F444550

General Info

Members Datasets Scaffolds Average Seq Length
440 262 437 354

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857453340|2857459126
Length 341
Sequence KVKIALVGCGRISANHFEAIQNNSSLELVAVCDIDQDRAQEASAKWKVDYYVSYQEMLERTDIQLISLCTPSGLHPEQAVMAAERKIHVLTEKPMAVTLKDANRMIQACDDNNVKLFVVKQNRLNSTLQLVKRAIDKQRFGKIYMVSVNVFWQRPQSYYDAASWRGTWELDGGAFMNQASHYVDMMEWLIGDVEKVYAITDTMARDIEAEDTGSAVLRFENGAIGSMNVTMLTYPKNLAGNLTILGEKGTVVVGGTSVNTIEKWEFADSDEDDELAVNVSYTPPSVYGYGHTGYYQNVTDVLLDGAKQGTDGKEGKKSLEVILAIYQSAREHKEIKLPLSE

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221656 Pelomonas sp. Root405 Isolate Unclassified
3 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
149 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
235 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
236 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
239 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 7.5
Rhizosphere 80.68
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000028 3300002704 Bacteria 120158
2 JGI25156J39149_1000013 3300002705 Bacteria 189553
3 JGI25154J39366_1000032 3300002738 Bacteria 189265
4 JGI25157J39369_1000017 3300002741 Bacteria 189553
5 JGI25151J46595_10001607 3300003187 Bacteria 14986
6 Ga0055525_1000047 3300003759 Bacteria 261507
7 Ga0065165_1000691 3300005262 Bacteria 48143
8 Ga0070658_10006880 3300005327 Bacteria 9191
9 Ga0070658_10011248 3300005327 Bacteria 7173
10 Ga0070658_10044477 3300005327 Bacteria 3589
11 Ga0070683_100068801 3300005329 Bacteria 3299
12 Ga0070666_10145169 3300005335 Bacteria 1654
13 Ga0068868_100016415 3300005338 Bacteria 5498
14 Ga0070660_100004993 3300005339 Bacteria 9173
15 Ga0070660_100005123 3300005339 Bacteria 9053
16 Ga0070660_100046983 3300005339 Bacteria 3310
17 Ga0070668_100238701 3300005347 Bacteria 1505
18 Ga0070671_100009821 3300005355 Bacteria 7681
19 Ga0070688_100083551 3300005365 Bacteria 2072
20 Ga0070714_100100274 3300005435 Bacteria 2550
21 Ga0070705_100027109 3300005440 Bacteria 3125
22 Ga0070694_100108417 3300005444 Bacteria 1975
23 Ga0070708_100056023 3300005445 Bacteria 3505
24 Ga0070663_100028872 3300005455 Bacteria 3782
25 Ga0070662_100035429 3300005457 Bacteria 3524
26 Ga0070662_100075648 3300005457 Bacteria 2494
27 Ga0070685_10015243 3300005466 Bacteria 4081
28 Ga0070707_100014812 3300005468 Bacteria 7309
29 Ga0070707_100072947 3300005468 Bacteria 3309
30 Ga0070707_100284571 3300005468 Bacteria 1606
31 Ga0070699_100000036 3300005518 Bacteria 133816
32 Ga0070699_100011473 3300005518 Bacteria 7652
33 Ga0070699_100012146 3300005518 Bacteria 7434
34 Ga0070697_100001922 3300005536 Bacteria 15904
35 Ga0070697_100214910 3300005536 Bacteria 1638
36 Ga0070696_100001123 3300005546 Bacteria 17326
37 Ga0070696_100022549 3300005546 Bacteria 4278
38 Ga0070693_100067630 3300005547 Bacteria 2095
39 Ga0070665_100052949 3300005548 Bacteria 4071
40 Ga0068855_100004247 3300005563 Bacteria 17499
41 Ga0068855_100023796 3300005563 Bacteria 7337
42 Ga0068855_100101134 3300005563 Bacteria 3318
43 Ga0068855_100153703 3300005563 Bacteria 2615
44 Ga0070664_100042719 3300005564 Bacteria 3826
45 Ga0070664_100123244 3300005564 Bacteria 2271
46 Ga0068854_100000860 3300005578 Bacteria 18187
47 Ga0068856_100008649 3300005614 Bacteria 9904
48 Ga0068864_100177414 3300005618 Bacteria 1946
49 Ga0068858_100009795 3300005842 Bacteria 9120
50 Ga0081455_10083914 3300005937 Bacteria 2602
51 Ga0075363_100048578 3300006048 Bacteria 2257
52 Ga0075363_100107349 3300006048 Bacteria 1549
53 Ga0070716_100003928 3300006173 Bacteria 7055
54 Ga0070712_100006429 3300006175 Bacteria 7286
55 Ga0075362_10001998 3300006177 Bacteria 6709
56 Ga0075367_10042578 3300006178 Bacteria 2657
57 Ga0075367_10157437 3300006178 Bacteria 1412
58 Ga0075366_10001435 3300006195 Bacteria 11892
59 Ga0097621_100025588 3300006237 Bacteria 4619
60 Ga0075370_10000365 3300006353 Bacteria 16530
61 Ga0075370_10041710 3300006353 Bacteria 2591
62 Ga0068871_100045854 3300006358 Bacteria 3519
63 Ga0075428_100000452 3300006844 Bacteria 41072
64 Ga0075428_100064717 3300006844 Bacteria 4005
65 Ga0075430_100002016 3300006846 Bacteria 16741
66 Ga0075430_100048693 3300006846 Bacteria 3579
67 Ga0075430_100089790 3300006846 Bacteria 2571
68 Ga0075431_100000364 3300006847 Bacteria 35896
69 Ga0075431_100002500 3300006847 Bacteria 17731
70 Ga0075431_100029231 3300006847 Bacteria 5671
71 Ga0075433_10014025 3300006852 Bacteria 6533
72 Ga0075429_100023304 3300006880 Bacteria 5370
73 Ga0075429_100118927 3300006880 Bacteria 2309
74 Ga0097620_100178620 3300006931 Bacteria 2205
75 Ga0105240_10002013 3300009093 Bacteria 33506
76 Ga0105240_10015675 3300009093 Bacteria 10290
77 Ga0105240_10023342 3300009093 Bacteria 8183
78 Ga0105240_10080289 3300009093 Bacteria 4012
79 Ga0105240_10117892 3300009093 Bacteria 3200
80 Ga0111539_10011937 3300009094 Bacteria 10891
81 Ga0111539_10018275 3300009094 Bacteria 8685
82 Ga0111539_10020138 3300009094 Bacteria 8220
83 Ga0105245_10317965 3300009098 Bacteria 1533
84 Ga0114129_10004357 3300009147 Bacteria 19984
85 Ga0114129_10255073 3300009147 Bacteria 2353
86 Ga0114129_10311021 3300009147 Bacteria 2097
87 Ga0105241_10002118 3300009174 Bacteria 14999
88 Ga0105241_10085829 3300009174 Bacteria 2474
89 Ga0105242_10001278 3300009176 Bacteria 19882
90 Ga0105242_10004433 3300009176 Bacteria 10914
91 Ga0105242_10069382 3300009176 Bacteria 2919
92 Ga0105242_10264246 3300009176 Bacteria 1556
93 Ga0105248_10015852 3300009177 Bacteria 8306
94 Ga0105237_10142843 3300009545 Bacteria 2388
95 Ga0105238_10331850 3300009551 Bacteria 1508
96 Ga0105249_10124581 3300009553 Bacteria 2452
97 Ga0105239_10037783 3300010375 Bacteria 5291
98 Ga0105239_10126573 3300010375 Bacteria 2840
99 Ga0157371_10002796 3300013102 Bacteria 16364
100 Ga0157370_10005186 3300013104 Bacteria 14678
101 Ga0157370_10005893 3300013104 Bacteria 13660
102 Ga0157370_10018950 3300013104 Bacteria 6919
103 Ga0157369_10004352 3300013105 Bacteria 16712
104 Ga0157374_10006650 3300013296 Bacteria 9820
105 Ga0157378_10003575 3300013297 Bacteria 13763
106 Ga0157372_10139159 3300013307 Bacteria 2796
107 Ga0157375_10029392 3300013308 Bacteria 5168
108 Ga0163163_10135713 3300014325 Bacteria 2502
109 Ga0157379_10245737 3300014968 Bacteria 1623
110 Ga0209435_100003 3300025206 Bacteria 669534
111 Ga0209563_100003 3300025230 Bacteria 1932942
112 Ga0207425_1001030 3300025245 Bacteria 12992
113 Ga0209646_1000008 3300025246 Bacteria 669534
114 Ga0209026_1000007 3300025250 Bacteria 669534
115 Ga0209148_1002087 3300025254 Bacteria 7609
116 Ga0209759_1000026 3300025256 Bacteria 311743
117 Ga0209565_1000758 3300025263 Bacteria 18952
118 Ga0209675_1001795 3300025291 Bacteria 11733
119 Ga0209025_1001036 3300025294 Bacteria 40764
120 Ga0209256_1017522 3300025299 Bacteria 2374
121 Ga0207680_10047440 3300025903 Bacteria 2545
122 Ga0207645_10232011 3300025907 Bacteria 1218
123 Ga0207643_10171287 3300025908 Bacteria 1310
124 Ga0207705_10000640 3300025909 Bacteria 29193
125 Ga0207705_10002230 3300025909 Bacteria 14959
126 Ga0207705_10030677 3300025909 Bacteria 3836
127 Ga0207684_10077709 3300025910 Bacteria 2823
128 Ga0207707_10142589 3300025912 Bacteria 2094
129 Ga0207695_10002190 3300025913 Bacteria 29482
130 Ga0207695_10005662 3300025913 Bacteria 16491
131 Ga0207695_10020685 3300025913 Bacteria 7531
132 Ga0207695_10035180 3300025913 Bacteria 5436
133 Ga0207695_10237645 3300025913 Bacteria 1724
134 Ga0207695_10263640 3300025913 Bacteria 1620
135 Ga0207657_10000973 3300025919 Bacteria 30427
136 Ga0207657_10008871 3300025919 Bacteria 10171
137 Ga0207657_10018985 3300025919 Bacteria 6543
138 Ga0207646_10036376 3300025922 Bacteria 4444
139 Ga0207646_10068247 3300025922 Bacteria 3175
140 Ga0207646_10099992 3300025922 Bacteria 2599
141 Ga0207646_10192972 3300025922 Bacteria 1839
142 Ga0207687_10129006 3300025927 Bacteria 1903
143 Ga0207700_10022999 3300025928 Bacteria 4287
144 Ga0207664_10175542 3300025929 Bacteria 1837
145 Ga0207644_10004083 3300025931 Bacteria 9469
146 Ga0207690_10016606 3300025932 Bacteria 4483
147 Ga0207706_10083464 3300025933 Bacteria 2809
148 Ga0207706_10088114 3300025933 Bacteria 2729
149 Ga0207706_10179891 3300025933 Bacteria 1857
150 Ga0207706_10203966 3300025933 Bacteria 1734
151 Ga0207686_10047029 3300025934 Bacteria 2665
152 Ga0207670_10004820 3300025936 Bacteria 7325
153 Ga0207704_10135472 3300025938 Bacteria 1713
154 Ga0207665_10001989 3300025939 Bacteria 13784
155 Ga0207689_10175877 3300025942 Bacteria 1765
156 Ga0207679_10136506 3300025945 Bacteria 1976
157 Ga0207667_10003719 3300025949 Bacteria 18811
158 Ga0207667_10028093 3300025949 Bacteria 6112
159 Ga0207667_10091215 3300025949 Bacteria 3148
160 Ga0207651_10010742 3300025960 Bacteria 5089
161 Ga0207668_10310460 3300025972 Bacteria 1305
162 Ga0207640_10004526 3300025981 Bacteria 7546
163 Ga0207677_10020308 3300026023 Bacteria 4031
164 Ga0207678_10006453 3300026067 Bacteria 10407
165 Ga0207678_10008719 3300026067 Bacteria 8930
166 Ga0207702_10060165 3300026078 Bacteria 3238
167 Ga0207702_10400535 3300026078 Bacteria 1323
168 Ga0207641_10067181 3300026088 Bacteria 3071
169 Ga0207641_10138204 3300026088 Bacteria 2195
170 Ga0207648_10058138 3300026089 Bacteria 3373
171 Ga0207648_10074014 3300026089 Bacteria 2968
172 Ga0207676_10010440 3300026095 Bacteria 6614
173 Ga0207676_10080617 3300026095 Bacteria 2642
174 Ga0207674_10012557 3300026116 Bacteria 9463
175 Ga0207683_10009611 3300026121 Bacteria 8243
176 Ga0209974_10021171 3300027876 Bacteria 2153
177 Ga0207428_10115080 3300027907 Bacteria 2066
178 Ga0207428_10182995 3300027907 Bacteria 1582
179 Ga0268266_10008344 3300028379 Bacteria 9221
180 Ga0307517_10153888 3300028786 Bacteria 1568
181 Ga0307515_10154515 3300028794 Bacteria 2377
182 Ga0307513_10050202 3300031456 Bacteria 4512
183 Ga0307408_100024658 3300031548 Bacteria 4111
184 Ga0307516_10175646 3300031730 Bacteria 1879
185 Ga0307405_10125236 3300031731 Bacteria 1765
186 Ga0307413_10013140 3300031824 Bacteria 4147
187 Ga0307413_10014619 3300031824 Bacteria 3994
188 Ga0307413_10051933 3300031824 Bacteria 2473
189 Ga0307413_10064047 3300031824 Bacteria 2282
190 Ga0307410_10000629 3300031852 Bacteria 14532
191 Ga0307410_10012904 3300031852 Bacteria 4853
192 Ga0307410_10016990 3300031852 Bacteria 4355
193 Ga0307410_10028879 3300031852 Bacteria 3524
194 Ga0307410_10096515 3300031852 Bacteria 2110
195 Ga0307410_10181562 3300031852 Bacteria 1593
196 Ga0307406_10018586 3300031901 Bacteria 4064
197 Ga0307406_10154078 3300031901 Bacteria 1643
198 Ga0307407_10047245 3300031903 Bacteria 2441
199 Ga0307407_10054817 3300031903 Bacteria 2301
200 Ga0307407_10076331 3300031903 Bacteria 2012
201 Ga0307407_10087141 3300031903 Bacteria 1904
202 Ga0307407_10201086 3300031903 Bacteria 1335
203 Ga0307409_100000080 3300031995 Bacteria 34467
204 Ga0307409_100063236 3300031995 Bacteria 2901
205 Ga0307416_100000433 3300032002 Bacteria 21345
206 Ga0307416_100001388 3300032002 Bacteria 13121
207 Ga0307416_100079432 3300032002 Bacteria 2764
208 Ga0307416_100135136 3300032002 Bacteria 2229
209 Ga0307414_10007884 3300032004 Bacteria 6008
210 Ga0307414_10019795 3300032004 Bacteria 4179
211 Ga0307411_10000388 3300032005 Bacteria 15018
212 Ga0307411_10004258 3300032005 Bacteria 6817
213 Ga0307411_10007269 3300032005 Bacteria 5621
214 Ga0307411_10135524 3300032005 Bacteria 1807
215 Ga0307415_100000280 3300032126 Bacteria 22015
216 Ga0307415_100163467 3300032126 Bacteria 1728
217 Ga0373955_0106534 3300035172 Bacteria 1616
218 Ga0373961_0014655 3300035241 Bacteria 1994
219 Ga0395899_0003829 3300037312 Bacteria 11872
220 Ga0395899_0020667 3300037312 Bacteria 4991
221 Ga0395899_0024721 3300037312 Bacteria 4541
222 Ga0395899_0033563 3300037312 Bacteria 3853
223 Ga0395899_0048119 3300037312 Bacteria 3174
224 Ga0395899_0127327 3300037312 Bacteria 1820
225 Ga0395900_0000331 3300037418 Bacteria 69780
226 Ga0395900_0000763 3300037418 Bacteria 42856
227 Ga0395900_0003744 3300037418 Bacteria 16335
228 Ga0395900_0004504 3300037418 Bacteria 14745
229 Ga0395900_0063442 3300037418 Bacteria 3797
230 Ga0395900_0131765 3300037418 Bacteria 2561
231 Ga0395898_0085197 3300037466 Bacteria 3046
232 Ga0395905_0004263 3300037471 Bacteria 14925
233 Ga0395905_0085447 3300037471 Bacteria 2956
234 Ga0395901_0000003 3300038443 Bacteria 701538
235 Ga0395901_0000097 3300038443 Bacteria 118528
236 Ga0395901_0001055 3300038443 Bacteria 29665
237 Ga0395901_0077622 3300038443 Bacteria 3466
238 Ga0242420_001097 3300038996 Bacteria 3461
239 Ga0436363_0283447 3300039450 Bacteria 5216
240 Ga0439439_0002360 3300041406 Bacteria 3997
241 Ga0439448_0000646 3300042005 Bacteria 8254
242 Ga0439449_0016445 3300042007 Bacteria 2780
243 Ga0439449_0058914 3300042007 Bacteria 1418
244 Ga0439449_0077367 3300042007 Bacteria 1227
245 Ga0439455_0002698 3300042012 Bacteria 3276
246 Ga0439455_0033108 3300042012 Bacteria 1295
247 Ga0450898_001528 3300042134 Bacteria 3071
248 Ga0450898_009105 3300042134 Bacteria 1581
249 Ga0439458_0005842 3300042157 Bacteria 2757
250 Ga0466969_0000978 3300044656 Bacteria 15403
251 Ga0466969_0013595 3300044656 Bacteria 4286
252 Ga0466972_0000657 3300044658 Bacteria 16677
253 Ga0466972_0061160 3300044658 Bacteria 1806
254 Ga0453683_0231676 3300044673 Bacteria 1176
255 Ga0466965_0004262 3300044683 Bacteria 6360
256 Ga0466965_0005611 3300044683 Bacteria 5661
257 Ga0466965_0096761 3300044683 Bacteria 1506
258 Ga0466966_0011506 3300044684 Bacteria 5869
259 Ga0466966_0012604 3300044684 Bacteria 5604
260 Ga0466961_0004528 3300044693 Bacteria 8714
261 Ga0466961_0019736 3300044693 Bacteria 4337
262 Ga0466961_0124267 3300044693 Bacteria 1619
263 Ga0466964_0000327 3300044706 Bacteria 14173
264 Ga0466964_0030434 3300044706 Bacteria 2136
265 Ga0453684_0000276 3300044712 Bacteria 222326
266 Ga0466971_0060750 3300044719 Bacteria 1708
267 Ga0466968_0102533 3300044735 Bacteria 1279
268 Ga0466957_0000007 3300044842 Bacteria 84513
269 Ga0466959_0003388 3300045049 Bacteria 10416
270 Ga0466959_0004938 3300045049 Bacteria 9034
271 Ga0451576_0002097 3300045051 Bacteria 31079
272 Ga0466967_0008718 3300045976 Bacteria 7467
273 Ga0466967_0087736 3300045976 Bacteria 2821
274 Ga0495580_0001312 3300046472 Bacteria 21969
275 Ga0495580_0017904 3300046472 Bacteria 5284
276 Ga0495580_0225744 3300046472 Bacteria 1286
277 Ga0495584_0000097 3300046491 Bacteria 59505
278 Ga0495584_0014823 3300046491 Bacteria 3972
279 Ga0495594_0050931 3300046499 Bacteria 2278
280 Ga0495607_0000524 3300046501 Bacteria 37754
281 Ga0495606_0007078 3300046507 Bacteria 10145
282 Ga0495616_0001262 3300046513 Bacteria 17783
283 Ga0495618_0175986 3300046514 Bacteria 1361
284 Ga0495630_0135352 3300046517 Bacteria 1872
285 Ga0495632_0009885 3300046519 Bacteria 5703
286 Ga0495666_0044759 3300046526 Bacteria 2136
287 Ga0495642_0000065 3300046528 Bacteria 63401
288 Ga0495609_0000030 3300046538 Bacteria 215885
289 Ga0495645_0021148 3300046543 Bacteria 4703
290 Ga0495656_0010492 3300046615 Bacteria 3370
291 Ga0495634_0114201 3300046642 Bacteria 1734
292 Ga0495625_0018491 3300046660 Bacteria 5440
293 Ga0495661_0000209 3300046665 Bacteria 67580
294 Ga0495588_0000078 3300046674 Bacteria 214254
295 Ga0495658_0025106 3300046683 Bacteria 3183
296 Ga0495658_0043420 3300046683 Bacteria 2515
297 Ga0495649_0003047 3300046694 Bacteria 11496
298 Ga0495589_0000021 3300046794 Bacteria 197941
299 Ga0495660_0120710 3300046810 Bacteria 1326
300 Ga0495674_0055205 3300047319 Bacteria 3485
301 Ga0495674_0056790 3300047319 Bacteria 3427
302 Ga0495676_0145182 3300047321 Bacteria 1696
303 Ga0495687_000276 3300047443 Bacteria 67876
304 Ga0495687_000319 3300047443 Bacteria 62530
305 Ga0495687_000327 3300047443 Bacteria 61677
306 Ga0495687_000615 3300047443 Bacteria 41337
307 Ga0495687_005459 3300047443 Bacteria 8097
308 Ga0495677_0000050 3300047445 Bacteria 67980
309 Ga0496101_0024481 3300048904 Bacteria 4179
310 Ga0496102_0000598 3300048905 Bacteria 37839
311 Ga0496102_0010261 3300048905 Bacteria 8053
312 Ga0496102_0014970 3300048905 Bacteria 6751
313 Ga0496102_0274197 3300048905 Bacteria 1590
314 Ga0496102_0368315 3300048905 Bacteria 1352
315 Ga0496103_0036884 3300048906 Bacteria 2995
316 Ga0496104_0001146 3300048907 Bacteria 22682
317 Ga0496104_0014907 3300048907 Bacteria 7028
318 Ga0496104_0155736 3300048907 Bacteria 2192
319 Ga0496105_0086968 3300048908 Bacteria 2583
320 Ga0496106_0001474 3300048909 Bacteria 17684
321 Ga0496106_0006465 3300048909 Bacteria 8680
322 Ga0496106_0097510 3300048909 Bacteria 2276
323 Ga0496107_0032332 3300048910 Bacteria 3739
324 Ga0496107_0132853 3300048910 Bacteria 1838
325 Ga0496108_0001195 3300048911 Bacteria 20324
326 Ga0496108_0076438 3300048911 Bacteria 2830
327 Ga0496108_0324367 3300048911 Bacteria 1342
328 Ga0496109_0023070 3300048912 Bacteria 5519
329 Ga0496109_0034013 3300048912 Bacteria 4587
330 Ga0496109_0242203 3300048912 Bacteria 1697
331 Ga0496110_0006030 3300048913 Bacteria 9546
332 Ga0496110_0026898 3300048913 Bacteria 4927
333 Ga0496111_0002920 3300048914 Bacteria 10447
334 Ga0496112_0002488 3300048915 Bacteria 14875
335 Ga0496112_0070724 3300048915 Bacteria 3448
336 Ga0496112_0178625 3300048915 Bacteria 2086
337 Ga0496113_0000701 3300048916 Bacteria 17130
338 Ga0496113_0003376 3300048916 Bacteria 9544
339 Ga0496113_0007063 3300048916 Bacteria 7187
340 Ga0496115_0043004 3300048918 Bacteria 3601
341 Ga0496115_0226025 3300048918 Bacteria 1544
342 Ga0496116_0000107 3300048919 Bacteria 188067
343 Ga0496117_0000038 3300048920 Bacteria 322781
344 Ga0496118_0000019 3300048921 Bacteria 489649
345 Ga0496120_0061782 3300048923 Bacteria 2089
346 Ga0496121_0000260 3300048924 Bacteria 110424
347 Ga0496121_0004923 3300048924 Bacteria 17526
348 Ga0496121_0010378 3300048924 Bacteria 10518
349 Ga0496122_0002607 3300048925 Bacteria 25253
350 Ga0496124_0008573 3300048927 Bacteria 10667
351 Ga0496124_0009546 3300048927 Bacteria 9974
352 Ga0496125_0120253 3300048928 Bacteria 1875
353 Ga0496126_0001190 3300048929 Bacteria 42445
354 Ga0496126_0001621 3300048929 Bacteria 34028
355 Ga0501300_003011 3300049523 Bacteria 2516
356 Ga0501033_0065261 3300049570 Bacteria 2678
357 Ga0501034_0002147 3300049571 Bacteria 24490
358 Ga0501036_0084140 3300049572 Bacteria 2690
359 Ga0501038_0159855 3300049574 Bacteria 1831
360 Ga0501039_0029298 3300049575 Bacteria 4239
361 Ga0501040_0012256 3300049576 Bacteria 5616
362 Ga0501041_0027669 3300049577 Bacteria 3417
363 Ga0501041_0027967 3300049577 Bacteria 3401
364 Ga0501047_0085092 3300049581 Bacteria 3038
365 Ga0501067_0001949 3300049583 Bacteria 11364
366 Ga0501067_0031689 3300049583 Bacteria 2933
367 Ga0501067_0039952 3300049583 Bacteria 2605
368 Ga0501067_0075973 3300049583 Bacteria 1861
369 Ga0501068_0000282 3300049584 Bacteria 25222
370 Ga0501068_0002719 3300049584 Bacteria 9382
371 Ga0501069_0000249 3300049585 Bacteria 24317
372 Ga0501069_0003100 3300049585 Bacteria 8520
373 Ga0501069_0016452 3300049585 Bacteria 3974
374 Ga0501069_0066238 3300049585 Bacteria 2020
375 Ga0501070_0007323 3300049586 Bacteria 9372
376 Ga0501070_0009089 3300049586 Bacteria 8404
377 Ga0501070_0030297 3300049586 Bacteria 4533
378 Ga0501070_0112289 3300049586 Bacteria 2252
379 Ga0501071_0003950 3300049587 Bacteria 9351
380 Ga0501071_0004594 3300049587 Bacteria 8755
381 Ga0501072_0000197 3300049588 Bacteria 44108
382 Ga0501072_0105448 3300049588 Bacteria 2241
383 Ga0501072_0140137 3300049588 Bacteria 1928
384 Ga0501073_0006478 3300049589 Bacteria 8710
385 Ga0501073_0007528 3300049589 Bacteria 8085
386 Ga0501074_0001562 3300049590 Bacteria 15490
387 Ga0501074_0002319 3300049590 Bacteria 13245
388 Ga0501074_0098589 3300049590 Bacteria 2092
389 Ga0501075_0050040 3300049591 Bacteria 3141
390 Ga0501076_0067872 3300049592 Bacteria 2848
391 Ga0501077_0002017 3300049593 Bacteria 12264
392 Ga0501206_003424 3300049653 Bacteria 2015
393 Ga0501209_006305 3300049656 Unclassified 2205
394 Ga0501216_001022 3300049660 Bacteria 3612
395 Ga0501235_006898 3300049669 Bacteria 2472
396 Ga0501239_000555 3300049672 Bacteria 2948
397 Ga0501249_012048 3300049679 Bacteria 1824
398 Ga0501080_0001113 3300049742 Bacteria 22136
399 Ga0501080_0016734 3300049742 Bacteria 6771
400 Ga0501080_0160701 3300049742 Bacteria 2075
401 Ga0501081_0259725 3300049743 Bacteria 1269
402 Ga0501083_0000798 3300049744 Bacteria 20654
403 Ga0501083_0001548 3300049744 Bacteria 15725
404 Ga0501273_000907 3300049770 Bacteria 2618
405 Ga0501035_0002683 3300049822 Bacteria 17321
406 Ga0501035_0064784 3300049822 Bacteria 3247
407 Ga0501044_0275205 3300049823 Bacteria 1618
408 Ga0501045_0025290 3300049824 Bacteria 4267
409 Ga0501045_0034223 3300049824 Bacteria 3687
410 nmdc:mga0k408_21245_c1 3300050493 Bacteria 3645
411 nmdc:mga0k408_59675_c1 3300050493 Bacteria 2217
412 nmdc:mga04h51_14953_c1 3300050495 Bacteria 2228
413 nmdc:mga07m45_3882_c1 3300050496 Bacteria 7255
414 nmdc:mga05p37_3119_c1 3300050507 Bacteria 19270
415 nmdc:mga05p37_437323_c1 3300050507 Bacteria 1518
416 nmdc:mga09592_49579_c1 3300050508 Bacteria 3540
417 nmdc:mga0qj67_64914_c1 3300050509 Bacteria 2905
418 nmdc:mga06r32_2236_c1 3300050510 Bacteria 17323
419 nmdc:mga06r32_297118_c1 3300050510 Bacteria 1601
420 nmdc:mga06r32_42639_c1 3300050510 Bacteria 4316
421 nmdc:mga06r32_499419_c1 3300050510 Bacteria 1193
422 nmdc:mga06r32_55518_c1 3300050510 Bacteria 3799
423 nmdc:mga08y16_12154_c1 3300050511 Bacteria 9049
424 nmdc:mga08y16_2466_c1 3300050511 Bacteria 18996
425 nmdc:mga08y16_95033_c1 3300050511 Bacteria 3105
426 nmdc:mga0rr50_56247_c1 3300050513 Bacteria 2938
427 nmdc:mga0a205_134981_c1 3300050515 Bacteria 2368
428 Ga0500658_0000949 3300053134 Bacteria 11845
429 Ga0501084_0002833 3300054114 Bacteria 13995
430 Ga0501084_0002944 3300054114 Bacteria 13788
431 Ga0501084_0197222 3300054114 Bacteria 1698
432 Ga0590071_001243 3300059421 Bacteria 6884
433 Ga0590071_002564 3300059421 Bacteria 4573
434 Ga0590075_014398 3300059424 Bacteria 1933
435 Ga0590077_005273 3300059426 Bacteria 2648
436 Ga0501082_0003671 3300060353 Bacteria 13412
437 Ga0501082_0007888 3300060353 Bacteria 9191

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100000452 Ga0075428_10000045214 335
2 3300009094 Ga0111539_10020138 Ga0111539_100201383 335
3 3300027907 Ga0207428_10182995 Ga0207428_101829951 335
4 3300050511 nmdc:mga08y16_12154_c1 nmdc:mga08y16_12154_c1_5898_6959 335
5 3300005355 Ga0070671_100009821 Ga0070671_1000098216 341
6 iso_pu_bacteria 2857453340 2857459126 341
7 iso_pu_bacteria 2643221585 2643937391 348
8 iso_pu_bacteria 2643221656 2644318556 348
9 3300005335 Ga0070666_10145169 Ga0070666_101451691 349
10 3300005347 Ga0070668_100238701 Ga0070668_1002387011 349
11 3300005457 Ga0070662_100035429 Ga0070662_1000354292 349
12 3300006048 Ga0075363_100107349 Ga0075363_1001073492 349
13 3300006178 Ga0075367_10042578 Ga0075367_100425782 349
14 3300006178 Ga0075367_10157437 Ga0075367_101574372 349
15 3300006195 Ga0075366_10001435 Ga0075366_1000143513 349
16 3300006353 Ga0075370_10000365 Ga0075370_1000036516 349
17 3300006353 Ga0075370_10041710 Ga0075370_100417102 349
18 3300009093 Ga0105240_10117892 Ga0105240_101178922 349
19 3300009098 Ga0105245_10317965 Ga0105245_103179652 349
20 3300009176 Ga0105242_10264246 Ga0105242_102642462 349
21 3300009545 Ga0105237_10142843 Ga0105237_101428432 349
22 3300010375 Ga0105239_10126573 Ga0105239_101265733 349
23 3300025933 Ga0207706_10083464 Ga0207706_100834642 349
24 3300025933 Ga0207706_10179891 Ga0207706_101798912 349
25 3300025942 Ga0207689_10175877 Ga0207689_101758772 349
26 3300025972 Ga0207668_10310460 Ga0207668_103104602 349
27 3300026089 Ga0207648_10058138 Ga0207648_100581382 349
28 3300026116 Ga0207674_10012557 Ga0207674_100125572 349
29 3300028786 Ga0307517_10153888 Ga0307517_101538882 349
30 3300028794 Ga0307515_10154515 Ga0307515_101545152 349
31 3300031456 Ga0307513_10050202 Ga0307513_100502022 349
32 3300031730 Ga0307516_10175646 Ga0307516_101756463 349
33 3300037471 Ga0395905_0085447 Ga0395905_0085447_334_1392 349
34 3300042007 Ga0439449_0058914 Ga0439449_0058914_70_1128 349
35 3300042007 Ga0439449_0077367 Ga0439449_0077367_159_1217 349
36 3300042134 Ga0450898_001528 Ga0450898_001528_704_1762 349
37 3300046519 Ga0495632_0009885 Ga0495632_0009885_192_1250 349
38 3300046694 Ga0495649_0003047 Ga0495649_0003047_7942_9000 349
39 3300046810 Ga0495660_0120710 Ga0495660_0120710_58_1116 349
40 3300047443 Ga0495687_000327 Ga0495687_000327_50501_51559 349
41 3300047443 Ga0495687_000615 Ga0495687_000615_3165_4223 349
42 3300047443 Ga0495687_005459 Ga0495687_005459_3522_4580 349
43 3300050493 nmdc:mga0k408_21245_c1 nmdc:mga0k408_21245_c1_1950_3008 349
44 3300050493 nmdc:mga0k408_59675_c1 nmdc:mga0k408_59675_c1_85_1143 349
45 3300050495 nmdc:mga04h51_14953_c1 nmdc:mga04h51_14953_c1_75_1133 349
46 3300050496 nmdc:mga07m45_3882_c1 nmdc:mga07m45_3882_c1_3959_5017 349
47 3300053134 Ga0500658_0000949 Ga0500658_0000949_10463_11521 349
48 3300005548 Ga0070665_100052949 Ga0070665_1000529494 350
49 3300044656 Ga0466969_0000978 Ga0466969_0000978_9561_10613 350
50 3300044683 Ga0466965_0004262 Ga0466965_0004262_4939_5991 350
51 3300044684 Ga0466966_0012604 Ga0466966_0012604_3115_4167 350
52 3300044693 Ga0466961_0004528 Ga0466961_0004528_6313_7365 350
53 3300044712 Ga0453684_0000276 Ga0453684_0000276_136286_137338 350
54 3300045049 Ga0466959_0003388 Ga0466959_0003388_7676_8728 350
55 3300045051 Ga0451576_0002097 Ga0451576_0002097_8201_9253 350
56 3300048905 Ga0496102_0014970 Ga0496102_0014970_1611_2663 350
57 3300048920 Ga0496117_0000038 Ga0496117_0000038_314494_315546 350
58 3300048921 Ga0496118_0000019 Ga0496118_0000019_413112_414164 350
59 3300048923 Ga0496120_0061782 Ga0496120_0061782_646_1698 350
60 3300048927 Ga0496124_0008573 Ga0496124_0008573_7889_8941 350
61 3300048929 Ga0496126_0001190 Ga0496126_0001190_12691_13743 350
62 3300005468 Ga0070707_100014812 Ga0070707_1000148126 351
63 3300005518 Ga0070699_100000036 Ga0070699_10000003615 351
64 3300014968 Ga0157379_10245737 Ga0157379_102457372 351
65 3300025922 Ga0207646_10192972 Ga0207646_101929722 351
66 3300046472 Ga0495580_0225744 Ga0495580_0225744_181_1239 351
67 3300046499 Ga0495594_0050931 Ga0495594_0050931_1132_2190 351
68 3300046517 Ga0495630_0135352 Ga0495630_0135352_414_1472 351
69 3300046526 Ga0495666_0044759 Ga0495666_0044759_1064_2122 351
70 3300046642 Ga0495634_0114201 Ga0495634_0114201_556_1614 351
71 3300046683 Ga0495658_0043420 Ga0495658_0043420_1012_2070 351
72 3300047319 Ga0495674_0055205 Ga0495674_0055205_1467_2525 351
73 3300047321 Ga0495676_0145182 Ga0495676_0145182_32_1090 351
74 3300048919 Ga0496116_0000107 Ga0496116_0000107_126788_127843 351
75 3300048924 Ga0496121_0000260 Ga0496121_0000260_49095_50150 351
76 3300005262 Ga0065165_1000691 Ga0065165_10006918 352
77 3300028379 Ga0268266_10008344 Ga0268266_100083449 352
78 3300049577 Ga0501041_0027669 Ga0501041_0027669_2160_3218 352
79 3300049824 Ga0501045_0025290 Ga0501045_0025290_171_1229 352
80 3300002704 JGI25155J39150_1000028 JGI25155J39150_100002830 353
81 3300002705 JGI25156J39149_1000013 JGI25156J39149_100001383 353
82 3300002738 JGI25154J39366_1000032 JGI25154J39366_100003283 353
83 3300002741 JGI25157J39369_1000017 JGI25157J39369_100001783 353
84 3300003187 JGI25151J46595_10001607 JGI25151J46595_100016075 353
85 3300003759 Ga0055525_1000047 Ga0055525_100004737 353
86 3300005327 Ga0070658_10006880 Ga0070658_100068808 353
87 3300005327 Ga0070658_10011248 Ga0070658_100112486 353
88 3300005327 Ga0070658_10044477 Ga0070658_100444773 353
89 3300005329 Ga0070683_100068801 Ga0070683_1000688012 353
90 3300005338 Ga0068868_100016415 Ga0068868_1000164153 353
91 3300005339 Ga0070660_100004993 Ga0070660_1000049932 353
92 3300005339 Ga0070660_100005123 Ga0070660_1000051235 353
93 3300005339 Ga0070660_100046983 Ga0070660_1000469833 353
94 3300005365 Ga0070688_100083551 Ga0070688_1000835512 353
95 3300005435 Ga0070714_100100274 Ga0070714_1001002743 353
96 3300005440 Ga0070705_100027109 Ga0070705_1000271092 353
97 3300005444 Ga0070694_100108417 Ga0070694_1001084172 353
98 3300005445 Ga0070708_100056023 Ga0070708_1000560233 353
99 3300005455 Ga0070663_100028872 Ga0070663_1000288721 353
100 3300005457 Ga0070662_100075648 Ga0070662_1000756482 353
101 3300005466 Ga0070685_10015243 Ga0070685_100152434 353
102 3300005468 Ga0070707_100072947 Ga0070707_1000729474 353
103 3300005468 Ga0070707_100284571 Ga0070707_1002845711 353
104 3300005518 Ga0070699_100011473 Ga0070699_1000114735 353
105 3300005518 Ga0070699_100012146 Ga0070699_1000121465 353
106 3300005536 Ga0070697_100001922 Ga0070697_10000192214 353
107 3300005536 Ga0070697_100214910 Ga0070697_1002149101 353
108 3300005546 Ga0070696_100001123 Ga0070696_1000011232 353
109 3300005546 Ga0070696_100022549 Ga0070696_1000225494 353
110 3300005547 Ga0070693_100067630 Ga0070693_1000676302 353
111 3300005563 Ga0068855_100004247 Ga0068855_1000042478 353
112 3300005563 Ga0068855_100023796 Ga0068855_1000237965 353
113 3300005563 Ga0068855_100101134 Ga0068855_1001011342 353
114 3300005563 Ga0068855_100153703 Ga0068855_1001537032 353
115 3300005564 Ga0070664_100042719 Ga0070664_1000427194 353
116 3300005564 Ga0070664_100123244 Ga0070664_1001232442 353
117 3300005578 Ga0068854_100000860 Ga0068854_10000086014 353
118 3300005614 Ga0068856_100008649 Ga0068856_1000086497 353
119 3300005618 Ga0068864_100177414 Ga0068864_1001774142 353
120 3300005842 Ga0068858_100009795 Ga0068858_1000097957 353
121 3300005937 Ga0081455_10083914 Ga0081455_100839143 353
122 3300006048 Ga0075363_100048578 Ga0075363_1000485782 353
123 3300006173 Ga0070716_100003928 Ga0070716_1000039283 353
124 3300006175 Ga0070712_100006429 Ga0070712_1000064292 353
125 3300006177 Ga0075362_10001998 Ga0075362_100019986 353
126 3300006237 Ga0097621_100025588 Ga0097621_1000255883 353
127 3300006358 Ga0068871_100045854 Ga0068871_1000458542 353
128 3300006844 Ga0075428_100064717 Ga0075428_1000647173 353
129 3300006846 Ga0075430_100002016 Ga0075430_10000201614 353
130 3300006846 Ga0075430_100048693 Ga0075430_1000486932 353
131 3300006846 Ga0075430_100089790 Ga0075430_1000897901 353
132 3300006847 Ga0075431_100000364 Ga0075431_10000036421 353
133 3300006847 Ga0075431_100002500 Ga0075431_10000250018 353
134 3300006847 Ga0075431_100029231 Ga0075431_1000292313 353
135 3300006852 Ga0075433_10014025 Ga0075433_100140252 353
136 3300006880 Ga0075429_100023304 Ga0075429_1000233044 353
137 3300006880 Ga0075429_100118927 Ga0075429_1001189272 353
138 3300006931 Ga0097620_100178620 Ga0097620_1001786202 353
139 3300009093 Ga0105240_10002013 Ga0105240_1000201310 353
140 3300009093 Ga0105240_10015675 Ga0105240_100156752 353
141 3300009093 Ga0105240_10023342 Ga0105240_100233423 353
142 3300009093 Ga0105240_10080289 Ga0105240_100802892 353
143 3300009094 Ga0111539_10011937 Ga0111539_100119379 353
144 3300009094 Ga0111539_10018275 Ga0111539_100182754 353
145 3300009147 Ga0114129_10004357 Ga0114129_1000435717 353
146 3300009147 Ga0114129_10255073 Ga0114129_102550732 353
147 3300009147 Ga0114129_10311021 Ga0114129_103110212 353
148 3300009174 Ga0105241_10002118 Ga0105241_1000211814 353
149 3300009174 Ga0105241_10085829 Ga0105241_100858293 353
150 3300009176 Ga0105242_10001278 Ga0105242_1000127814 353
151 3300009176 Ga0105242_10004433 Ga0105242_100044338 353
152 3300009176 Ga0105242_10069382 Ga0105242_100693822 353
153 3300009177 Ga0105248_10015852 Ga0105248_100158524 353
154 3300009551 Ga0105238_10331850 Ga0105238_103318502 353
155 3300009553 Ga0105249_10124581 Ga0105249_101245812 353
156 3300010375 Ga0105239_10037783 Ga0105239_100377832 353
157 3300013102 Ga0157371_10002796 Ga0157371_1000279613 353
158 3300013104 Ga0157370_10005186 Ga0157370_100051863 353
159 3300013104 Ga0157370_10005893 Ga0157370_1000589312 353
160 3300013104 Ga0157370_10018950 Ga0157370_100189503 353
161 3300013105 Ga0157369_10004352 Ga0157369_100043522 353
162 3300013296 Ga0157374_10006650 Ga0157374_100066507 353
163 3300013297 Ga0157378_10003575 Ga0157378_100035756 353
164 3300013307 Ga0157372_10139159 Ga0157372_101391593 353
165 3300013308 Ga0157375_10029392 Ga0157375_100293925 353
166 3300014325 Ga0163163_10135713 Ga0163163_101357132 353
167 3300025206 Ga0209435_100003 Ga0209435_10000388 353
168 3300025230 Ga0209563_100003 Ga0209563_100003567 353
169 3300025245 Ga0207425_1001030 Ga0207425_10010304 353
170 3300025246 Ga0209646_1000008 Ga0209646_100000888 353
171 3300025250 Ga0209026_1000007 Ga0209026_100000788 353
172 3300025254 Ga0209148_1002087 Ga0209148_10020873 353
173 3300025256 Ga0209759_1000026 Ga0209759_1000026191 353
174 3300025263 Ga0209565_1000758 Ga0209565_100075816 353
175 3300025291 Ga0209675_1001795 Ga0209675_10017957 353
176 3300025294 Ga0209025_1001036 Ga0209025_100103615 353
177 3300025299 Ga0209256_1017522 Ga0209256_10175222 353
178 3300025903 Ga0207680_10047440 Ga0207680_100474403 353
179 3300025907 Ga0207645_10232011 Ga0207645_102320111 353
180 3300025908 Ga0207643_10171287 Ga0207643_101712872 353
181 3300025909 Ga0207705_10000640 Ga0207705_1000064014 353
182 3300025909 Ga0207705_10002230 Ga0207705_1000223013 353
183 3300025909 Ga0207705_10030677 Ga0207705_100306771 353
184 3300025910 Ga0207684_10077709 Ga0207684_100777092 353
185 3300025912 Ga0207707_10142589 Ga0207707_101425892 353
186 3300025913 Ga0207695_10002190 Ga0207695_1000219010 353
187 3300025913 Ga0207695_10005662 Ga0207695_100056624 353
188 3300025913 Ga0207695_10020685 Ga0207695_100206856 353
189 3300025913 Ga0207695_10035180 Ga0207695_100351803 353
190 3300025913 Ga0207695_10237645 Ga0207695_102376452 353
191 3300025913 Ga0207695_10263640 Ga0207695_102636402 353
192 3300025919 Ga0207657_10000973 Ga0207657_1000097326 353
193 3300025919 Ga0207657_10008871 Ga0207657_100088717 353
194 3300025919 Ga0207657_10018985 Ga0207657_100189854 353
195 3300025922 Ga0207646_10036376 Ga0207646_100363761 353
196 3300025922 Ga0207646_10068247 Ga0207646_100682472 353
197 3300025922 Ga0207646_10099992 Ga0207646_100999922 353
198 3300025927 Ga0207687_10129006 Ga0207687_101290062 353
199 3300025928 Ga0207700_10022999 Ga0207700_100229993 353
200 3300025929 Ga0207664_10175542 Ga0207664_101755422 353
201 3300025931 Ga0207644_10004083 Ga0207644_100040836 353
202 3300025932 Ga0207690_10016606 Ga0207690_100166064 353
203 3300025933 Ga0207706_10088114 Ga0207706_100881143 353
204 3300025933 Ga0207706_10203966 Ga0207706_102039661 353
205 3300025934 Ga0207686_10047029 Ga0207686_100470293 353
206 3300025936 Ga0207670_10004820 Ga0207670_100048207 353
207 3300025938 Ga0207704_10135472 Ga0207704_101354722 353
208 3300025939 Ga0207665_10001989 Ga0207665_100019895 353
209 3300025945 Ga0207679_10136506 Ga0207679_101365062 353
210 3300025949 Ga0207667_10003719 Ga0207667_100037196 353
211 3300025949 Ga0207667_10028093 Ga0207667_100280933 353
212 3300025949 Ga0207667_10091215 Ga0207667_100912153 353
213 3300025960 Ga0207651_10010742 Ga0207651_100107424 353
214 3300025981 Ga0207640_10004526 Ga0207640_100045264 353
215 3300026023 Ga0207677_10020308 Ga0207677_100203084 353
216 3300026067 Ga0207678_10006453 Ga0207678_1000645310 353
217 3300026067 Ga0207678_10008719 Ga0207678_100087195 353
218 3300026078 Ga0207702_10060165 Ga0207702_100601652 353
219 3300026078 Ga0207702_10400535 Ga0207702_104005351 353
220 3300026088 Ga0207641_10067181 Ga0207641_100671814 353
221 3300026088 Ga0207641_10138204 Ga0207641_101382042 353
222 3300026089 Ga0207648_10074014 Ga0207648_100740143 353
223 3300026095 Ga0207676_10010440 Ga0207676_100104402 353
224 3300026095 Ga0207676_10080617 Ga0207676_100806172 353
225 3300026121 Ga0207683_10009611 Ga0207683_100096112 353
226 3300027876 Ga0209974_10021171 Ga0209974_100211711 353
227 3300027907 Ga0207428_10115080 Ga0207428_101150802 353
228 3300031548 Ga0307408_100024658 Ga0307408_1000246582 353
229 3300031731 Ga0307405_10125236 Ga0307405_101252362 353
230 3300031824 Ga0307413_10013140 Ga0307413_100131403 353
231 3300031824 Ga0307413_10014619 Ga0307413_100146192 353
232 3300031824 Ga0307413_10051933 Ga0307413_100519331 353
233 3300031824 Ga0307413_10064047 Ga0307413_100640472 353
234 3300031852 Ga0307410_10000629 Ga0307410_100006297 353
235 3300031852 Ga0307410_10012904 Ga0307410_100129042 353
236 3300031852 Ga0307410_10016990 Ga0307410_100169902 353
237 3300031852 Ga0307410_10028879 Ga0307410_100288792 353
238 3300031852 Ga0307410_10096515 Ga0307410_100965151 353
239 3300031852 Ga0307410_10181562 Ga0307410_101815622 353
240 3300031901 Ga0307406_10018586 Ga0307406_100185862 353
241 3300031901 Ga0307406_10154078 Ga0307406_101540782 353
242 3300031903 Ga0307407_10047245 Ga0307407_100472452 353
243 3300031903 Ga0307407_10054817 Ga0307407_100548172 353
244 3300031903 Ga0307407_10076331 Ga0307407_100763312 353
245 3300031903 Ga0307407_10087141 Ga0307407_100871412 353
246 3300031903 Ga0307407_10201086 Ga0307407_102010861 353
247 3300031995 Ga0307409_100000080 Ga0307409_10000008019 353
248 3300031995 Ga0307409_100063236 Ga0307409_1000632362 353
249 3300032002 Ga0307416_100000433 Ga0307416_10000043313 353
250 3300032002 Ga0307416_100001388 Ga0307416_10000138812 353
251 3300032002 Ga0307416_100079432 Ga0307416_1000794322 353
252 3300032002 Ga0307416_100135136 Ga0307416_1001351362 353
253 3300032004 Ga0307414_10007884 Ga0307414_100078845 353
254 3300032004 Ga0307414_10019795 Ga0307414_100197952 353
255 3300032005 Ga0307411_10000388 Ga0307411_100003886 353
256 3300032005 Ga0307411_10004258 Ga0307411_100042582 353
257 3300032005 Ga0307411_10007269 Ga0307411_100072693 353
258 3300032005 Ga0307411_10135524 Ga0307411_101355242 353
259 3300032126 Ga0307415_100000280 Ga0307415_1000002805 353
260 3300032126 Ga0307415_100163467 Ga0307415_1001634672 353
261 3300035172 Ga0373955_0106534 Ga0373955_0106534_471_1532 353
262 3300035241 Ga0373961_0014655 Ga0373961_0014655_116_1177 353
263 3300037312 Ga0395899_0003829 Ga0395899_0003829_10385_11446 353
264 3300037312 Ga0395899_0020667 Ga0395899_0020667_1959_3020 353
265 3300037312 Ga0395899_0024721 Ga0395899_0024721_1646_2707 353
266 3300037312 Ga0395899_0033563 Ga0395899_0033563_2288_3349 353
267 3300037312 Ga0395899_0048119 Ga0395899_0048119_1079_2152 353
268 3300037312 Ga0395899_0127327 Ga0395899_0127327_501_1562 353
269 3300037418 Ga0395900_0000331 Ga0395900_0000331_28591_29652 353
270 3300037418 Ga0395900_0000763 Ga0395900_0000763_29881_30942 353
271 3300037418 Ga0395900_0003744 Ga0395900_0003744_8710_9783 353
272 3300037418 Ga0395900_0004504 Ga0395900_0004504_12349_13410 353
273 3300037418 Ga0395900_0063442 Ga0395900_0063442_864_1925 353
274 3300037418 Ga0395900_0131765 Ga0395900_0131765_650_1711 353
275 3300037466 Ga0395898_0085197 Ga0395898_0085197_1437_2510 353
276 3300037471 Ga0395905_0004263 Ga0395905_0004263_6646_7719 353
277 3300038443 Ga0395901_0000003 Ga0395901_0000003_295834_296895 353
278 3300038443 Ga0395901_0000097 Ga0395901_0000097_62267_63328 353
279 3300038443 Ga0395901_0001055 Ga0395901_0001055_9293_10366 353
280 3300038443 Ga0395901_0077622 Ga0395901_0077622_2001_3062 353
281 3300038996 Ga0242420_001097 Ga0242420_001097_1350_2411 353
282 3300039450 Ga0436363_0283447 Ga0436363_0283447_3934_4995 353
283 3300041406 Ga0439439_0002360 Ga0439439_0002360_1089_2150 353
284 3300042005 Ga0439448_0000646 Ga0439448_0000646_3919_4980 353
285 3300042007 Ga0439449_0016445 Ga0439449_0016445_1498_2559 353
286 3300042012 Ga0439455_0002698 Ga0439455_0002698_1706_2767 353
287 3300042012 Ga0439455_0033108 Ga0439455_0033108_112_1179 353
288 3300042134 Ga0450898_009105 Ga0450898_009105_491_1552 353
289 3300042157 Ga0439458_0005842 Ga0439458_0005842_833_1894 353
290 3300044656 Ga0466969_0013595 Ga0466969_0013595_3213_4274 353
291 3300044658 Ga0466972_0000657 Ga0466972_0000657_13392_14453 353
292 3300044658 Ga0466972_0061160 Ga0466972_0061160_621_1682 353
293 3300044673 Ga0453683_0231676 Ga0453683_0231676_99_1160 353
294 3300044683 Ga0466965_0005611 Ga0466965_0005611_2474_3535 353
295 3300044683 Ga0466965_0096761 Ga0466965_0096761_313_1374 353
296 3300044684 Ga0466966_0011506 Ga0466966_0011506_3292_4353 353
297 3300044693 Ga0466961_0019736 Ga0466961_0019736_134_1195 353
298 3300044693 Ga0466961_0124267 Ga0466961_0124267_78_1139 353
299 3300044706 Ga0466964_0000327 Ga0466964_0000327_6770_7831 353
300 3300044706 Ga0466964_0030434 Ga0466964_0030434_784_1845 353
301 3300044719 Ga0466971_0060750 Ga0466971_0060750_515_1576 353
302 3300044735 Ga0466968_0102533 Ga0466968_0102533_84_1145 353
303 3300044842 Ga0466957_0000007 Ga0466957_0000007_52224_53285 353
304 3300045049 Ga0466959_0004938 Ga0466959_0004938_7896_8957 353
305 3300045976 Ga0466967_0008718 Ga0466967_0008718_4689_5750 353
306 3300045976 Ga0466967_0087736 Ga0466967_0087736_1731_2792 353
307 3300046472 Ga0495580_0001312 Ga0495580_0001312_2447_3508 353
308 3300046472 Ga0495580_0017904 Ga0495580_0017904_573_1634 353
309 3300046491 Ga0495584_0000097 Ga0495584_0000097_27356_28417 353
310 3300046491 Ga0495584_0014823 Ga0495584_0014823_780_1841 353
311 3300046501 Ga0495607_0000524 Ga0495607_0000524_31703_32764 353
312 3300046507 Ga0495606_0007078 Ga0495606_0007078_2670_3731 353
313 3300046513 Ga0495616_0001262 Ga0495616_0001262_5802_6863 353
314 3300046514 Ga0495618_0175986 Ga0495618_0175986_262_1323 353
315 3300046528 Ga0495642_0000065 Ga0495642_0000065_37054_38115 353
316 3300046538 Ga0495609_0000030 Ga0495609_0000030_126098_127159 353
317 3300046543 Ga0495645_0021148 Ga0495645_0021148_1529_2590 353
318 3300046615 Ga0495656_0010492 Ga0495656_0010492_273_1334 353
319 3300046660 Ga0495625_0018491 Ga0495625_0018491_2339_3400 353
320 3300046665 Ga0495661_0000209 Ga0495661_0000209_34959_36020 353
321 3300046674 Ga0495588_0000078 Ga0495588_0000078_186_1247 353
322 3300046683 Ga0495658_0025106 Ga0495658_0025106_175_1236 353
323 3300046794 Ga0495589_0000021 Ga0495589_0000021_126398_127459 353
324 3300047319 Ga0495674_0056790 Ga0495674_0056790_822_1883 353
325 3300047443 Ga0495687_000276 Ga0495687_000276_31773_32834 353
326 3300047443 Ga0495687_000319 Ga0495687_000319_35792_36853 353
327 3300047445 Ga0495677_0000050 Ga0495677_0000050_35350_36411 353
328 3300048904 Ga0496101_0024481 Ga0496101_0024481_2510_3571 353
329 3300048905 Ga0496102_0000598 Ga0496102_0000598_24148_25209 353
330 3300048905 Ga0496102_0010261 Ga0496102_0010261_1956_3017 353
331 3300048905 Ga0496102_0274197 Ga0496102_0274197_70_1131 353
332 3300048905 Ga0496102_0368315 Ga0496102_0368315_180_1241 353
333 3300048906 Ga0496103_0036884 Ga0496103_0036884_1362_2423 353
334 3300048907 Ga0496104_0001146 Ga0496104_0001146_9856_10917 353
335 3300048907 Ga0496104_0014907 Ga0496104_0014907_1481_2542 353
336 3300048907 Ga0496104_0155736 Ga0496104_0155736_132_1193 353
337 3300048908 Ga0496105_0086968 Ga0496105_0086968_682_1743 353
338 3300048909 Ga0496106_0001474 Ga0496106_0001474_12031_13092 353
339 3300048909 Ga0496106_0006465 Ga0496106_0006465_380_1441 353
340 3300048909 Ga0496106_0097510 Ga0496106_0097510_848_1909 353
341 3300048910 Ga0496107_0032332 Ga0496107_0032332_326_1387 353
342 3300048910 Ga0496107_0132853 Ga0496107_0132853_183_1244 353
343 3300048911 Ga0496108_0001195 Ga0496108_0001195_2928_3989 353
344 3300048911 Ga0496108_0076438 Ga0496108_0076438_191_1252 353
345 3300048911 Ga0496108_0324367 Ga0496108_0324367_80_1141 353
346 3300048912 Ga0496109_0023070 Ga0496109_0023070_2258_3319 353
347 3300048912 Ga0496109_0034013 Ga0496109_0034013_2780_3841 353
348 3300048912 Ga0496109_0242203 Ga0496109_0242203_189_1250 353
349 3300048913 Ga0496110_0006030 Ga0496110_0006030_6545_7606 353
350 3300048913 Ga0496110_0026898 Ga0496110_0026898_2293_3354 353
351 3300048914 Ga0496111_0002920 Ga0496111_0002920_3495_4556 353
352 3300048915 Ga0496112_0002488 Ga0496112_0002488_11363_12424 353
353 3300048915 Ga0496112_0070724 Ga0496112_0070724_688_1749 353
354 3300048915 Ga0496112_0178625 Ga0496112_0178625_79_1140 353
355 3300048916 Ga0496113_0000701 Ga0496113_0000701_3251_4312 353
356 3300048916 Ga0496113_0003376 Ga0496113_0003376_1004_2065 353
357 3300048916 Ga0496113_0007063 Ga0496113_0007063_5370_6431 353
358 3300048918 Ga0496115_0043004 Ga0496115_0043004_132_1193 353
359 3300048918 Ga0496115_0226025 Ga0496115_0226025_192_1253 353
360 3300048924 Ga0496121_0004923 Ga0496121_0004923_4872_5933 353
361 3300048924 Ga0496121_0010378 Ga0496121_0010378_6757_7818 353
362 3300048925 Ga0496122_0002607 Ga0496122_0002607_17709_18770 353
363 3300048927 Ga0496124_0009546 Ga0496124_0009546_4008_5069 353
364 3300048928 Ga0496125_0120253 Ga0496125_0120253_232_1293 353
365 3300048929 Ga0496126_0001621 Ga0496126_0001621_18663_19724 353
366 3300049523 Ga0501300_003011 Ga0501300_003011_499_1560 353
367 3300049570 Ga0501033_0065261 Ga0501033_0065261_899_1960 353
368 3300049571 Ga0501034_0002147 Ga0501034_0002147_8744_9805 353
369 3300049572 Ga0501036_0084140 Ga0501036_0084140_475_1536 353
370 3300049574 Ga0501038_0159855 Ga0501038_0159855_286_1347 353
371 3300049575 Ga0501039_0029298 Ga0501039_0029298_557_1618 353
372 3300049576 Ga0501040_0012256 Ga0501040_0012256_1976_3037 353
373 3300049577 Ga0501041_0027967 Ga0501041_0027967_209_1270 353
374 3300049581 Ga0501047_0085092 Ga0501047_0085092_1278_2339 353
375 3300049583 Ga0501067_0001949 Ga0501067_0001949_8294_9355 353
376 3300049583 Ga0501067_0031689 Ga0501067_0031689_1195_2256 353
377 3300049583 Ga0501067_0039952 Ga0501067_0039952_504_1565 353
378 3300049583 Ga0501067_0075973 Ga0501067_0075973_394_1455 353
379 3300049584 Ga0501068_0000282 Ga0501068_0000282_6650_7711 353
380 3300049584 Ga0501068_0002719 Ga0501068_0002719_7276_8337 353
381 3300049585 Ga0501069_0000249 Ga0501069_0000249_11730_12791 353
382 3300049585 Ga0501069_0003100 Ga0501069_0003100_6274_7335 353
383 3300049585 Ga0501069_0016452 Ga0501069_0016452_2671_3732 353
384 3300049585 Ga0501069_0066238 Ga0501069_0066238_931_1992 353
385 3300049586 Ga0501070_0007323 Ga0501070_0007323_6514_7575 353
386 3300049586 Ga0501070_0009089 Ga0501070_0009089_827_1888 353
387 3300049586 Ga0501070_0030297 Ga0501070_0030297_1817_2878 353
388 3300049586 Ga0501070_0112289 Ga0501070_0112289_582_1643 353
389 3300049587 Ga0501071_0003950 Ga0501071_0003950_7204_8265 353
390 3300049587 Ga0501071_0004594 Ga0501071_0004594_1091_2152 353
391 3300049588 Ga0501072_0000197 Ga0501072_0000197_36040_37101 353
392 3300049588 Ga0501072_0105448 Ga0501072_0105448_178_1239 353
393 3300049588 Ga0501072_0140137 Ga0501072_0140137_720_1781 353
394 3300049589 Ga0501073_0006478 Ga0501073_0006478_1161_2222 353
395 3300049589 Ga0501073_0007528 Ga0501073_0007528_656_1717 353
396 3300049590 Ga0501074_0001562 Ga0501074_0001562_118_1179 353
397 3300049590 Ga0501074_0002319 Ga0501074_0002319_6504_7565 353
398 3300049590 Ga0501074_0098589 Ga0501074_0098589_129_1190 353
399 3300049591 Ga0501075_0050040 Ga0501075_0050040_1383_2444 353
400 3300049592 Ga0501076_0067872 Ga0501076_0067872_1775_2836 353
401 3300049593 Ga0501077_0002017 Ga0501077_0002017_1988_3049 353
402 3300049653 Ga0501206_003424 Ga0501206_003424_612_1790 353
403 3300049656 Ga0501209_006305 Ga0501209_006305_983_2161 353
404 3300049660 Ga0501216_001022 Ga0501216_001022_531_1709 353
405 3300049669 Ga0501235_006898 Ga0501235_006898_262_1323 353
406 3300049672 Ga0501239_000555 Ga0501239_000555_1146_2324 353
407 3300049679 Ga0501249_012048 Ga0501249_012048_343_1404 353
408 3300049742 Ga0501080_0001113 Ga0501080_0001113_6517_7578 353
409 3300049742 Ga0501080_0016734 Ga0501080_0016734_638_1699 353
410 3300049742 Ga0501080_0160701 Ga0501080_0160701_84_1145 353
411 3300049743 Ga0501081_0259725 Ga0501081_0259725_96_1157 353
412 3300049744 Ga0501083_0000798 Ga0501083_0000798_8390_9451 353
413 3300049744 Ga0501083_0001548 Ga0501083_0001548_6381_7442 353
414 3300049770 Ga0501273_000907 Ga0501273_000907_138_1199 353
415 3300049822 Ga0501035_0002683 Ga0501035_0002683_12009_13070 353
416 3300049822 Ga0501035_0064784 Ga0501035_0064784_1474_2535 353
417 3300049823 Ga0501044_0275205 Ga0501044_0275205_89_1150 353
418 3300049824 Ga0501045_0034223 Ga0501045_0034223_2261_3322 353
419 3300050507 nmdc:mga05p37_3119_c1 nmdc:mga05p37_3119_c1_10968_12029 353
420 3300050507 nmdc:mga05p37_437323_c1 nmdc:mga05p37_437323_c1_306_1367 353
421 3300050508 nmdc:mga09592_49579_c1 nmdc:mga09592_49579_c1_324_1403 353
422 3300050509 nmdc:mga0qj67_64914_c1 nmdc:mga0qj67_64914_c1_866_1927 353
423 3300050510 nmdc:mga06r32_2236_c1 nmdc:mga06r32_2236_c1_4914_5975 353
424 3300050510 nmdc:mga06r32_297118_c1 nmdc:mga06r32_297118_c1_304_1365 353
425 3300050510 nmdc:mga06r32_42639_c1 nmdc:mga06r32_42639_c1_1985_3046 353
426 3300050510 nmdc:mga06r32_499419_c1 nmdc:mga06r32_499419_c1_114_1175 353
427 3300050510 nmdc:mga06r32_55518_c1 nmdc:mga06r32_55518_c1_2268_3329 353
428 3300050511 nmdc:mga08y16_2466_c1 nmdc:mga08y16_2466_c1_1926_2987 353
429 3300050511 nmdc:mga08y16_95033_c1 nmdc:mga08y16_95033_c1_586_1647 353
430 3300050513 nmdc:mga0rr50_56247_c1 nmdc:mga0rr50_56247_c1_380_1459 353
431 3300050515 nmdc:mga0a205_134981_c1 nmdc:mga0a205_134981_c1_1148_2209 353
432 3300054114 Ga0501084_0002833 Ga0501084_0002833_7077_8138 353
433 3300054114 Ga0501084_0002944 Ga0501084_0002944_7248_8309 353
434 3300054114 Ga0501084_0197222 Ga0501084_0197222_535_1596 353
435 3300059421 Ga0590071_001243 Ga0590071_001243_3154_4215 353
436 3300059421 Ga0590071_002564 Ga0590071_002564_1707_2768 353
437 3300059424 Ga0590075_014398 Ga0590075_014398_565_1626 353
438 3300059426 Ga0590077_005273 Ga0590077_005273_678_1739 353
439 3300060353 Ga0501082_0003671 Ga0501082_0003671_6514_7575 353
440 3300060353 Ga0501082_0007888 Ga0501082_0007888_7043_8104 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

2

120

0.98

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

128

252

0.98

PF03447

NAD_binding_3

Homoserine dehydrogenase, NAD binding domain

8

119

0.96

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

132

337

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q2k-assembly1.cif.gz_E crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9953 11 352
3q2k-assembly2.cif.gz_P crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9951 11 352
3q2k-assembly2.cif.gz_L crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9941 11 352
3q2k-assembly2.cif.gz_O crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9933 7 352
3q2k-assembly1.cif.gz_E crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.9922 11 352
ID Description Score Start End Superfamily
3q2kD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9949 141 352 3.30.360.10
3q2kH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9841 11 141 3.40.50.720
3q2kD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9827 141 352 3.30.360.10
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 13 130 3.40.50.720
af_Q04869_4_115_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.952 13 119 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N1WB29-F1-model_v4 Oxidoreductase 0.9898 9 148 GO:0000166
AF-Q9KHV5-F1-model_v4 WlbA 0.9861 5 131 GO:0000166
AF-Q9KHV5-F1-model_v4 WlbA 0.9783 5 131 GO:0000166
AF-A0A011QT55-F1-model_v4 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.1.1.312) 0.9765 1 130 GO:0000166
GO:0050606
AF-A0A2N1WB29-F1-model_v4 Oxidoreductase 0.9759 9 148 GO:0000166

Feature Viewer

pLDDT pTM Quality
93.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map