 | Ga0070660_100113720 | Ga0070660_1001137203 | 136 |
| 91 | 3300005339 | Ga0070660_100230675 | Ga0070660_1002306752 | 136 |
| 92 | 3300005339 | Ga0070660_101481681 | Ga0070660_1014816811 | 136 |
| 93 | 3300005341 | Ga0070691_10097617 | Ga0070691_100976171 | 136 |
| 94 | 3300005343 | Ga0070687_100011484 | Ga0070687_1000114845 | 136 |
| 95 | 3300005344 | Ga0070661_100011269 | Ga0070661_1000112697 | 136 |
| 96 | 3300005345 | Ga0070692_10055637 | Ga0070692_100556373 | 136 |
| 97 | 3300005345 | Ga0070692_10098136 | Ga0070692_100981361 | 136 |
| 98 | 3300005345 | Ga0070692_11231511 | Ga0070692_112315111 | 136 |
| 99 | 3300005353 | Ga0070669_100057586 | Ga0070669_1000575862 | 136 |
| 100 | 3300005353 | Ga0070669_100213283 | Ga0070669_1002132832 | 136 |
| 101 | 3300005354 | Ga0070675_100453012 | Ga0070675_1004530122 | 136 |
| 102 | 3300005354 | Ga0070675_100826472 | Ga0070675_1008264721 | 136 |
| 103 | 3300005355 | Ga0070671_100209644 | Ga0070671_1002096442 | 136 |
| 104 | 3300005355 | Ga0070671_100424931 | Ga0070671_1004249312 | 136 |
| 105 | 3300005356 | Ga0070674_100039135 | Ga0070674_1000391352 | 136 |
| 106 | 3300005356 | Ga0070674_100067621 | Ga0070674_1000676211 | 136 |
| 107 | 3300005364 | Ga0070673_100005173 | Ga0070673_1000051733 | 136 |
| 108 | 3300005364 | Ga0070673_101031482 | Ga0070673_1010314822 | 136 |
| 109 | 3300005434 | Ga0070709_10004734 | Ga0070709_100047348 | 136 |
| 110 | 3300005441 | Ga0070700_100060809 | Ga0070700_1000608092 | 136 |
| 111 | 3300005441 | Ga0070700_100151994 | Ga0070700_1001519941 | 136 |
| 112 | 3300005444 | Ga0070694_100053647 | Ga0070694_1000536474 | 136 |
| 113 | 3300005445 | Ga0070708_100000089 | Ga0070708_10000008911 | 136 |
| 114 | 3300005455 | Ga0070663_100004710 | Ga0070663_1000047103 | 136 |
| 115 | 3300005455 | Ga0070663_100388274 | Ga0070663_1003882742 | 136 |
| 116 | 3300005455 | Ga0070663_100389379 | Ga0070663_1003893791 | 136 |
| 117 | 3300005456 | Ga0070678_100031309 | Ga0070678_1000313094 | 136 |
| 118 | 3300005457 | Ga0070662_100061960 | Ga0070662_1000619601 | 136 |
| 119 | 3300005458 | Ga0070681_10005428 | Ga0070681_100054289 | 136 |
| 120 | 3300005458 | Ga0070681_10005852 | Ga0070681_100058522 | 136 |
| 121 | 3300005458 | Ga0070681_10034253 | Ga0070681_100342534 | 136 |
| 122 | 3300005458 | Ga0070681_10250758 | Ga0070681_102507583 | 136 |
| 123 | 3300005459 | Ga0068867_100006955 | Ga0068867_1000069556 | 136 |
| 124 | 3300005459 | Ga0068867_100019919 | Ga0068867_1000199195 | 136 |
| 125 | 3300005459 | Ga0068867_100281493 | Ga0068867_1002814931 | 136 |
| 126 | 3300005466 | Ga0070685_10324717 | Ga0070685_103247172 | 136 |
| 127 | 3300005467 | Ga0070706_100145916 | Ga0070706_1001459163 | 136 |
| 128 | 3300005468 | Ga0070707_100000317 | Ga0070707_10000031741 | 136 |
| 129 | 3300005471 | Ga0070698_100082823 | Ga0070698_1000828233 | 136 |
| 130 | 3300005471 | Ga0070698_100105365 | Ga0070698_1001053653 | 136 |
| 131 | 3300005530 | Ga0070679_100002058 | Ga0070679_1000020583 | 136 |
| 132 | 3300005530 | Ga0070679_100011408 | Ga0070679_1000114088 | 136 |
| 133 | 3300005530 | Ga0070679_100033707 | Ga0070679_1000337075 | 136 |
| 134 | 3300005530 | Ga0070679_100312231 | Ga0070679_1003122313 | 136 |
| 135 | 3300005530 | Ga0070679_100545123 | Ga0070679_1005451232 | 136 |
| 136 | 3300005535 | Ga0070684_100191373 | Ga0070684_1001913733 | 136 |
| 137 | 3300005535 | Ga0070684_100368976 | Ga0070684_1003689762 | 136 |
| 138 | 3300005535 | Ga0070684_100371625 | Ga0070684_1003716252 | 136 |
| 139 | 3300005539 | Ga0068853_100106514 | Ga0068853_1001065143 | 136 |
| 140 | 3300005543 | Ga0070672_100348271 | Ga0070672_1003482712 | 136 |
| 141 | 3300005546 | Ga0070696_100101259 | Ga0070696_1001012592 | 136 |
| 142 | 3300005546 | Ga0070696_100148596 | Ga0070696_1001485963 | 136 |
| 143 | 3300005546 | Ga0070696_100473597 | Ga0070696_1004735972 | 136 |
| 144 | 3300005546 | Ga0070696_100820015 | Ga0070696_1008200151 | 136 |
| 145 | 3300005547 | Ga0070693_100000716 | Ga0070693_10000071613 | 136 |
| 146 | 3300005547 | Ga0070693_100154676 | Ga0070693_1001546761 | 136 |
| 147 | 3300005547 | Ga0070693_100318246 | Ga0070693_1003182462 | 136 |
| 148 | 3300005549 | Ga0070704_100005456 | Ga0070704_1000054568 | 136 |
| 149 | 3300005563 | Ga0068855_100181738 | Ga0068855_1001817383 | 136 |
| 150 | 3300005563 | Ga0068855_100768670 | Ga0068855_1007686701 | 136 |
| 151 | 3300005564 | Ga0070664_100020777 | Ga0070664_1000207773 | 136 |
| 152 | 3300005564 | Ga0070664_100078786 | Ga0070664_1000787862 | 136 |
| 153 | 3300005564 | Ga0070664_100307498 | Ga0070664_1003074981 | 136 |
| 154 | 3300005577 | Ga0068857_100673466 | Ga0068857_1006734661 | 136 |
| 155 | 3300005578 | Ga0068854_100061187 | Ga0068854_1000611873 | 136 |
| 156 | 3300005578 | Ga0068854_101610370 | Ga0068854_1016103702 | 136 |
| 157 | 3300005614 | Ga0068856_100600505 | Ga0068856_1006005053 | 136 |
| 158 | 3300005614 | Ga0068856_100784203 | Ga0068856_1007842031 | 136 |
| 159 | 3300005616 | Ga0068852_100073153 | Ga0068852_1000731533 | 136 |
| 160 | 3300005718 | Ga0068866_10007089 | Ga0068866_100070894 | 136 |
| 161 | 3300005719 | Ga0068861_100678634 | Ga0068861_1006786341 | 136 |
| 162 | 3300005719 | Ga0068861_101003083 | Ga0068861_1010030832 | 136 |
| 163 | 3300006173 | Ga0070716_100004829 | Ga0070716_1000048298 | 136 |
| 164 | 3300006237 | Ga0097621_100747595 | Ga0097621_1007475952 | 136 |
| 165 | 3300006846 | Ga0075430_100006591 | Ga0075430_10000659110 | 136 |
| 166 | 3300006846 | Ga0075430_100022145 | Ga0075430_1000221457 | 136 |
| 167 | 3300006847 | Ga0075431_100102838 | Ga0075431_1001028382 | 136 |
| 168 | 3300006852 | Ga0075433_10001700 | Ga0075433_1000170014 | 136 |
| 169 | 3300006852 | Ga0075433_11029587 | Ga0075433_110295872 | 136 |
| 170 | 3300006871 | Ga0075434_100025029 | Ga0075434_1000250297 | 136 |
| 171 | 3300006871 | Ga0075434_100914598 | Ga0075434_1009145981 | 136 |
| 172 | 3300006880 | Ga0075429_100049305 | Ga0075429_1000493053 | 136 |
| 173 | 3300006881 | Ga0068865_100087136 | Ga0068865_1000871362 | 136 |
| 174 | 3300006881 | Ga0068865_100346171 | Ga0068865_1003461712 | 136 |
| 175 | 3300007076 | Ga0075435_100123621 | Ga0075435_1001236212 | 136 |
| 176 | 3300007076 | Ga0075435_100215649 | Ga0075435_1002156492 | 136 |
| 177 | 3300009098 | Ga0105245_10109011 | Ga0105245_101090112 | 136 |
| 178 | 3300009147 | Ga0114129_10024727 | Ga0114129_100247276 | 136 |
| 179 | 3300009174 | Ga0105241_10092049 | Ga0105241_100920493 | 136 |
| 180 | 3300009174 | Ga0105241_10164209 | Ga0105241_101642091 | 136 |
| 181 | 3300009177 | Ga0105248_10253623 | Ga0105248_102536233 | 136 |
| 182 | 3300009177 | Ga0105248_10421611 | Ga0105248_104216112 | 136 |
| 183 | 3300009551 | Ga0105238_10083430 | Ga0105238_100834302 | 136 |
| 184 | 3300009553 | Ga0105249_10543240 | Ga0105249_105432402 | 136 |
| 185 | 3300013100 | Ga0157373_10195577 | Ga0157373_101955771 | 136 |
| 186 | 3300013102 | Ga0157371_10065245 | Ga0157371_100652453 | 136 |
| 187 | 3300013104 | Ga0157370_10061254 | Ga0157370_100612543 | 136 |
| 188 | 3300013105 | Ga0157369_10156137 | Ga0157369_101561373 | 136 |
| 189 | 3300013105 | Ga0157369_10285076 | Ga0157369_102850762 | 136 |
| 190 | 3300013297 | Ga0157378_10029438 | Ga0157378_100294383 | 136 |
| 191 | 3300013297 | Ga0157378_10053531 | Ga0157378_100535315 | 136 |
| 192 | 3300013306 | Ga0163162_11164852 | Ga0163162_111648522 | 136 |
| 193 | 3300013306 | Ga0163162_11677557 | Ga0163162_116775571 | 136 |
| 194 | 3300013307 | Ga0157372_12646437 | Ga0157372_126464372 | 136 |
| 195 | 3300014745 | Ga0157377_10523751 | Ga0157377_105237512 | 136 |
| 196 | 3300014969 | Ga0157376_10796867 | Ga0157376_107968672 | 136 |
| 197 | 3300025907 | Ga0207645_10011485 | Ga0207645_100114854 | 136 |
| 198 | 3300025909 | Ga0207705_10031690 | Ga0207705_100316903 | 136 |
| 199 | 3300025909 | Ga0207705_10223468 | Ga0207705_102234682 | 136 |
| 200 | 3300025912 | Ga0207707_10026589 | Ga0207707_100265896 | 136 |
| 201 | 3300025912 | Ga0207707_10057388 | Ga0207707_100573881 | 136 |
| 202 | 3300025912 | Ga0207707_10064161 | Ga0207707_100641611 | 136 |
| 203 | 3300025912 | Ga0207707_10103965 | Ga0207707_101039653 | 136 |
| 204 | 3300025917 | Ga0207660_10012495 | Ga0207660_100124954 | 136 |
| 205 | 3300025917 | Ga0207660_10029564 | Ga0207660_100295641 | 136 |
| 206 | 3300025917 | Ga0207660_10203287 | Ga0207660_102032872 | 136 |
| 207 | 3300025917 | Ga0207660_10550482 | Ga0207660_105504822 | 136 |
| 208 | 3300025918 | Ga0207662_10011243 | Ga0207662_100112437 | 136 |
| 209 | 3300025919 | Ga0207657_10007873 | Ga0207657_100078733 | 136 |
| 210 | 3300025919 | Ga0207657_10211977 | Ga0207657_102119772 | 136 |
| 211 | 3300025919 | Ga0207657_10297041 | Ga0207657_102970412 | 136 |
| 212 | 3300025920 | Ga0207649_10691374 | Ga0207649_106913741 | 136 |
| 213 | 3300025921 | Ga0207652_10005503 | Ga0207652_100055039 | 136 |
| 214 | 3300025921 | Ga0207652_10010965 | Ga0207652_100109654 | 136 |
| 215 | 3300025921 | Ga0207652_10144191 | Ga0207652_101441913 | 136 |
| 216 | 3300025921 | Ga0207652_10970349 | Ga0207652_109703492 | 136 |
| 217 | 3300025922 | Ga0207646_10007348 | Ga0207646_100073487 | 136 |
| 218 | 3300025923 | Ga0207681_10045151 | Ga0207681_100451514 | 136 |
| 219 | 3300025923 | Ga0207681_10047918 | Ga0207681_100479184 | 136 |
| 220 | 3300025924 | Ga0207694_10303214 | Ga0207694_103032142 | 136 |
| 221 | 3300025925 | Ga0207650_10135536 | Ga0207650_101355361 | 136 |
| 222 | 3300025925 | Ga0207650_10443055 | Ga0207650_104430551 | 136 |
| 223 | 3300025931 | Ga0207644_10174915 | Ga0207644_101749152 | 136 |
| 224 | 3300025931 | Ga0207644_10289985 | Ga0207644_102899852 | 136 |
| 225 | 3300025932 | Ga0207690_11499802 | Ga0207690_114998021 | 136 |
| 226 | 3300025933 | Ga0207706_10028510 | Ga0207706_100285105 | 136 |
| 227 | 3300025933 | Ga0207706_10051857 | Ga0207706_100518574 | 136 |
| 228 | 3300025937 | Ga0207669_10263207 | Ga0207669_102632072 | 136 |
| 229 | 3300025937 | Ga0207669_10961406 | Ga0207669_109614061 | 136 |
| 230 | 3300025939 | Ga0207665_10003155 | Ga0207665_1000315512 | 136 |
| 231 | 3300025940 | Ga0207691_10005767 | Ga0207691_1000576711 | 136 |
| 232 | 3300025941 | Ga0207711_10154976 | Ga0207711_101549762 | 136 |
| 233 | 3300025944 | Ga0207661_10012961 | Ga0207661_100129613 | 136 |
| 234 | 3300025945 | Ga0207679_10016157 | Ga0207679_100161574 | 136 |
| 235 | 3300025949 | Ga0207667_10100833 | Ga0207667_101008333 | 136 |
| 236 | 3300025949 | Ga0207667_10117222 | Ga0207667_101172223 | 136 |
| 237 | 3300025949 | Ga0207667_10680977 | Ga0207667_106809772 | 136 |
| 238 | 3300025960 | Ga0207651_10216522 | Ga0207651_102165223 | 136 |
| 239 | 3300025960 | Ga0207651_10324964 | Ga0207651_103249642 | 136 |
| 240 | 3300025981 | Ga0207640_10017898 | Ga0207640_100178985 | 136 |
| 241 | 3300026023 | Ga0207677_10324373 | Ga0207677_103243732 | 136 |
| 242 | 3300026023 | Ga0207677_10569492 | Ga0207677_105694922 | 136 |
| 243 | 3300026041 | Ga0207639_10107835 | Ga0207639_101078353 | 136 |
| 244 | 3300026067 | Ga0207678_10001013 | Ga0207678_100010132 | 136 |
| 245 | 3300026067 | Ga0207678_10497476 | Ga0207678_104974762 | 136 |
| 246 | 3300026075 | Ga0207708_10025034 | Ga0207708_100250343 | 136 |
| 247 | 3300026075 | Ga0207708_10063233 | Ga0207708_100632331 | 136 |
| 248 | 3300026075 | Ga0207708_10226129 | Ga0207708_102261292 | 136 |
| 249 | 3300026078 | Ga0207702_10524895 | Ga0207702_105248952 | 136 |
| 250 | 3300026089 | Ga0207648_10015820 | Ga0207648_100158205 | 136 |
| 251 | 3300026089 | Ga0207648_10035536 | Ga0207648_100355362 | 136 |
| 252 | 3300026089 | Ga0207648_10193515 | Ga0207648_101935151 | 136 |
| 253 | 3300026116 | Ga0207674_10024667 | Ga0207674_100246676 | 136 |
| 254 | 3300026118 | Ga0207675_100261230 | Ga0207675_1002612303 | 136 |
| 255 | 3300026121 | Ga0207683_10020772 | Ga0207683_100207727 | 136 |
| 256 | 3300026121 | Ga0207683_10050924 | Ga0207683_100509243 | 136 |
| 257 | 3300026142 | Ga0207698_10197656 | Ga0207698_101976561 | 136 |
| 258 | 3300031901 | Ga0307406_10842359 | Ga0307406_108423592 | 136 |
| 259 | 3300031995 | Ga0307409_101266934 | Ga0307409_1012669341 | 136 |
| 260 | 3300034817 | Ga0373948_0113402 | Ga0373948_0113402_77_544 | 136 |
| 261 | 3300034957 | Ga0373938_0027790 | Ga0373938_0027790_590_1057 | 136 |
| 262 | 3300034957 | Ga0373938_0053137 | Ga0373938_0053137_102_530 | 136 |
| 263 | 3300035085 | Ga0373929_0072474 | Ga0373929_0072474_253_720 | 136 |
| 264 | 3300035112 | Ga0373932_0038140 | Ga0373932_0038140_234_701 | 136 |
| 265 | 3300035115 | Ga0373941_0006802 | Ga0373941_0006802_1533_2000 | 136 |
| 266 | 3300035115 | Ga0373941_0037548 | Ga0373941_0037548_543_971 | 136 |
| 267 | 3300035241 | Ga0373961_0172223 | Ga0373961_0172223_85_552 | 136 |
| 268 | 3300035691 | Ga0373931_1097297 | Ga0373931_1097297_79_507 | 136 |
| 269 | 3300035692 | Ga0373935_0051582 | Ga0373935_0051582_182_625 | 136 |
| 270 | 3300037471 | Ga0395905_0184750 | Ga0395905_0184750_315_728 | 136 |
| 271 | 3300041443 | Ga0451789_0453464 | Ga0451789_0453464_11_430 | 136 |
| 272 | 3300041486 | Ga0451807_2654675 | Ga0451807_2654675_340_771 | 136 |
| 273 | 3300041512 | Ga0451853_1790155 | Ga0451853_1790155_74_505 | 136 |
| 274 | 3300041997 | Ga0439431_0137152 | Ga0439431_0137152_239_661 | 136 |
| 275 | 3300042015 | Ga0439462_0008661 | Ga0439462_0008661_1942_2364 | 136 |
| 276 | 3300042876 | Ga0451577_0235323 | Ga0451577_0235323_587_1000 | 136 |
| 277 | 3300044712 | Ga0453684_0039035 | Ga0453684_0039035_3744_4157 | 136 |
| 278 | 3300046674 | Ga0495588_0005752 | Ga0495588_0005752_4569_4985 | 136 |
| 279 | 3300048915 | Ga0496112_0006291 | Ga0496112_0006291_9773_10240 | 136 |
| 280 | 3300048915 | Ga0496112_0065790 | Ga0496112_0065790_1656_2093 | 136 |
| 281 | 3300050508 | nmdc:mga09592_107763_c1 | nmdc:mga09592_107763_c1_1205_1618 | 136 |
| 282 | 3300050509 | nmdc:mga0qj67_3770_c1 | nmdc:mga0qj67_3770_c1_672_1133 | 136 |
| 283 | 3300050509 | nmdc:mga0qj67_98074_c1 | nmdc:mga0qj67_98074_c1_1485_1898 | 136 |
| 284 | 3300050512 | nmdc:mga0n895_884952_c1 | nmdc:mga0n895_884952_c1_338_757 | 136 |
| 285 | 3300050513 | nmdc:mga0rr50_1156206_c1 | nmdc:mga0rr50_1156206_c1_175_642 | 136 |
| 286 | 3300050514 | nmdc:mga08x19_220266_c1 | nmdc:mga08x19_220266_c1_215_643 | 136 |
| 287 | 3300050515 | nmdc:mga0a205_11578_c1 | nmdc:mga0a205_11578_c1_4937_5404 | 136 |
| 288 | 3300050515 | nmdc:mga0a205_61581_c1 | nmdc:mga0a205_61581_c1_2079_2513 | 136 |
| 289 | 3300005293 | Ga0065715_10014827 | Ga0065715_100148273 | 137 |
| 290 | 3300005327 | Ga0070658_10121793 | Ga0070658_101217933 | 137 |
| 291 | 3300005336 | Ga0070680_100076663 | Ga0070680_1000766632 | 137 |
| 292 | 3300005336 | Ga0070680_100488600 | Ga0070680_1004886002 | 137 |
| 293 | 3300005336 | Ga0070680_101219620 | Ga0070680_1012196201 | 137 |
| 294 | 3300005353 | Ga0070669_100000545 | Ga0070669_10000054523 | 137 |
| 295 | 3300005366 | Ga0070659_101132670 | Ga0070659_1011326701 | 137 |
| 296 | 3300005441 | Ga0070700_100483432 | Ga0070700_1004834322 | 137 |
| 297 | 3300005444 | Ga0070694_100072992 | Ga0070694_1000729923 | 137 |
| 298 | 3300005457 | Ga0070662_100067676 | Ga0070662_1000676763 | 137 |
| 299 | 3300005458 | Ga0070681_10119705 | Ga0070681_101197053 | 137 |
| 300 | 3300005458 | Ga0070681_10127990 | Ga0070681_101279903 | 137 |
| 301 | 3300005467 | Ga0070706_100070190 | Ga0070706_1000701905 | 137 |
| 302 | 3300005468 | Ga0070707_100149248 | Ga0070707_1001492482 | 137 |
| 303 | 3300005468 | Ga0070707_100477540 | Ga0070707_1004775402 | 137 |
| 304 | 3300005471 | Ga0070698_100669170 | Ga0070698_1006691701 | 137 |
| 305 | 3300005518 | Ga0070699_100219094 | Ga0070699_1002190943 | 137 |
| 306 | 3300005518 | Ga0070699_100381950 | Ga0070699_1003819502 | 137 |
| 307 | 3300005530 | Ga0070679_100061906 | Ga0070679_1000619064 | 137 |
| 308 | 3300005543 | Ga0070672_100820522 | Ga0070672_1008205221 | 137 |
| 309 | 3300005546 | Ga0070696_100001495 | Ga0070696_1000014951 | 137 |
| 310 | 3300005548 | Ga0070665_100022326 | Ga0070665_1000223266 | 137 |
| 311 | 3300005564 | Ga0070664_100307199 | Ga0070664_1003071992 | 137 |
| 312 | 3300005614 | Ga0068856_101237792 | Ga0068856_1012377922 | 137 |
| 313 | 3300005617 | Ga0068859_100288454 | Ga0068859_1002884543 | 137 |
| 314 | 3300005719 | Ga0068861_100005892 | Ga0068861_10000589211 | 137 |
| 315 | 3300005840 | Ga0068870_10012072 | Ga0068870_100120721 | 137 |
| 316 | 3300006847 | Ga0075431_100017492 | Ga0075431_1000174923 | 137 |
| 317 | 3300006847 | Ga0075431_100143347 | Ga0075431_1001433473 | 137 |
| 318 | 3300006931 | Ga0097620_100288492 | Ga0097620_1002884922 | 137 |
| 319 | 3300009093 | Ga0105240_10294011 | Ga0105240_102940113 | 137 |
| 320 | 3300009147 | Ga0114129_12100924 | Ga0114129_121009242 | 137 |
| 321 | 3300009148 | Ga0105243_10221340 | Ga0105243_102213403 | 137 |
| 322 | 3300009545 | Ga0105237_10071082 | Ga0105237_100710823 | 137 |
| 323 | 3300009553 | Ga0105249_10000224 | Ga0105249_1000022429 | 137 |
| 324 | 3300013308 | Ga0157375_10056671 | Ga0157375_100566711 | 137 |
| 325 | 3300014326 | Ga0157380_10043849 | Ga0157380_100438493 | 137 |
| 326 | 3300014497 | Ga0182008_10003068 | Ga0182008_100030684 | 137 |
| 327 | 3300025909 | Ga0207705_10150981 | Ga0207705_101509813 | 137 |
| 328 | 3300025910 | Ga0207684_10106264 | Ga0207684_101062642 | 137 |
| 329 | 3300025912 | Ga0207707_10004390 | Ga0207707_1000439011 | 137 |
| 330 | 3300025912 | Ga0207707_10779064 | Ga0207707_107790642 | 137 |
| 331 | 3300025914 | Ga0207671_10069671 | Ga0207671_100696713 | 137 |
| 332 | 3300025917 | Ga0207660_10232990 | Ga0207660_102329901 | 137 |
| 333 | 3300025917 | Ga0207660_10517885 | Ga0207660_105178852 | 137 |
| 334 | 3300025921 | Ga0207652_10003840 | Ga0207652_1000384010 | 137 |
| 335 | 3300025921 | Ga0207652_10248074 | Ga0207652_102480742 | 137 |
| 336 | 3300025922 | Ga0207646_10072200 | Ga0207646_100722003 | 137 |
| 337 | 3300025933 | Ga0207706_10282178 | Ga0207706_102821782 | 137 |
| 338 | 3300026078 | Ga0207702_12421567 | Ga0207702_124215671 | 137 |
| 339 | 3300026118 | Ga0207675_100037472 | Ga0207675_1000374726 | 137 |
| 340 | 3300027471 | Ga0209995_1027947 | Ga0209995_10279472 | 137 |
| 341 | 3300027526 | Ga0209968_1053732 | Ga0209968_10537322 | 137 |
| 342 | 3300027717 | Ga0209998_10000439 | Ga0209998_100004399 | 137 |
| 343 | 3300030745 | Ga0316182_1453216 | Ga0316182_14532162 | 137 |
| 344 | 3300031548 | Ga0307408_100016682 | Ga0307408_1000166827 | 137 |
| 345 | 3300031548 | Ga0307408_100017172 | Ga0307408_1000171722 | 137 |
| 346 | 3300031548 | Ga0307408_101119593 | Ga0307408_1011195931 | 137 |
| 347 | 3300031731 | Ga0307405_10020682 | Ga0307405_100206822 | 137 |
| 348 | 3300031731 | Ga0307405_10076275 | Ga0307405_100762753 | 137 |
| 349 | 3300031731 | Ga0307405_10106039 | Ga0307405_101060392 | 137 |
| 350 | 3300031731 | Ga0307405_10407906 | Ga0307405_104079062 | 137 |
| 351 | 3300031731 | Ga0307405_10456253 | Ga0307405_104562532 | 137 |
| 352 | 3300031824 | Ga0307413_10208145 | Ga0307413_102081452 | 137 |
| 353 | 3300031852 | Ga0307410_10071664 | Ga0307410_100716642 | 137 |
| 354 | 3300031852 | Ga0307410_10082370 | Ga0307410_100823703 | 137 |
| 355 | 3300031852 | Ga0307410_11077647 | Ga0307410_110776471 | 137 |
| 356 | 3300031901 | Ga0307406_10012171 | Ga0307406_100121712 | 137 |
| 357 | 3300031901 | Ga0307406_10127740 | Ga0307406_101277402 | 137 |
| 358 | 3300031901 | Ga0307406_11420300 | Ga0307406_114203002 | 137 |
| 359 | 3300031903 | Ga0307407_10047340 | Ga0307407_100473402 | 137 |
| 360 | 3300031903 | Ga0307407_10340988 | Ga0307407_103409882 | 137 |
| 361 | 3300031911 | Ga0307412_10001454 | Ga0307412_100014547 | 137 |
| 362 | 3300031911 | Ga0307412_10511122 | Ga0307412_105111221 | 137 |
| 363 | 3300031995 | Ga0307409_100098185 | Ga0307409_1000981853 | 137 |
| 364 | 3300031995 | Ga0307409_100150158 | Ga0307409_1001501583 | 137 |
| 365 | 3300031995 | Ga0307409_100845347 | Ga0307409_1008453472 | 137 |
| 366 | 3300032002 | Ga0307416_100023331 | Ga0307416_1000233313 | 137 |
| 367 | 3300032002 | Ga0307416_100492025 | Ga0307416_1004920252 | 137 |
| 368 | 3300032004 | Ga0307414_10533034 | Ga0307414_105330342 | 137 |
| 369 | 3300032004 | Ga0307414_11033356 | Ga0307414_110333561 | 137 |
| 370 | 3300032005 | Ga0307411_10070923 | Ga0307411_100709233 | 137 |
| 371 | 3300032005 | Ga0307411_10197426 | Ga0307411_101974262 | 137 |
| 372 | 3300032005 | Ga0307411_10514309 | Ga0307411_105143092 | 137 |
| 373 | 3300032005 | Ga0307411_11246358 | Ga0307411_112463581 | 137 |
| 374 | 3300036401 | Ga0373937_0081792 | Ga0373937_0081792_13_447 | 137 |
| 375 | 3300044684 | Ga0466966_0003349 | Ga0466966_0003349_116_556 | 137 |
| 376 | 3300045049 | Ga0466959_0016914 | Ga0466959_0016914_3651_4082 | 137 |
| 377 | 3300046454 | Ga0495592_0379690 | Ga0495592_0379690_291_728 | 137 |
| 378 | 3300046459 | Ga0495629_0334247 | Ga0495629_0334247_11_445 | 137 |
| 379 | 3300046462 | Ga0495651_0050922 | Ga0495651_0050922_2716_3150 | 137 |
| 380 | 3300046463 | Ga0495653_0039030 | Ga0495653_0039030_502_936 | 137 |
| 381 | 3300046476 | Ga0495662_0024415 | Ga0495662_0024415_2428_2862 | 137 |
| 382 | 3300046477 | Ga0495664_0054570 | Ga0495664_0054570_74_508 | 137 |
| 383 | 3300046511 | Ga0495608_0012134 | Ga0495608_0012134_4511_4945 | 137 |
| 384 | 3300046514 | Ga0495618_0084845 | Ga0495618_0084845_291_725 | 137 |
| 385 | 3300046516 | Ga0495628_0054636 | Ga0495628_0054636_13_447 | 137 |
| 386 | 3300046517 | Ga0495630_0380310 | Ga0495630_0380310_585_1019 | 137 |
| 387 | 3300046535 | Ga0495586_0042220 | Ga0495586_0042220_45_479 | 137 |
| 388 | 3300046543 | Ga0495645_0061830 | Ga0495645_0061830_669_1106 | 137 |
| 389 | 3300046559 | Ga0495667_0055940 | Ga0495667_0055940_1152_1586 | 137 |
| 390 | 3300046642 | Ga0495634_0111517 | Ga0495634_0111517_1245_1679 | 137 |
| 391 | 3300046663 | Ga0495635_0016810 | Ga0495635_0016810_80_514 | 137 |
| 392 | 3300046675 | Ga0495657_0051287 | Ga0495657_0051287_2297_2731 | 137 |
| 393 | 3300046678 | Ga0495599_0003880 | Ga0495599_0003880_7657_8094 | 137 |
| 394 | 3300046680 | Ga0495646_0111359 | Ga0495646_0111359_1102_1536 | 137 |
| 395 | 3300046689 | Ga0495613_0157297 | Ga0495613_0157297_1008_1442 | 137 |
| 396 | 3300046809 | Ga0495600_0025018 | Ga0495600_0025018_3133_3567 | 137 |
| 397 | 3300047317 | Ga0495604_0074359 | Ga0495604_0074359_2094_2528 | 137 |
| 398 | 3300047319 | Ga0495674_0037313 | Ga0495674_0037313_1025_1459 | 137 |
| 399 | 3300047322 | Ga0495680_0033910 | Ga0495680_0033910_22_456 | 137 |
| 400 | 3300047444 | Ga0495675_0221018 | Ga0495675_0221018_700_1134 | 137 |
| 401 | 3300047471 | Ga0495684_0015430 | Ga0495684_0015430_5390_5824 | 137 |
| 402 | 3300048088 | Ga0495602_0071561 | Ga0495602_0071561_2478_2912 | 137 |
| 403 | 3300048904 | Ga0496101_0103371 | Ga0496101_0103371_273_689 | 137 |
| 404 | 3300048905 | Ga0496102_0259047 | Ga0496102_0259047_321_737 | 137 |
| 405 | 3300048917 | Ga0496114_0053689 | Ga0496114_0053689_1039_1455 | 137 |
| 406 | 3300048918 | Ga0496115_0016184 | Ga0496115_0016184_2442_2858 | 137 |
| 407 | 3300049515 | Ga0501292_002287 | Ga0501292_002287_124_549 | 137 |
| 408 | 3300049576 | Ga0501040_0150826 | Ga0501040_0150826_1169_1630 | 137 |
| 409 | 3300049588 | Ga0501072_0292437 | Ga0501072_0292437_531_1067 | 137 |
| 410 | 3300049649 | Ga0501198_010109 | Ga0501198_010109_864_1289 | 137 |
| 411 | 3300049652 | Ga0501202_002632 | Ga0501202_002632_255_680 | 137 |
| 412 | 3300049660 | Ga0501216_001187 | Ga0501216_001187_2758_3183 | 137 |
| 413 | 3300049661 | Ga0501217_008845 | Ga0501217_008845_1381_1806 | 137 |
| 414 | 3300049664 | Ga0501224_004861 | Ga0501224_004861_728_1153 | 137 |
| 415 | 3300049665 | Ga0501227_019690 | Ga0501227_019690_62_487 | 137 |
| 416 | 3300049668 | Ga0501233_001385 | Ga0501233_001385_1588_2013 | 137 |
| 417 | 3300049670 | Ga0501236_041315 | Ga0501236_041315_81_506 | 137 |
| 418 | 3300049673 | Ga0501240_010216 | Ga0501240_010216_113_538 | 137 |
| 419 | 3300049674 | Ga0501242_005807 | Ga0501242_005807_903_1328 | 137 |
| 420 | 3300049679 | Ga0501249_009311 | Ga0501249_009311_1058_1483 | 137 |
| 421 | 3300049680 | Ga0501250_002574 | Ga0501250_002574_783_1208 | 137 |
| 422 | 3300049681 | Ga0501251_114378 | Ga0501251_114378_33_458 | 137 |
| 423 | 3300049682 | Ga0501252_008866 | Ga0501252_008866_420_845 | 137 |
| 424 | 3300049683 | Ga0501253_202506 | Ga0501253_202506_59_484 | 137 |
| 425 | 3300049686 | Ga0501257_014120 | Ga0501257_014120_1210_1635 | 137 |
| 426 | 3300049688 | Ga0501259_012103 | Ga0501259_012103_279_704 | 137 |
| 427 | 3300049688 | Ga0501259_081531 | Ga0501259_081531_32_466 | 137 |
| 428 | 3300049689 | Ga0501260_002878 | Ga0501260_002878_534_959 | 137 |
| 429 | 3300049705 | Ga0501225_0006893 | Ga0501225_0006893_1507_1932 | 137 |
| 430 | 3300049707 | Ga0501234_000983 | Ga0501234_000983_3978_4403 | 137 |
| 431 | 3300049708 | Ga0501245_045978 | Ga0501245_045978_225_650 | 137 |
| 432 | 3300049765 | Ga0501268_001833 | Ga0501268_001833_1406_1831 | 137 |
| 433 | 3300049771 | Ga0501274_007886 | Ga0501274_007886_405_830 | 137 |
| 434 | 3300049773 | Ga0501276_002834 | Ga0501276_002834_369_794 | 137 |
| 435 | 3300049779 | Ga0501283_011735 | Ga0501283_011735_51_476 | 137 |
| 436 | 3300049851 | Ga0501212_010470 | Ga0501212_010470_884_1309 | 137 |
| 437 | 3300050507 | nmdc:mga05p37_1238314_c1 | nmdc:mga05p37_1238314_c1_37_498 | 137 |
| 438 | 3300050507 | nmdc:mga05p37_363794_c1 | nmdc:mga05p37_363794_c1_794_1231 | 137 |
| 439 | 3300050510 | nmdc:mga06r32_151911_c1 | nmdc:mga06r32_151911_c1_1066_1542 | 137 |
| 440 | 3300050510 | nmdc:mga06r32_886577_c1 | nmdc:mga06r32_886577_c1_359_796 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nv5-assembly2.cif.gz_B | c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) | 0.8916 | 2 | 128 |
| 4nv5-assembly1.cif.gz_A | c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) | 0.8896 | 4 | 129 |
| 4nv2-assembly1.cif.gz_A | c50a mutant of synechococcus vkor, c2221 crystal form | 0.8826 | 1 | 128 |
| 6wvh-assembly1.cif.gz_A | human vkor with brodifacoum | 0.8158 | 5 | 132 |
| 4nv2-assembly1.cif.gz_A | c50a mutant of synechococcus vkor, c2221 crystal form | 0.8096 | 1 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nv5A01 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain | 0.8896 | 4 | 129 | 1.20.1440.130 |
| af_Q54V87_14_188_1.20.1440.130 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain | 0.8715 | 2 | 131 | 1.20.1440.130 |
| af_Q10S76_73_247_1.20.1440.130 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain | 0.866 | 3 | 136 | 1.20.1440.130 |
| af_A1ZAJ5_3_151_1.20.1440.130 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain | 0.8557 | 3 | 133 | 1.20.1440.130 |
| af_I6X5W1_15_164_1.20.1440.130 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain | 0.8443 | 2 | 131 | 1.20.1440.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5PBN3-F1-model_v4 | Vitamin K epoxide reductase family protein | 0.9946 | 3 | 136 |
GO:0016020
GO:0016491 GO:0048038 |
| AF-A0A2V7GHQ1-F1-model_v4 | Vitamin K epoxide reductase | 0.9901 | 2 | 134 |
GO:0016020
GO:0016491 GO:0048038 |
| AF-A0A7Y5QL11-F1-model_v4 | Vitamin K epoxide reductase family protein | 0.9891 | 1 | 132 |
GO:0016020
GO:0016491 GO:0048038 |
| AF-A0A2V7QJY1-F1-model_v4 | Vitamin K epoxide reductase | 0.9868 | 1 | 135 |
GO:0016020
GO:0016491 GO:0048038 |
| AF-A0A7W1UIM1-F1-model_v4 | Vitamin K epoxide reductase family protein | 0.9846 | 1 | 136 |
GO:0016020
GO:0016491 GO:0048038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar