F444534

General Info

Members Datasets Scaffolds Average Seq Length
440 281 880 238

Family's Representative Sequence

Representative Sequence 3300053154|Ga0500619_000040|Ga0500619_000040_18770_19561
Length 263
Sequence MSLLELHGVTKRFGGLTANQDVSFNVEAGQIVGLIGPNGAGKTTAFNCVAGFYAPTSGRIELDGKTISGLSPEACARAGVGRTFQVARTFTSMTACENVMAAAMLHQRRVPAARTTALKWLGFVNLAHFADKPAGSMTISEQRRLAVARALATAPKLLLMDEVMAGLNPSEVREMVKVVQAIRDTGIACLIVEHVLEGIMPIADKIVVLDRGIKIADGPPAEVSRNPAVIAAYLGPPDDEELSSPPEGVQKPWGGPAVFTGDE

Samples

Sample ID Description Type Environment
1 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
137 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
140 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
141 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
241 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
244 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
245 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
246 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
247 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
248 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
249 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
250 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
251 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
252 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
253 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
254 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
255 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
256 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
257 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
258 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
259 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
260 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
261 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
262 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
263 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
264 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
265 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
266 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
267 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
268 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
269 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
270 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
271 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
272 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
273 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
274 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
275 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
276 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
277 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
278 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
279 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
280 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
281 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.68
Metatranscriptomes 0.23
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.14
Nodule 5.23
Rhizoplane 4.32
Rhizosphere 54.09
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500619_000040 3300053154 Bacteria 40525
2 JGI25155J39150_1001038 3300002704 Bacteria 2962
3 JGI25155J39150_1001040 3300002704 Bacteria 2949
4 JGI25156J39149_1000158 3300002705 Bacteria 49923
5 JGI25156J39149_1000164 3300002705 Bacteria 48491
6 JGI25162J39368_1006794 3300002737 Bacteria 1894
7 JGI25154J39366_1000074 3300002738 Bacteria 92481
8 JGI25154J39366_1000114 3300002738 Bacteria 68169
9 JGI25154J39366_1000175 3300002738 Bacteria 49923
10 JGI25157J39369_1000335 3300002741 Bacteria 33363
11 JGI25152J39213_1002477 3300002773 Bacteria 6992
12 JGI25153J46596_10002270 3300003215 Bacteria 11209
13 JGI25153J46596_10003693 3300003215 Bacteria 8459
14 rootH1_10019386 3300003316 Bacteria 1442
15 rootL2_10064870 3300003322 Unclassified 12348
16 rootH1_10082242 3300003323 Bacteria 2570
17 Ga0055532_1000080 3300003758 Bacteria 120879
18 Ga0055535_1000056 3300003761 Bacteria 128204
19 Ga0055535_1003152 3300003761 Bacteria 4926
20 Ga0055529_1000165 3300003763 Bacteria 91442
21 Ga0055526_1002150 3300003771 Bacteria 13519
22 Ga0055524_1000027 3300003775 Bacteria 213655
23 Ga0055530_10017021 3300003791 Bacteria 2291
24 Ga0065165_1000832 3300005262 Bacteria 40569
25 Ga0070658_10251947 3300005327 Bacteria 1498
26 Ga0070658_10296983 3300005327 Bacteria 1377
27 Ga0070670_100083039 3300005331 Bacteria 2753
28 Ga0068869_100044130 3300005334 Bacteria 3206
29 Ga0068868_100008596 3300005338 Bacteria 7314
30 Ga0070661_100000893 3300005344 Bacteria 21405
31 Ga0070661_100101521 3300005344 Bacteria 2140
32 Ga0070675_100009253 3300005354 Bacteria 7654
33 Ga0070659_100004831 3300005366 Bacteria 9631
34 Ga0070659_100310788 3300005366 Bacteria 1316
35 Ga0070667_100018165 3300005367 Bacteria 5831
36 Ga0070667_100264293 3300005367 Bacteria 1541
37 Ga0070708_100414037 3300005445 Bacteria 1271
38 Ga0070663_100258089 3300005455 Bacteria 1382
39 Ga0070662_100000931 3300005457 Bacteria 17917
40 Ga0070662_100725795 3300005457 Bacteria 842
41 Ga0068867_100000018 3300005459 Bacteria 102056
42 Ga0068867_100004640 3300005459 Bacteria 9669
43 Ga0070706_100132758 3300005467 Bacteria 2324
44 Ga0070672_100009637 3300005543 Bacteria 6666
45 Ga0068855_100040000 3300005563 Bacteria 5565
46 Ga0068855_101157616 3300005563 Bacteria 806
47 Ga0070664_100002509 3300005564 Bacteria 14796
48 Ga0070664_100065471 3300005564 Bacteria 3101
49 Ga0070664_100113132 3300005564 Bacteria 2371
50 Ga0068857_100080602 3300005577 Bacteria 2906
51 Ga0068857_100127728 3300005577 Bacteria 2291
52 Ga0068854_100066767 3300005578 Bacteria 2618
53 Ga0068856_100018591 3300005614 Bacteria 6735
54 Ga0068852_100006807 3300005616 Bacteria 8298
55 Ga0068852_100025699 3300005616 Bacteria 4775
56 Ga0068863_100698632 3300005841 Bacteria 1008
57 Ga0075365_10031551 3300006038 Bacteria 3400
58 Ga0075365_10353476 3300006038 Bacteria 1036
59 Ga0075363_100080666 3300006048 Bacteria 1779
60 Ga0075363_100163118 3300006048 Bacteria 1262
61 Ga0075364_10158072 3300006051 Bacteria 1529
62 Ga0075362_10020128 3300006177 Bacteria 2785
63 Ga0075362_10023088 3300006177 Bacteria 2627
64 Ga0075367_10047429 3300006178 Bacteria 2527
65 Ga0075367_10097664 3300006178 Bacteria 1792
66 Ga0075366_10024864 3300006195 Bacteria 3493
67 Ga0075366_10076207 3300006195 Bacteria 2001
68 Ga0097621_100156233 3300006237 Bacteria 1958
69 Ga0097621_100169873 3300006237 Bacteria 1879
70 Ga0075370_10001985 3300006353 Bacteria 9273
71 Ga0075370_10062522 3300006353 Bacteria 2122
72 Ga0075370_10063322 3300006353 Bacteria 2108
73 Ga0075434_100080372 3300006871 Bacteria 3257
74 Ga0079104_1004958 3300006946 Bacteria 5482
75 Ga0099794_10000585 3300007265 Bacteria 12212
76 Ga0105240_10000809 3300009093 Bacteria 56801
77 Ga0105240_10010334 3300009093 Bacteria 13132
78 Ga0105240_10167965 3300009093 Bacteria 2601
79 Ga0105245_10137905 3300009098 Bacteria 2294
80 Ga0114129_10356465 3300009147 Bacteria 1936
81 Ga0105243_10031481 3300009148 Bacteria 4090
82 Ga0105243_10130285 3300009148 Bacteria 2133
83 Ga0105243_10285397 3300009148 Bacteria 1489
84 Ga0105242_10266071 3300009176 Bacteria 1551
85 Ga0105237_10233927 3300009545 Bacteria 1838
86 Ga0105237_10300002 3300009545 Bacteria 1610
87 Ga0105239_10075487 3300010375 Bacteria 3706
88 Ga0105239_10491575 3300010375 Bacteria 1395
89 Ga0163163_10127428 3300014325 Bacteria 2584
90 Ga0163163_10613255 3300014325 Bacteria 1151
91 Ga0157380_11003351 3300014326 Bacteria 868
92 Ga0182008_10020675 3300014497 Bacteria 3385
93 Ga0157377_10000051 3300014745 Bacteria 90204
94 Ga0157379_10112628 3300014968 Bacteria 2445
95 Ga0157376_10075142 3300014969 Bacteria 2883
96 Ga0157376_10573588 3300014969 Bacteria 1119
97 Ga0182006_1020942 3300015261 Bacteria 2733
98 Ga0213874_10074047 3300021377 Bacteria 1092
99 Ga0213875_10180639 3300021388 Bacteria 991
100 Ga0209435_100018 3300025206 Bacteria 274625
101 Ga0209435_100138 3300025206 Bacteria 24452
102 Ga0209147_100051 3300025229 Bacteria 274605
103 Ga0209437_100145 3300025233 Bacteria 163138
104 Ga0209258_100071 3300025242 Bacteria 278319
105 Ga0209258_100244 3300025242 Bacteria 100255
106 Ga0209646_1000081 3300025246 Bacteria 201708
107 Ga0209646_1000090 3300025246 Bacteria 189912
108 Ga0209026_1000042 3300025250 Bacteria 273111
109 Ga0209026_1007538 3300025250 Bacteria 2432
110 Ga0209759_1000098 3300025256 Bacteria 157516
111 Ga0209759_1000109 3300025256 Bacteria 145042
112 Ga0209759_1000936 3300025256 Bacteria 21031
113 Ga0209129_1000075 3300025258 Bacteria 201273
114 Ga0209565_1010168 3300025263 Bacteria 2345
115 Ga0209455_1000030 3300025272 Bacteria 533479
116 Ga0209455_1028487 3300025272 Bacteria 976
117 Ga0209025_1032271 3300025294 Bacteria 2453
118 Ga0209564_1000046 3300025295 Bacteria 373787
119 Ga0209758_1000045 3300025297 Bacteria 369174
120 Ga0209758_1000052 3300025297 Bacteria 338962
121 Ga0209050_1000257 3300025298 Bacteria 114186
122 Ga0209256_1000013 3300025299 Bacteria 689442
123 Ga0209051_1003673 3300025303 Bacteria 9927
124 Ga0209051_1014608 3300025303 Bacteria 3653
125 Ga0209257_1038287 3300025304 Bacteria 1455
126 Ga0207697_10055271 3300025315 Bacteria 1646
127 Ga0207645_10001304 3300025907 Bacteria 20534
128 Ga0207645_10160947 3300025907 Bacteria 1469
129 Ga0207705_10256874 3300025909 Bacteria 1333
130 Ga0207705_10281201 3300025909 Bacteria 1274
131 Ga0207684_10124424 3300025910 Bacteria 2212
132 Ga0207684_10447590 3300025910 Bacteria 1109
133 Ga0207695_10001196 3300025913 Bacteria 44626
134 Ga0207695_10008186 3300025913 Bacteria 13134
135 Ga0207671_10217853 3300025914 Bacteria 1495
136 Ga0207649_10077692 3300025920 Bacteria 2140
137 Ga0207650_10057935 3300025925 Bacteria 2883
138 Ga0207659_10071735 3300025926 Bacteria 2530
139 Ga0207644_10103523 3300025931 Bacteria 2142
140 Ga0207690_10062549 3300025932 Bacteria 2534
141 Ga0207706_10001218 3300025933 Bacteria 26011
142 Ga0207706_10105094 3300025933 Bacteria 2485
143 Ga0207686_10491269 3300025934 Bacteria 951
144 Ga0207709_10016442 3300025935 Bacteria 4113
145 Ga0207691_10006518 3300025940 Bacteria 11267
146 Ga0207711_10236578 3300025941 Bacteria 1674
147 Ga0207689_10031804 3300025942 Bacteria 4389
148 Ga0207689_10117317 3300025942 Bacteria 2189
149 Ga0207679_10000056 3300025945 Bacteria 108254
150 Ga0207679_10445463 3300025945 Bacteria 1147
151 Ga0207667_10007680 3300025949 Bacteria 12908
152 Ga0207667_10209921 3300025949 Bacteria 1996
153 Ga0207651_10048131 3300025960 Bacteria 2880
154 Ga0207668_10925790 3300025972 Bacteria 777
155 Ga0207640_10014346 3300025981 Bacteria 4559
156 Ga0207702_10034341 3300026078 Bacteria 4239
157 Ga0207641_10722678 3300026088 Bacteria 982
158 Ga0207648_10000060 3300026089 Bacteria 102225
159 Ga0207648_10002312 3300026089 Bacteria 20575
160 Ga0207648_10192197 3300026089 Bacteria 1809
161 Ga0207674_10071423 3300026116 Bacteria 3487
162 Ga0207674_10127555 3300026116 Bacteria 2509
163 Ga0207674_10486756 3300026116 Bacteria 1192
164 Ga0207675_100173706 3300026118 Bacteria 2061
165 Ga0207683_10155100 3300026121 Bacteria 2068
166 Ga0207698_10020491 3300026142 Bacteria 4553
167 Ga0207698_10120826 3300026142 Bacteria 2217
168 Ga0209588_1000022 3300027671 Bacteria 92210
169 Ga0268264_10797293 3300028381 Bacteria 943
170 Ga0307517_10000499 3300028786 Bacteria 67326
171 Ga0307517_10115266 3300028786 Bacteria 2018
172 Ga0307515_10000366 3300028794 Bacteria 111195
173 Ga0307515_10001653 3300028794 Bacteria 49625
174 Ga0307515_10001755 3300028794 Bacteria 48316
175 Ga0307515_10076802 3300028794 Bacteria 4422
176 Ga0307515_10089438 3300028794 Bacteria 3877
177 Ga0307512_10112726 3300030522 Bacteria 1783
178 Ga0307512_10252708 3300030522 Bacteria 876
179 Ga0265325_10076271 3300031241 Bacteria 1673
180 Ga0307513_10018139 3300031456 Bacteria 8421
181 Ga0307513_10020950 3300031456 Bacteria 7733
182 Ga0307513_10039320 3300031456 Bacteria 5245
183 Ga0307513_10051731 3300031456 Bacteria 4429
184 Ga0307513_10107739 3300031456 Bacteria 2789
185 Ga0307513_10199739 3300031456 Bacteria 1842
186 Ga0307509_10002631 3300031507 Bacteria 28728
187 Ga0307509_10006190 3300031507 Bacteria 16213
188 Ga0307509_10008010 3300031507 Bacteria 13596
189 Ga0307509_10020942 3300031507 Bacteria 7409
190 Ga0307509_10035192 3300031507 Bacteria 5498
191 Ga0307509_10184443 3300031507 Bacteria 1946
192 Ga0307508_10000194 3300031616 Bacteria 73425
193 Ga0307508_10001847 3300031616 Bacteria 23394
194 Ga0307508_10006981 3300031616 Bacteria 10530
195 Ga0307514_10009816 3300031649 Bacteria 8027
196 Ga0307514_10036410 3300031649 Bacteria 3911
197 Ga0307516_10002103 3300031730 Bacteria 27039
198 Ga0307516_10002796 3300031730 Bacteria 23020
199 Ga0307516_10019944 3300031730 Bacteria 6931
200 Ga0307516_10055371 3300031730 Bacteria 3871
201 Ga0307516_10080561 3300031730 Bacteria 3100
202 Ga0307516_10166431 3300031730 Bacteria 1949
203 Ga0307516_10182048 3300031730 Bacteria 1834
204 Ga0307516_10270959 3300031730 Bacteria 1384
205 Ga0307516_10306829 3300031730 Bacteria 1261
206 Ga0307507_10063323 3300033179 Bacteria 3425
207 Ga0307507_10089503 3300033179 Bacteria 2648
208 Ga0307510_10002130 3300033180 Bacteria 22354
209 Ga0307510_10130976 3300033180 Bacteria 2181
210 Ga0307510_10229799 3300033180 Bacteria 1358
211 Ga0373930_0018110 3300034816 Bacteria 1350
212 Ga0373932_0020437 3300035112 Bacteria 1736
213 Ga0373931_0036659 3300035691 Bacteria 2557
214 Ga0373931_0072833 3300035691 Bacteria 1879
215 Ga0395899_0002403 3300037312 Bacteria 15207
216 Ga0395900_0022594 3300037418 Bacteria 6436
217 Ga0395900_0029616 3300037418 Bacteria 5617
218 Ga0395900_0063521 3300037418 Bacteria 3795
219 Ga0395900_0570933 3300037418 Bacteria 1074
220 Ga0395900_0642283 3300037418 Bacteria 998
221 Ga0395898_0059445 3300037466 Bacteria 3718
222 Ga0395905_0000531 3300037471 Bacteria 52244
223 Ga0395905_0001953 3300037471 Bacteria 23590
224 Ga0395905_0008345 3300037471 Bacteria 10216
225 Ga0395905_0052191 3300037471 Bacteria 3828
226 Ga0395905_0344553 3300037471 Bacteria 1381
227 Ga0395905_0438026 3300037471 Bacteria 1204
228 Ga0395905_0508827 3300037471 Bacteria 1104
229 Ga0436364_0361338 3300037853 Bacteria 1948
230 Ga0395901_0015495 3300038443 Bacteria 7761
231 Ga0395901_0054940 3300038443 Bacteria 4140
232 Ga0395901_0087920 3300038443 Bacteria 3249
233 Ga0395901_0279889 3300038443 Bacteria 1733
234 Ga0436365_1525646 3300039437 Bacteria 1068
235 Ga0451849_0545189 3300041505 Bacteria 1072
236 Ga0451851_0370427 3300041507 Bacteria 1150
237 Ga0451853_1153607 3300041512 Bacteria 1621
238 Ga0450919_002275 3300042121 Bacteria 2488
239 Ga0450923_005975 3300042125 Bacteria 1992
240 Ga0450918_000456 3300042531 Bacteria 8730
241 Ga0451577_0203625 3300042876 Bacteria 1787
242 Ga0466969_0005620 3300044656 Bacteria 6666
243 Ga0466969_0010501 3300044656 Bacteria 4909
244 Ga0466972_0000353 3300044658 Bacteria 24981
245 Ga0453683_0205248 3300044673 Bacteria 1251
246 Ga0466965_0003147 3300044683 Bacteria 7198
247 Ga0466965_0099755 3300044683 Bacteria 1484
248 Ga0466965_0181611 3300044683 Bacteria 1110
249 Ga0466966_0003743 3300044684 Bacteria 10029
250 Ga0466966_0003937 3300044684 Bacteria 9805
251 Ga0466966_0083421 3300044684 Bacteria 1988
252 Ga0466961_0006996 3300044693 Bacteria 7178
253 Ga0466961_0009341 3300044693 Bacteria 6246
254 Ga0466961_0084724 3300044693 Bacteria 2004
255 Ga0466963_0048876 3300044694 Bacteria 2797
256 Ga0466964_0006734 3300044706 Bacteria 4284
257 Ga0466964_0035089 3300044706 Bacteria 2004
258 Ga0466964_0037619 3300044706 Bacteria 1944
259 Ga0466964_0084004 3300044706 Bacteria 1372
260 Ga0453684_0001576 3300044712 Bacteria 63117
261 Ga0453684_0023623 3300044712 Bacteria 9036
262 Ga0453684_0028538 3300044712 Bacteria 7957
263 Ga0453684_0042842 3300044712 Bacteria 6093
264 Ga0453684_0052876 3300044712 Bacteria 5306
265 Ga0453684_0108672 3300044712 Bacteria 3375
266 Ga0466971_0004238 3300044719 Bacteria 6182
267 Ga0466971_0024785 3300044719 Bacteria 2677
268 Ga0466968_0109490 3300044735 Bacteria 1241
269 Ga0466970_0088968 3300044765 Bacteria 1674
270 Ga0466957_0011075 3300044842 Bacteria 5190
271 Ga0466957_0035421 3300044842 Bacteria 2995
272 Ga0466957_0130472 3300044842 Bacteria 1610
273 Ga0466960_0065242 3300044901 Bacteria 1798
274 Ga0466959_0000519 3300045049 Bacteria 22368
275 Ga0466959_0031327 3300045049 Bacteria 3935
276 Ga0466959_0033580 3300045049 Bacteria 3794
277 Ga0466959_0052823 3300045049 Bacteria 2975
278 Ga0451576_0158250 3300045051 Bacteria 2363
279 Ga0451576_0452118 3300045051 Bacteria 1348
280 Ga0466958_0078756 3300045836 Bacteria 2025
281 Ga0466958_0112778 3300045836 Bacteria 1698
282 Ga0466958_0275667 3300045836 Bacteria 1077
283 Ga0466958_0489419 3300045836 Bacteria 798
284 Ga0466967_0062542 3300045976 Bacteria 3304
285 Ga0466967_0070711 3300045976 Bacteria 3122
286 Ga0466967_0322317 3300045976 Bacteria 1490
287 Ga0466967_0363097 3300045976 Bacteria 1403
288 Ga0495592_0000237 3300046454 Bacteria 47510
289 Ga0495590_0032102 3300046457 Bacteria 1837
290 Ga0495605_0074541 3300046474 Bacteria 1597
291 Ga0495662_0101413 3300046476 Bacteria 1408
292 Ga0495607_0044221 3300046501 Bacteria 2627
293 Ga0495583_0145996 3300046506 Bacteria 983
294 Ga0495606_0104738 3300046507 Bacteria 1716
295 Ga0495608_0132161 3300046511 Bacteria 1597
296 Ga0495610_0036768 3300046512 Bacteria 2499
297 Ga0495610_0083191 3300046512 Bacteria 1465
298 Ga0495618_0257298 3300046514 Bacteria 1094
299 Ga0495632_0000179 3300046519 Bacteria 64710
300 Ga0495632_0007246 3300046519 Bacteria 7000
301 Ga0495632_0050828 3300046519 Bacteria 2042
302 Ga0495643_0010850 3300046522 Bacteria 5584
303 Ga0495643_0032688 3300046522 Bacteria 2885
304 Ga0495648_0031103 3300046524 Bacteria 3520
305 Ga0495642_0003544 3300046528 Bacteria 6149
306 Ga0495642_0044251 3300046528 Unclassified 1817
307 Ga0495642_0154027 3300046528 Unclassified 995
308 Ga0495597_0007276 3300046542 Bacteria 5640
309 Ga0495597_0042758 3300046542 Bacteria 2019
310 Ga0495622_0029968 3300046557 Bacteria 2542
311 Ga0495622_0137284 3300046557 Bacteria 1111
312 Ga0495668_0017470 3300046616 Bacteria 4159
313 Ga0495611_0048337 3300046648 Bacteria 1912
314 Ga0495625_0000673 3300046660 Bacteria 48716
315 Ga0495625_0026166 3300046660 Bacteria 4412
316 Ga0495661_0012220 3300046665 Bacteria 5799
317 Ga0495661_0021567 3300046665 Bacteria 4199
318 Ga0495588_0051116 3300046674 Bacteria 2128
319 Ga0495646_0305569 3300046680 Bacteria 840
320 Ga0495658_0039692 3300046683 Bacteria 2613
321 Ga0495624_0119333 3300046690 Bacteria 1620
322 Ga0495671_0068433 3300046692 Bacteria 1746
323 Ga0495660_0018201 3300046810 Bacteria 4039
324 Ga0495636_0154734 3300047318 Bacteria 1030
325 Ga0495674_0173742 3300047319 Bacteria 1797
326 Ga0495672_0000036 3300047320 Bacteria 279648
327 Ga0495676_0037039 3300047321 Bacteria 4066
328 Ga0495687_003725 3300047443 Bacteria 10815
329 Ga0495687_005772 3300047443 Bacteria 7771
330 Ga0495687_005773 3300047443 Bacteria 7771
331 Ga0495687_012330 3300047443 Bacteria 4525
332 Ga0495687_025960 3300047443 Bacteria 2762
333 Ga0495626_0104219 3300048091 Bacteria 1234
334 Ga0496100_0323903 3300048903 Bacteria 1158
335 Ga0496101_0208792 3300048904 Bacteria 1512
336 Ga0496101_0214504 3300048904 Bacteria 1492
337 Ga0496102_0182924 3300048905 Bacteria 1975
338 Ga0496103_0013398 3300048906 Bacteria 4861
339 Ga0496104_0363993 3300048907 Bacteria 1359
340 Ga0496105_0049307 3300048908 Bacteria 3476
341 Ga0496106_0103948 3300048909 Bacteria 2205
342 Ga0496107_0128386 3300048910 Bacteria 1871
343 Ga0496107_0149481 3300048910 Bacteria 1727
344 Ga0496107_0288281 3300048910 Bacteria 1222
345 Ga0496108_0469815 3300048911 Bacteria 1099
346 Ga0496109_0154412 3300048912 Bacteria 2150
347 Ga0496109_0645031 3300048912 Bacteria 996
348 Ga0496110_0108228 3300048913 Bacteria 2496
349 Ga0496111_0191375 3300048914 Bacteria 1521
350 Ga0496113_0506410 3300048916 Bacteria 969
351 Ga0496114_0102842 3300048917 Bacteria 2441
352 Ga0496115_0301209 3300048918 Bacteria 1314
353 Ga0496116_0004558 3300048919 Bacteria 13143
354 Ga0496116_0065553 3300048919 Bacteria 2329
355 Ga0496118_0081780 3300048921 Bacteria 2266
356 Ga0496119_0111924 3300048922 Bacteria 1514
357 Ga0496121_0006855 3300048924 Bacteria 13926
358 Ga0496121_0345715 3300048924 Bacteria 992
359 Ga0496122_0000801 3300048925 Bacteria 60312
360 Ga0496123_0000528 3300048926 Bacteria 65747
361 Ga0496125_0004529 3300048928 Bacteria 15964
362 Ga0501037_0023442 3300049573 Bacteria 4563
363 Ga0501043_0000243 3300049579 Bacteria 49191
364 Ga0501046_0000137 3300049580 Bacteria 78496
365 Ga0501047_0000050 3300049581 Bacteria 155628
366 Ga0501048_0017987 3300049582 Bacteria 5200
367 Ga0501045_0006004 3300049824 Bacteria 8405
368 nmdc:mga03683_107837_c1 3300050489 Bacteria 1229
369 nmdc:mga0yw44_285693_c1 3300050492 Bacteria 1103
370 nmdc:mga0yw44_908_c1 3300050492 Bacteria 7682
371 nmdc:mga0k408_160648_c1 3300050493 Bacteria 1339
372 nmdc:mga0k408_1828_c2 3300050493 Bacteria 8233
373 nmdc:mga0k408_2521_c1 3300050493 Bacteria 9425
374 nmdc:mga0k408_40885_c1 3300050493 Bacteria 2669
375 nmdc:mga06z11_207521_c1 3300050494 Bacteria 1140
376 nmdc:mga07m45_1471_c1 3300050496 Bacteria 10818
377 nmdc:mga07m45_43057_c1 3300050496 Bacteria 2531
378 nmdc:mga07m45_67182_c2 3300050496 Bacteria 1571
379 nmdc:mga07m45_8963_c1 3300050496 Bacteria 5167
380 nmdc:mga05p37_399618_c1 3300050507 Bacteria 1605
381 nmdc:mga0sz30_56789_c1 3300050516 Bacteria 1668
382 Ga0495601_0055337 3300053077 Bacteria 2512
383 Ga0500578_0000437 3300053086 Bacteria 51031
384 Ga0500646_0025448 3300053090 Bacteria 1598
385 Ga0500651_0027776 3300053093 Bacteria 3558
386 Ga0500651_0042097 3300053093 Bacteria 2878
387 Ga0500594_0007781 3300053118 Bacteria 2430
388 Ga0500618_000922 3300053125 Bacteria 15179
389 Ga0500618_002393 3300053125 Bacteria 7148
390 Ga0500642_0004416 3300053130 Bacteria 4398
391 Ga0500652_000312 3300053131 Bacteria 17547
392 Ga0500559_0000602 3300053136 Bacteria 24517
393 Ga0500568_0022336 3300053139 Bacteria 2707
394 Ga0500622_0000164 3300053156 Bacteria 70630
395 Ga0500636_0080448 3300053177 Bacteria 1878
396 Ga0500584_088842 3300053726 Bacteria 1303
397 Ga0587082_000257 3300059504 Bacteria 3878
398 Ga0466962_0009870 3300061719 Bacteria 4579
399 Ga0466962_0164083 3300061719 Bacteria 1080
400 Ga0466962_0287063 3300061719 Bacteria 813
401 2511247849 2511231003 Bacteria 5606035
402 2587729990 2585428057 Bacteria 6737412
403 2587734866 2585428058 Bacteria 6853932
404 2587754459 2585428062 Bacteria 6842168
405 2588293183 2588253510 Bacteria 6901809
406 2643968413 2643221592 Bacteria 6608788
407 2644141795 2643221625 Bacteria 6512927
408 2644248841 2643221644 Bacteria 6865017
409 2644272535 2643221648 Bacteria 6521465
410 2819594743 2818991445 Bacteria 4955017
411 2824662839 2824661429 Bacteria 9877870
412 2879102765 2879099564 Bacteria 10442239
413 2884815382 2884811622 Bacteria 5552861
414 2884815395 2884811622 Bacteria 5552861
415 2884841237 2884836552 Bacteria 5219991
416 2884856111 2884852848 Bacteria 5221161
417 2896156963 2896154374 Bacteria 5221518
418 2897805103 2897803580 Bacteria 7000062
419 2919049354 2919046199 Bacteria 5567169
420 2929619818 2929615660 Bacteria 9193770
421 2929629129 2929624759 Bacteria 9339455
422 2932816633 2932809354 Bacteria 9135765
423 2932822080 2932818245 Bacteria 9955613
424 2933581737 2933577622 Bacteria 9116884
425 2935646778 2935638405 Bacteria 10015038
426 2935674552 2935665750 Bacteria 9571747
427 2935690657 2935684952 Bacteria 9590419
428 2935717647 2935713505 Bacteria 9608509
429 2935727203 2935722832 Bacteria 9608746
430 2935735973 2935732158 Bacteria 9706831
431 2935744756 2935741537 Bacteria 9707219
432 2935755666 2935750917 Bacteria 9590372
433 2935761845 2935760218 Bacteria 9817913
434 2935808114 2935801545 Bacteria 9301974
435 2935814166 2935810662 Bacteria 9401221
436 2935836032 2935827899 Bacteria 10038562
437 2936039721 2936037263 Bacteria 9446081
438 2940561053 2940556831 Bacteria 9590747
439 8054009174 8054002106 Bacteria 7987183
440 8055750429 8055742211 Bacteria 9226248
441 Ga0500619_000040
442 JGI25155J39150_1001038
443 JGI25155J39150_1001040
444 JGI25156J39149_1000158
445 JGI25156J39149_1000164
446 JGI25162J39368_1006794
447 JGI25154J39366_1000074
448 JGI25154J39366_1000114
449 JGI25154J39366_1000175
450 JGI25157J39369_1000335
451 JGI25152J39213_1002477
452 JGI25153J46596_10002270
453 JGI25153J46596_10003693
454 rootH1_10019386
455 rootL2_10064870
456 rootH1_10082242
457 Ga0055532_1000080
458 Ga0055535_1000056
459 Ga0055535_1003152
460 Ga0055529_1000165
461 Ga0055526_1002150
462 Ga0055524_1000027
463 Ga0055530_10017021
464 Ga0065165_1000832
465 Ga0070658_10251947
466 Ga0070658_10296983
467 Ga0070670_100083039
468 Ga0068869_100044130
469 Ga0068868_100008596
470 Ga0070661_100000893
471 Ga0070661_100101521
472 Ga0070675_100009253
473 Ga0070659_100004831
474 Ga0070659_100310788
475 Ga0070667_100018165
476 Ga0070667_100264293
477 Ga0070708_100414037
478 Ga0070663_100258089
479 Ga0070662_100000931
480 Ga0070662_100725795
481 Ga0068867_100000018
482 Ga0068867_100004640
483 Ga0070706_100132758
484 Ga0070672_100009637
485 Ga0068855_100040000
486 Ga0068855_101157616
487 Ga0070664_100002509
488 Ga0070664_100065471
489 Ga0070664_100113132
490 Ga0068857_100080602
491 Ga0068857_100127728
492 Ga0068854_100066767
493 Ga0068856_100018591
494 Ga0068852_100006807
495 Ga0068852_100025699
496 Ga0068863_100698632
497 Ga0075365_10031551
498 Ga0075365_10353476
499 Ga0075363_100080666
500 Ga0075363_100163118
501 Ga0075364_10158072
502 Ga0075362_10020128
503 Ga0075362_10023088
504 Ga0075367_10047429
505 Ga0075367_10097664
506 Ga0075366_10024864
507 Ga0075366_10076207
508 Ga0097621_100156233
509 Ga0097621_100169873
510 Ga0075370_10001985
511 Ga0075370_10062522
512 Ga0075370_10063322
513 Ga0075434_100080372
514 Ga0079104_1004958
515 Ga0099794_10000585
516 Ga0105240_10000809
517 Ga0105240_10010334
518 Ga0105240_10167965
519 Ga0105245_10137905
520 Ga0114129_10356465
521 Ga0105243_10031481
522 Ga0105243_10130285
523 Ga0105243_10285397
524 Ga0105242_10266071
525 Ga0105237_10233927
526 Ga0105237_10300002
527 Ga0105239_10075487
528 Ga0105239_10491575
529 Ga0163163_10127428
530 Ga0163163_10613255
531 Ga0157380_11003351
532 Ga0182008_10020675
533 Ga0157377_10000051
534 Ga0157379_10112628
535 Ga0157376_10075142
536 Ga0157376_10573588
537 Ga0182006_1020942
538 Ga0213874_10074047
539 Ga0213875_10180639
540 Ga0209435_100018
541 Ga0209435_100138
542 Ga0209147_100051
543 Ga0209437_100145
544 Ga0209258_100071
545 Ga0209258_100244
546 Ga0209646_1000081
547 Ga0209646_1000090
548 Ga0209026_1000042
549 Ga0209026_1007538
550 Ga0209759_1000098
551 Ga0209759_1000109
552 Ga0209759_1000936
553 Ga0209129_1000075
554 Ga0209565_1010168
555 Ga0209455_1000030
556 Ga0209455_1028487
557 Ga0209025_1032271
558 Ga0209564_1000046
559 Ga0209758_1000045
560 Ga0209758_1000052
561 Ga0209050_1000257
562 Ga0209256_1000013
563 Ga0209051_1003673
564 Ga0209051_1014608
565 Ga0209257_1038287
566 Ga0207697_10055271
567 Ga0207645_10001304
568 Ga0207645_10160947
569 Ga0207705_10256874
570 Ga0207705_10281201
571 Ga0207684_10124424
572 Ga0207684_10447590
573 Ga0207695_10001196
574 Ga0207695_10008186
575 Ga0207671_10217853
576 Ga0207649_10077692
577 Ga0207650_10057935
578 Ga0207659_10071735
579 Ga0207644_10103523
580 Ga0207690_10062549
581 Ga0207706_10001218
582 Ga0207706_10105094
583 Ga0207686_10491269
584 Ga0207709_10016442
585 Ga0207691_10006518
586 Ga0207711_10236578
587 Ga0207689_10031804
588 Ga0207689_10117317
589 Ga0207679_10000056
590 Ga0207679_10445463
591 Ga0207667_10007680
592 Ga0207667_10209921
593 Ga0207651_10048131
594 Ga0207668_10925790
595 Ga0207640_10014346
596 Ga0207702_10034341
597 Ga0207641_10722678
598 Ga0207648_10000060
599 Ga0207648_10002312
600 Ga0207648_10192197
601 Ga0207674_10071423
602 Ga0207674_10127555
603 Ga0207674_10486756
604 Ga0207675_100173706
605 Ga0207683_10155100
606 Ga0207698_10020491
607 Ga0207698_10120826
608 Ga0209588_1000022
609 Ga0268264_10797293
610 Ga0307517_10000499
611 Ga0307517_10115266
612 Ga0307515_10000366
613 Ga0307515_10001653
614 Ga0307515_10001755
615 Ga0307515_10076802
616 Ga0307515_10089438
617 Ga0307512_10112726
618 Ga0307512_10252708
619 Ga0265325_10076271
620 Ga0307513_10018139
621 Ga0307513_10020950
622 Ga0307513_10039320
623 Ga0307513_10051731
624 Ga0307513_10107739
625 Ga0307513_10199739
626 Ga0307509_10002631
627 Ga0307509_10006190
628 Ga0307509_10008010
629 Ga0307509_10020942
630 Ga0307509_10035192
631 Ga0307509_10184443
632 Ga0307508_10000194
633 Ga0307508_10001847
634 Ga0307508_10006981
635 Ga0307514_10009816
636 Ga0307514_10036410
637 Ga0307516_10002103
638 Ga0307516_10002796
639 Ga0307516_10019944
640 Ga0307516_10055371
641 Ga0307516_10080561
642 Ga0307516_10166431
643 Ga0307516_10182048
644 Ga0307516_10270959
645 Ga0307516_10306829
646 Ga0307507_10063323
647 Ga0307507_10089503
648 Ga0307510_10002130
649 Ga0307510_10130976
650 Ga0307510_10229799
651 Ga0373930_0018110
652 Ga0373932_0020437
653 Ga0373931_0036659
654 Ga0373931_0072833
655 Ga0395899_0002403
656 Ga0395900_0022594
657 Ga0395900_0029616
658 Ga0395900_0063521
659 Ga0395900_0570933
660 Ga0395900_0642283
661 Ga0395898_0059445
662 Ga0395905_0000531
663 Ga0395905_0001953
664 Ga0395905_0008345
665 Ga0395905_0052191
666 Ga0395905_0344553
667 Ga0395905_0438026
668 Ga0395905_0508827
669 Ga0436364_0361338
670 Ga0395901_0015495
671 Ga0395901_0054940
672 Ga0395901_0087920
673 Ga0395901_0279889
674 Ga0436365_1525646
675 Ga0451849_0545189
676 Ga0451851_0370427
677 Ga0451853_1153607
678 Ga0450919_002275
679 Ga0450923_005975
680 Ga0450918_000456
681 Ga0451577_0203625
682 Ga0466969_0005620
683 Ga0466969_0010501
684 Ga0466972_0000353
685 Ga0453683_0205248
686 Ga0466965_0003147
687 Ga0466965_0099755
688 Ga0466965_0181611
689 Ga0466966_0003743
690 Ga0466966_0003937
691 Ga0466966_0083421
692 Ga0466961_0006996
693 Ga0466961_0009341
694 Ga0466961_0084724
695 Ga0466963_0048876
696 Ga0466964_0006734
697 Ga0466964_0035089
698 Ga0466964_0037619
699 Ga0466964_0084004
700 Ga0453684_0001576
701 Ga0453684_0023623
702 Ga0453684_0028538
703 Ga0453684_0042842
704 Ga0453684_0052876
705 Ga0453684_0108672
706 Ga0466971_0004238
707 Ga0466971_0024785
708 Ga0466968_0109490
709 Ga0466970_0088968
710 Ga0466957_0011075
711 Ga0466957_0035421
712 Ga0466957_0130472
713 Ga0466960_0065242
714 Ga0466959_0000519
715 Ga0466959_0031327
716 Ga0466959_0033580
717 Ga0466959_0052823
718 Ga0451576_0158250
719 Ga0451576_0452118
720 Ga0466958_0078756
721 Ga0466958_0112778
722 Ga0466958_0275667
723 Ga0466958_0489419
724 Ga0466967_0062542
725 Ga0466967_0070711
726 Ga0466967_0322317
727 Ga0466967_0363097
728 Ga0495592_0000237
729 Ga0495590_0032102
730 Ga0495605_0074541
731 Ga0495662_0101413
732 Ga0495607_0044221
733 Ga0495583_0145996
734 Ga0495606_0104738
735 Ga0495608_0132161
736 Ga0495610_0036768
737 Ga0495610_0083191
738 Ga0495618_0257298
739 Ga0495632_0000179
740 Ga0495632_0007246
741 Ga0495632_0050828
742 Ga0495643_0010850
743 Ga0495643_0032688
744 Ga0495648_0031103
745 Ga0495642_0003544
746 Ga0495642_0044251
747 Ga0495642_0154027
748 Ga0495597_0007276
749 Ga0495597_0042758
750 Ga0495622_0029968
751 Ga0495622_0137284
752 Ga0495668_0017470
753 Ga0495611_0048337
754 Ga0495625_0000673
755 Ga0495625_0026166
756 Ga0495661_0012220
757 Ga0495661_0021567
758 Ga0495588_0051116
759 Ga0495646_0305569
760 Ga0495658_0039692
761 Ga0495624_0119333
762 Ga0495671_0068433
763 Ga0495660_0018201
764 Ga0495636_0154734
765 Ga0495674_0173742
766 Ga0495672_0000036
767 Ga0495676_0037039
768 Ga0495687_003725
769 Ga0495687_005772
770 Ga0495687_005773
771 Ga0495687_012330
772 Ga0495687_025960
773 Ga0495626_0104219
774 Ga0496100_0323903
775 Ga0496101_0208792
776 Ga0496101_0214504
777 Ga0496102_0182924
778 Ga0496103_0013398
779 Ga0496104_0363993
780 Ga0496105_0049307
781 Ga0496106_0103948
782 Ga0496107_0128386
783 Ga0496107_0149481
784 Ga0496107_0288281
785 Ga0496108_0469815
786 Ga0496109_0154412
787 Ga0496109_0645031
788 Ga0496110_0108228
789 Ga0496111_0191375
790 Ga0496113_0506410
791 Ga0496114_0102842
792 Ga0496115_0301209
793 Ga0496116_0004558
794 Ga0496116_0065553
795 Ga0496118_0081780
796 Ga0496119_0111924
797 Ga0496121_0006855
798 Ga0496121_0345715
799 Ga0496122_0000801
800 Ga0496123_0000528
801 Ga0496125_0004529
802 Ga0501037_0023442
803 Ga0501043_0000243
804 Ga0501046_0000137
805 Ga0501047_0000050
806 Ga0501048_0017987
807 Ga0501045_0006004
808 nmdc:mga03683_107837_c1
809 nmdc:mga0yw44_285693_c1
810 nmdc:mga0yw44_908_c1
811 nmdc:mga0k408_160648_c1
812 nmdc:mga0k408_1828_c2
813 nmdc:mga0k408_2521_c1
814 nmdc:mga0k408_40885_c1
815 nmdc:mga06z11_207521_c1
816 nmdc:mga07m45_1471_c1
817 nmdc:mga07m45_43057_c1
818 nmdc:mga07m45_67182_c2
819 nmdc:mga07m45_8963_c1
820 nmdc:mga05p37_399618_c1
821 nmdc:mga0sz30_56789_c1
822 Ga0495601_0055337
823 Ga0500578_0000437
824 Ga0500646_0025448
825 Ga0500651_0027776
826 Ga0500651_0042097
827 Ga0500594_0007781
828 Ga0500618_000922
829 Ga0500618_002393
830 Ga0500642_0004416
831 Ga0500652_000312
832 Ga0500559_0000602
833 Ga0500568_0022336
834 Ga0500622_0000164
835 Ga0500636_0080448
836 Ga0500584_088842
837 Ga0587082_000257
838 Ga0466962_0009870
839 Ga0466962_0164083
840 Ga0466962_0287063
841 2511247849
842 2587729990
843 2587734866
844 2587754459
845 2588293183
846 2643968413
847 2644141795
848 2644248841
849 2644272535
850 2819594743
851 2824662839
852 2879102765
853 2884815382
854 2884815395
855 2884841237
856 2884856111
857 2896156963
858 2897805103
859 2919049354
860 2929619818
861 2929629129
862 2932816633
863 2932822080
864 2933581737
865 2935646778
866 2935674552
867 2935690657
868 2935717647
869 2935727203
870 2935735973
871 2935744756
872 2935755666
873 2935761845
874 2935808114
875 2935814166
876 2935836032
877 2936039721
878 2940561053
879 8054009174
880 8055750429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

214

235

0.98

PF00005

ABC_tran

ABC transporter

19

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.937 4 235
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.928 4 234
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9217 4 235
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9211 1 223
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9204 1 223
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.947 3 236 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9314 3 236 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9241 2 226 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9221 2 224 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9213 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6J6GRK5-F1-model_v4 Unannotated protein 0.9682 111 235 GO:0005524
GO:0005886
GO:0016887
AF-A0A257UMR1-F1-model_v4 deleted 0.9649 1 235
AF-A0A537X5T0-F1-model_v4 ABC transporter ATP-binding protein 0.9585 3 235 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A538R5L1-F1-model_v4 Branched-chain amino acid ABC transporter ATP-binding protein/permease 0.9584 4 235 GO:0005524
GO:0005886
GO:0015658
GO:0016887
AF-A0A5P2H818-F1-model_v4 ABC transporter ATP-binding protein 0.9553 1 235 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map