F444550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 440 | 262 | 437 | 354 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2857453340|2857459126 |
| Length | 341 |
| Sequence | KVKIALVGCGRISANHFEAIQNNSSLELVAVCDIDQDRAQEASAKWKVDYYVSYQEMLERTDIQLISLCTPSGLHPEQAVMAAERKIHVLTEKPMAVTLKDANRMIQACDDNNVKLFVVKQNRLNSTLQLVKRAIDKQRFGKIYMVSVNVFWQRPQSYYDAASWRGTWELDGGAFMNQASHYVDMMEWLIGDVEKVYAITDTMARDIEAEDTGSAVLRFENGAIGSMNVTMLTYPKNLAGNLTILGEKGTVVVGGTSVNTIEKWEFADSDEDDELAVNVSYTPPSVYGYGHTGYYQNVTDVLLDGAKQGTDGKEGKKSLEVILAIYQSAREHKEIKLPLSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 2 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 3 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 144 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 145 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 146 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 147 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 148 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 149 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 150 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 151 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 154 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 155 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 156 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 157 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 158 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 159 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 160 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 206 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 207 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 208 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 209 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 210 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 214 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 215 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 235 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 236 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 237 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 239 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 244 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 248 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 260 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 261 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 262 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0 |
| Isolates | 0.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.23 |
| Nodule | 0 |
| Rhizoplane | 7.5 |
| Rhizosphere | 80.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000028 | 3300002704 | Bacteria | 120158 |
| 2 | JGI25156J39149_1000013 | 3300002705 | Bacteria | 189553 |
| 3 | JGI25154J39366_1000032 | 3300002738 | Bacteria | 189265 |
| 4 | JGI25157J39369_1000017 | 3300002741 | Bacteria | 189553 |
| 5 | JGI25151J46595_10001607 | 3300003187 | Bacteria | 14986 |
| 6 | Ga0055525_1000047 | 3300003759 | Bacteria | 261507 |
| 7 | Ga0065165_1000691 | 3300005262 | Bacteria | 48143 |
| 8 | Ga0070658_10006880 | 3300005327 | Bacteria | 9191 |
| 9 | Ga0070658_10011248 | 3300005327 | Bacteria | 7173 |
| 10 | Ga0070658_10044477 | 3300005327 | Bacteria | 3589 |
| 11 | Ga0070683_100068801 | 3300005329 | Bacteria | 3299 |
| 12 | Ga0070666_10145169 | 3300005335 | Bacteria | 1654 |
| 13 | Ga0068868_100016415 | 3300005338 | Bacteria | 5498 |
| 14 | Ga0070660_100004993 | 3300005339 | Bacteria | 9173 |
| 15 | Ga0070660_100005123 | 3300005339 | Bacteria | 9053 |
| 16 | Ga0070660_100046983 | 3300005339 | Bacteria | 3310 |
| 17 | Ga0070668_100238701 | 3300005347 | Bacteria | 1505 |
| 18 | Ga0070671_100009821 | 3300005355 | Bacteria | 7681 |
| 19 | Ga0070688_100083551 | 3300005365 | Bacteria | 2072 |
| 20 | Ga0070714_100100274 | 3300005435 | Bacteria | 2550 |
| 21 | Ga0070705_100027109 | 3300005440 | Bacteria | 3125 |
| 22 | Ga0070694_100108417 | 3300005444 | Bacteria | 1975 |
| 23 | Ga0070708_100056023 | 3300005445 | Bacteria | 3505 |
| 24 | Ga0070663_100028872 | 3300005455 | Bacteria | 3782 |
| 25 | Ga0070662_100035429 | 3300005457 | Bacteria | 3524 |
| 26 | Ga0070662_100075648 | 3300005457 | Bacteria | 2494 |
| 27 | Ga0070685_10015243 | 3300005466 | Bacteria | 4081 |
| 28 | Ga0070707_100014812 | 3300005468 | Bacteria | 7309 |
| 29 | Ga0070707_100072947 | 3300005468 | Bacteria | 3309 |
| 30 | Ga0070707_100284571 | 3300005468 | Bacteria | 1606 |
| 31 | Ga0070699_100000036 | 3300005518 | Bacteria | 133816 |
| 32 | Ga0070699_100011473 | 3300005518 | Bacteria | 7652 |
| 33 | Ga0070699_100012146 | 3300005518 | Bacteria | 7434 |
| 34 | Ga0070697_100001922 | 3300005536 | Bacteria | 15904 |
| 35 | Ga0070697_100214910 | 3300005536 | Bacteria | 1638 |
| 36 | Ga0070696_100001123 | 3300005546 | Bacteria | 17326 |
| 37 | Ga0070696_100022549 | 3300005546 | Bacteria | 4278 |
| 38 | Ga0070693_100067630 | 3300005547 | Bacteria | 2095 |
| 39 | Ga0070665_100052949 | 3300005548 | Bacteria | 4071 |
| 40 | Ga0068855_100004247 | 3300005563 | Bacteria | 17499 |
| 41 | Ga0068855_100023796 | 3300005563 | Bacteria | 7337 |
| 42 | Ga0068855_100101134 | 3300005563 | Bacteria | 3318 |
| 43 | Ga0068855_100153703 | 3300005563 | Bacteria | 2615 |
| 44 | Ga0070664_100042719 | 3300005564 | Bacteria | 3826 |
| 45 | Ga0070664_100123244 | 3300005564 | Bacteria | 2271 |
| 46 | Ga0068854_100000860 | 3300005578 | Bacteria | 18187 |
| 47 | Ga0068856_100008649 | 3300005614 | Bacteria | 9904 |
| 48 | Ga0068864_100177414 | 3300005618 | Bacteria | 1946 |
| 49 | Ga0068858_100009795 | 3300005842 | Bacteria | 9120 |
| 50 | Ga0081455_10083914 | 3300005937 | Bacteria | 2602 |
| 51 | Ga0075363_100048578 | 3300006048 | Bacteria | 2257 |
| 52 | Ga0075363_100107349 | 3300006048 | Bacteria | 1549 |
| 53 | Ga0070716_100003928 | 3300006173 | Bacteria | 7055 |
| 54 | Ga0070712_100006429 | 3300006175 | Bacteria | 7286 |
| 55 | Ga0075362_10001998 | 3300006177 | Bacteria | 6709 |
| 56 | Ga0075367_10042578 | 3300006178 | Bacteria | 2657 |
| 57 | Ga0075367_10157437 | 3300006178 | Bacteria | 1412 |
| 58 | Ga0075366_10001435 | 3300006195 | Bacteria | 11892 |
| 59 | Ga0097621_100025588 | 3300006237 | Bacteria | 4619 |
| 60 | Ga0075370_10000365 | 3300006353 | Bacteria | 16530 |
| 61 | Ga0075370_10041710 | 3300006353 | Bacteria | 2591 |
| 62 | Ga0068871_100045854 | 3300006358 | Bacteria | 3519 |
| 63 | Ga0075428_100000452 | 3300006844 | Bacteria | 41072 |
| 64 | Ga0075428_100064717 | 3300006844 | Bacteria | 4005 |
| 65 | Ga0075430_100002016 | 3300006846 | Bacteria | 16741 |
| 66 | Ga0075430_100048693 | 3300006846 | Bacteria | 3579 |
| 67 | Ga0075430_100089790 | 3300006846 | Bacteria | 2571 |
| 68 | Ga0075431_100000364 | 3300006847 | Bacteria | 35896 |
| 69 | Ga0075431_100002500 | 3300006847 | Bacteria | 17731 |
| 70 | Ga0075431_100029231 | 3300006847 | Bacteria | 5671 |
| 71 | Ga0075433_10014025 | 3300006852 | Bacteria | 6533 |
| 72 | Ga0075429_100023304 | 3300006880 | Bacteria | 5370 |
| 73 | Ga0075429_100118927 | 3300006880 | Bacteria | 2309 |
| 74 | Ga0097620_100178620 | 3300006931 | Bacteria | 2205 |
| 75 | Ga0105240_10002013 | 3300009093 | Bacteria | 33506 |
| 76 | Ga0105240_10015675 | 3300009093 | Bacteria | 10290 |
| 77 | Ga0105240_10023342 | 3300009093 | Bacteria | 8183 |
| 78 | Ga0105240_10080289 | 3300009093 | Bacteria | 4012 |
| 79 | Ga0105240_10117892 | 3300009093 | Bacteria | 3200 |
| 80 | Ga0111539_10011937 | 3300009094 | Bacteria | 10891 |
| 81 | Ga0111539_10018275 | 3300009094 | Bacteria | 8685 |
| 82 | Ga0111539_10020138 | 3300009094 | Bacteria | 8220 |
| 83 | Ga0105245_10317965 | 3300009098 | Bacteria | 1533 |
| 84 | Ga0114129_10004357 | 3300009147 | Bacteria | 19984 |
| 85 | Ga0114129_10255073 | 3300009147 | Bacteria | 2353 |
| 86 | Ga0114129_10311021 | 3300009147 | Bacteria | 2097 |
| 87 | Ga0105241_10002118 | 3300009174 | Bacteria | 14999 |
| 88 | Ga0105241_10085829 | 3300009174 | Bacteria | 2474 |
| 89 | Ga0105242_10001278 | 3300009176 | Bacteria | 19882 |
| 90 | Ga0105242_10004433 | 3300009176 | Bacteria | 10914 |
| 91 | Ga0105242_10069382 | 3300009176 | Bacteria | 2919 |
| 92 | Ga0105242_10264246 | 3300009176 | Bacteria | 1556 |
| 93 | Ga0105248_10015852 | 3300009177 | Bacteria | 8306 |
| 94 | Ga0105237_10142843 | 3300009545 | Bacteria | 2388 |
| 95 | Ga0105238_10331850 | 3300009551 | Bacteria | 1508 |
| 96 | Ga0105249_10124581 | 3300009553 | Bacteria | 2452 |
| 97 | Ga0105239_10037783 | 3300010375 | Bacteria | 5291 |
| 98 | Ga0105239_10126573 | 3300010375 | Bacteria | 2840 |
| 99 | Ga0157371_10002796 | 3300013102 | Bacteria | 16364 |
| 100 | Ga0157370_10005186 | 3300013104 | Bacteria | 14678 |
| 101 | Ga0157370_10005893 | 3300013104 | Bacteria | 13660 |
| 102 | Ga0157370_10018950 | 3300013104 | Bacteria | 6919 |
| 103 | Ga0157369_10004352 | 3300013105 | Bacteria | 16712 |
| 104 | Ga0157374_10006650 | 3300013296 | Bacteria | 9820 |
| 105 | Ga0157378_10003575 | 3300013297 | Bacteria | 13763 |
| 106 | Ga0157372_10139159 | 3300013307 | Bacteria | 2796 |
| 107 | Ga0157375_10029392 | 3300013308 | Bacteria | 5168 |
| 108 | Ga0163163_10135713 | 3300014325 | Bacteria | 2502 |
| 109 | Ga0157379_10245737 | 3300014968 | Bacteria | 1623 |
| 110 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 111 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 112 | Ga0207425_1001030 | 3300025245 | Bacteria | 12992 |
| 113 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 114 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 115 | Ga0209148_1002087 | 3300025254 | Bacteria | 7609 |
| 116 | Ga0209759_1000026 | 3300025256 | Bacteria | 311743 |
| 117 | Ga0209565_1000758 | 3300025263 | Bacteria | 18952 |
| 118 | Ga0209675_1001795 | 3300025291 | Bacteria | 11733 |
| 119 | Ga0209025_1001036 | 3300025294 | Bacteria | 40764 |
| 120 | Ga0209256_1017522 | 3300025299 | Bacteria | 2374 |
| 121 | Ga0207680_10047440 | 3300025903 | Bacteria | 2545 |
| 122 | Ga0207645_10232011 | 3300025907 | Bacteria | 1218 |
| 123 | Ga0207643_10171287 | 3300025908 | Bacteria | 1310 |
| 124 | Ga0207705_10000640 | 3300025909 | Bacteria | 29193 |
| 125 | Ga0207705_10002230 | 3300025909 | Bacteria | 14959 |
| 126 | Ga0207705_10030677 | 3300025909 | Bacteria | 3836 |
| 127 | Ga0207684_10077709 | 3300025910 | Bacteria | 2823 |
| 128 | Ga0207707_10142589 | 3300025912 | Bacteria | 2094 |
| 129 | Ga0207695_10002190 | 3300025913 | Bacteria | 29482 |
| 130 | Ga0207695_10005662 | 3300025913 | Bacteria | 16491 |
| 131 | Ga0207695_10020685 | 3300025913 | Bacteria | 7531 |
| 132 | Ga0207695_10035180 | 3300025913 | Bacteria | 5436 |
| 133 | Ga0207695_10237645 | 3300025913 | Bacteria | 1724 |
| 134 | Ga0207695_10263640 | 3300025913 | Bacteria | 1620 |
| 135 | Ga0207657_10000973 | 3300025919 | Bacteria | 30427 |
| 136 | Ga0207657_10008871 | 3300025919 | Bacteria | 10171 |
| 137 | Ga0207657_10018985 | 3300025919 | Bacteria | 6543 |
| 138 | Ga0207646_10036376 | 3300025922 | Bacteria | 4444 |
| 139 | Ga0207646_10068247 | 3300025922 | Bacteria | 3175 |
| 140 | Ga0207646_10099992 | 3300025922 | Bacteria | 2599 |
| 141 | Ga0207646_10192972 | 3300025922 | Bacteria | 1839 |
| 142 | Ga0207687_10129006 | 3300025927 | Bacteria | 1903 |
| 143 | Ga0207700_10022999 | 3300025928 | Bacteria | 4287 |
| 144 | Ga0207664_10175542 | 3300025929 | Bacteria | 1837 |
| 145 | Ga0207644_10004083 | 3300025931 | Bacteria | 9469 |
| 146 | Ga0207690_10016606 | 3300025932 | Bacteria | 4483 |
| 147 | Ga0207706_10083464 | 3300025933 | Bacteria | 2809 |
| 148 | Ga0207706_10088114 | 3300025933 | Bacteria | 2729 |
| 149 | Ga0207706_10179891 | 3300025933 | Bacteria | 1857 |
| 150 | Ga0207706_10203966 | 3300025933 | Bacteria | 1734 |
| 151 | Ga0207686_10047029 | 3300025934 | Bacteria | 2665 |
| 152 | Ga0207670_10004820 | 3300025936 | Bacteria | 7325 |
| 153 | Ga0207704_10135472 | 3300025938 | Bacteria | 1713 |
| 154 | Ga0207665_10001989 | 3300025939 | Bacteria | 13784 |
| 155 | Ga0207689_10175877 | 3300025942 | Bacteria | 1765 |
| 156 | Ga0207679_10136506 | 3300025945 | Bacteria | 1976 |
| 157 | Ga0207667_10003719 | 3300025949 | Bacteria | 18811 |
| 158 | Ga0207667_10028093 | 3300025949 | Bacteria | 6112 |
| 159 | Ga0207667_10091215 | 3300025949 | Bacteria | 3148 |
| 160 | Ga0207651_10010742 | 3300025960 | Bacteria | 5089 |
| 161 | Ga0207668_10310460 | 3300025972 | Bacteria | 1305 |
| 162 | Ga0207640_10004526 | 3300025981 | Bacteria | 7546 |
| 163 | Ga0207677_10020308 | 3300026023 | Bacteria | 4031 |
| 164 | Ga0207678_10006453 | 3300026067 | Bacteria | 10407 |
| 165 | Ga0207678_10008719 | 3300026067 | Bacteria | 8930 |
| 166 | Ga0207702_10060165 | 3300026078 | Bacteria | 3238 |
| 167 | Ga0207702_10400535 | 3300026078 | Bacteria | 1323 |
| 168 | Ga0207641_10067181 | 3300026088 | Bacteria | 3071 |
| 169 | Ga0207641_10138204 | 3300026088 | Bacteria | 2195 |
| 170 | Ga0207648_10058138 | 3300026089 | Bacteria | 3373 |
| 171 | Ga0207648_10074014 | 3300026089 | Bacteria | 2968 |
| 172 | Ga0207676_10010440 | 3300026095 | Bacteria | 6614 |
| 173 | Ga0207676_10080617 | 3300026095 | Bacteria | 2642 |
| 174 | Ga0207674_10012557 | 3300026116 | Bacteria | 9463 |
| 175 | Ga0207683_10009611 | 3300026121 | Bacteria | 8243 |
| 176 | Ga0209974_10021171 | 3300027876 | Bacteria | 2153 |
| 177 | Ga0207428_10115080 | 3300027907 | Bacteria | 2066 |
| 178 | Ga0207428_10182995 | 3300027907 | Bacteria | 1582 |
| 179 | Ga0268266_10008344 | 3300028379 | Bacteria | 9221 |
| 180 | Ga0307517_10153888 | 3300028786 | Bacteria | 1568 |
| 181 | Ga0307515_10154515 | 3300028794 | Bacteria | 2377 |
| 182 | Ga0307513_10050202 | 3300031456 | Bacteria | 4512 |
| 183 | Ga0307408_100024658 | 3300031548 | Bacteria | 4111 |
| 184 | Ga0307516_10175646 | 3300031730 | Bacteria | 1879 |
| 185 | Ga0307405_10125236 | 3300031731 | Bacteria | 1765 |
| 186 | Ga0307413_10013140 | 3300031824 | Bacteria | 4147 |
| 187 | Ga0307413_10014619 | 3300031824 | Bacteria | 3994 |
| 188 | Ga0307413_10051933 | 3300031824 | Bacteria | 2473 |
| 189 | Ga0307413_10064047 | 3300031824 | Bacteria | 2282 |
| 190 | Ga0307410_10000629 | 3300031852 | Bacteria | 14532 |
| 191 | Ga0307410_10012904 | 3300031852 | Bacteria | 4853 |
| 192 | Ga0307410_10016990 | 3300031852 | Bacteria | 4355 |
| 193 | Ga0307410_10028879 | 3300031852 | Bacteria | 3524 |
| 194 | Ga0307410_10096515 | 3300031852 | Bacteria | 2110 |
| 195 | Ga0307410_10181562 | 3300031852 | Bacteria | 1593 |
| 196 | Ga0307406_10018586 | 3300031901 | Bacteria | 4064 |
| 197 | Ga0307406_10154078 | 3300031901 | Bacteria | 1643 |
| 198 | Ga0307407_10047245 | 3300031903 | Bacteria | 2441 |
| 199 | Ga0307407_10054817 | 3300031903 | Bacteria | 2301 |
| 200 | Ga0307407_10076331 | 3300031903 | Bacteria | 2012 |
| 201 | Ga0307407_10087141 | 3300031903 | Bacteria | 1904 |
| 202 | Ga0307407_10201086 | 3300031903 | Bacteria | 1335 |
| 203 | Ga0307409_100000080 | 3300031995 | Bacteria | 34467 |
| 204 | Ga0307409_100063236 | 3300031995 | Bacteria | 2901 |
| 205 | Ga0307416_100000433 | 3300032002 | Bacteria | 21345 |
| 206 | Ga0307416_100001388 | 3300032002 | Bacteria | 13121 |
| 207 | Ga0307416_100079432 | 3300032002 | Bacteria | 2764 |
| 208 | Ga0307416_100135136 | 3300032002 | Bacteria | 2229 |
| 209 | Ga0307414_10007884 | 3300032004 | Bacteria | 6008 |
| 210 | Ga0307414_10019795 | 3300032004 | Bacteria | 4179 |
| 211 | Ga0307411_10000388 | 3300032005 | Bacteria | 15018 |
| 212 | Ga0307411_10004258 | 3300032005 | Bacteria | 6817 |
| 213 | Ga0307411_10007269 | 3300032005 | Bacteria | 5621 |
| 214 | Ga0307411_10135524 | 3300032005 | Bacteria | 1807 |
| 215 | Ga0307415_100000280 | 3300032126 | Bacteria | 22015 |
| 216 | Ga0307415_100163467 | 3300032126 | Bacteria | 1728 |
| 217 | Ga0373955_0106534 | 3300035172 | Bacteria | 1616 |
| 218 | Ga0373961_0014655 | 3300035241 | Bacteria | 1994 |
| 219 | Ga0395899_0003829 | 3300037312 | Bacteria | 11872 |
| 220 | Ga0395899_0020667 | 3300037312 | Bacteria | 4991 |
| 221 | Ga0395899_0024721 | 3300037312 | Bacteria | 4541 |
| 222 | Ga0395899_0033563 | 3300037312 | Bacteria | 3853 |
| 223 | Ga0395899_0048119 | 3300037312 | Bacteria | 3174 |
| 224 | Ga0395899_0127327 | 3300037312 | Bacteria | 1820 |
| 225 | Ga0395900_0000331 | 3300037418 | Bacteria | 69780 |
| 226 | Ga0395900_0000763 | 3300037418 | Bacteria | 42856 |
| 227 | Ga0395900_0003744 | 3300037418 | Bacteria | 16335 |
| 228 | Ga0395900_0004504 | 3300037418 | Bacteria | 14745 |
| 229 | Ga0395900_0063442 | 3300037418 | Bacteria | 3797 |
| 230 | Ga0395900_0131765 | 3300037418 | Bacteria | 2561 |
| 231 | Ga0395898_0085197 | 3300037466 | Bacteria | 3046 |
| 232 | Ga0395905_0004263 | 3300037471 | Bacteria | 14925 |
| 233 | Ga0395905_0085447 | 3300037471 | Bacteria | 2956 |
| 234 | Ga0395901_0000003 | 3300038443 | Bacteria | 701538 |
| 235 | Ga0395901_0000097 | 3300038443 | Bacteria | 118528 |
| 236 | Ga0395901_0001055 | 3300038443 | Bacteria | 29665 |
| 237 | Ga0395901_0077622 | 3300038443 | Bacteria | 3466 |
| 238 | Ga0242420_001097 | 3300038996 | Bacteria | 3461 |
| 239 | Ga0436363_0283447 | 3300039450 | Bacteria | 5216 |
| 240 | Ga0439439_0002360 | 3300041406 | Bacteria | 3997 |
| 241 | Ga0439448_0000646 | 3300042005 | Bacteria | 8254 |
| 242 | Ga0439449_0016445 | 3300042007 | Bacteria | 2780 |
| 243 | Ga0439449_0058914 | 3300042007 | Bacteria | 1418 |
| 244 | Ga0439449_0077367 | 3300042007 | Bacteria | 1227 |
| 245 | Ga0439455_0002698 | 3300042012 | Bacteria | 3276 |
| 246 | Ga0439455_0033108 | 3300042012 | Bacteria | 1295 |
| 247 | Ga0450898_001528 | 3300042134 | Bacteria | 3071 |
| 248 | Ga0450898_009105 | 3300042134 | Bacteria | 1581 |
| 249 | Ga0439458_0005842 | 3300042157 | Bacteria | 2757 |
| 250 | Ga0466969_0000978 | 3300044656 | Bacteria | 15403 |
| 251 | Ga0466969_0013595 | 3300044656 | Bacteria | 4286 |
| 252 | Ga0466972_0000657 | 3300044658 | Bacteria | 16677 |
| 253 | Ga0466972_0061160 | 3300044658 | Bacteria | 1806 |
| 254 | Ga0453683_0231676 | 3300044673 | Bacteria | 1176 |
| 255 | Ga0466965_0004262 | 3300044683 | Bacteria | 6360 |
| 256 | Ga0466965_0005611 | 3300044683 | Bacteria | 5661 |
| 257 | Ga0466965_0096761 | 3300044683 | Bacteria | 1506 |
| 258 | Ga0466966_0011506 | 3300044684 | Bacteria | 5869 |
| 259 | Ga0466966_0012604 | 3300044684 | Bacteria | 5604 |
| 260 | Ga0466961_0004528 | 3300044693 | Bacteria | 8714 |
| 261 | Ga0466961_0019736 | 3300044693 | Bacteria | 4337 |
| 262 | Ga0466961_0124267 | 3300044693 | Bacteria | 1619 |
| 263 | Ga0466964_0000327 | 3300044706 | Bacteria | 14173 |
| 264 | Ga0466964_0030434 | 3300044706 | Bacteria | 2136 |
| 265 | Ga0453684_0000276 | 3300044712 | Bacteria | 222326 |
| 266 | Ga0466971_0060750 | 3300044719 | Bacteria | 1708 |
| 267 | Ga0466968_0102533 | 3300044735 | Bacteria | 1279 |
| 268 | Ga0466957_0000007 | 3300044842 | Bacteria | 84513 |
| 269 | Ga0466959_0003388 | 3300045049 | Bacteria | 10416 |
| 270 | Ga0466959_0004938 | 3300045049 | Bacteria | 9034 |
| 271 | Ga0451576_0002097 | 3300045051 | Bacteria | 31079 |
| 272 | Ga0466967_0008718 | 3300045976 | Bacteria | 7467 |
| 273 | Ga0466967_0087736 | 3300045976 | Bacteria | 2821 |
| 274 | Ga0495580_0001312 | 3300046472 | Bacteria | 21969 |
| 275 | Ga0495580_0017904 | 3300046472 | Bacteria | 5284 |
| 276 | Ga0495580_0225744 | 3300046472 | Bacteria | 1286 |
| 277 | Ga0495584_0000097 | 3300046491 | Bacteria | 59505 |
| 278 | Ga0495584_0014823 | 3300046491 | Bacteria | 3972 |
| 279 | Ga0495594_0050931 | 3300046499 | Bacteria | 2278 |
| 280 | Ga0495607_0000524 | 3300046501 | Bacteria | 37754 |
| 281 | Ga0495606_0007078 | 3300046507 | Bacteria | 10145 |
| 282 | Ga0495616_0001262 | 3300046513 | Bacteria | 17783 |
| 283 | Ga0495618_0175986 | 3300046514 | Bacteria | 1361 |
| 284 | Ga0495630_0135352 | 3300046517 | Bacteria | 1872 |
| 285 | Ga0495632_0009885 | 3300046519 | Bacteria | 5703 |
| 286 | Ga0495666_0044759 | 3300046526 | Bacteria | 2136 |
| 287 | Ga0495642_0000065 | 3300046528 | Bacteria | 63401 |
| 288 | Ga0495609_0000030 | 3300046538 | Bacteria | 215885 |
| 289 | Ga0495645_0021148 | 3300046543 | Bacteria | 4703 |
| 290 | Ga0495656_0010492 | 3300046615 | Bacteria | 3370 |
| 291 | Ga0495634_0114201 | 3300046642 | Bacteria | 1734 |
| 292 | Ga0495625_0018491 | 3300046660 | Bacteria | 5440 |
| 293 | Ga0495661_0000209 | 3300046665 | Bacteria | 67580 |
| 294 | Ga0495588_0000078 | 3300046674 | Bacteria | 214254 |
| 295 | Ga0495658_0025106 | 3300046683 | Bacteria | 3183 |
| 296 | Ga0495658_0043420 | 3300046683 | Bacteria | 2515 |
| 297 | Ga0495649_0003047 | 3300046694 | Bacteria | 11496 |
| 298 | Ga0495589_0000021 | 3300046794 | Bacteria | 197941 |
| 299 | Ga0495660_0120710 | 3300046810 | Bacteria | 1326 |
| 300 | Ga0495674_0055205 | 3300047319 | Bacteria | 3485 |
| 301 | Ga0495674_0056790 | 3300047319 | Bacteria | 3427 |
| 302 | Ga0495676_0145182 | 3300047321 | Bacteria | 1696 |
| 303 | Ga0495687_000276 | 3300047443 | Bacteria | 67876 |
| 304 | Ga0495687_000319 | 3300047443 | Bacteria | 62530 |
| 305 | Ga0495687_000327 | 3300047443 | Bacteria | 61677 |
| 306 | Ga0495687_000615 | 3300047443 | Bacteria | 41337 |
| 307 | Ga0495687_005459 | 3300047443 | Bacteria | 8097 |
| 308 | Ga0495677_0000050 | 3300047445 | Bacteria | 67980 |
| 309 | Ga0496101_0024481 | 3300048904 | Bacteria | 4179 |
| 310 | Ga0496102_0000598 | 3300048905 | Bacteria | 37839 |
| 311 | Ga0496102_0010261 | 3300048905 | Bacteria | 8053 |
| 312 | Ga0496102_0014970 | 3300048905 | Bacteria | 6751 |
| 313 | Ga0496102_0274197 | 3300048905 | Bacteria | 1590 |
| 314 | Ga0496102_0368315 | 3300048905 | Bacteria | 1352 |
| 315 | Ga0496103_0036884 | 3300048906 | Bacteria | 2995 |
| 316 | Ga0496104_0001146 | 3300048907 | Bacteria | 22682 |
| 317 | Ga0496104_0014907 | 3300048907 | Bacteria | 7028 |
| 318 | Ga0496104_0155736 | 3300048907 | Bacteria | 2192 |
| 319 | Ga0496105_0086968 | 3300048908 | Bacteria | 2583 |
| 320 | Ga0496106_0001474 | 3300048909 | Bacteria | 17684 |
| 321 | Ga0496106_0006465 | 3300048909 | Bacteria | 8680 |
| 322 | Ga0496106_0097510 | 3300048909 | Bacteria | 2276 |
| 323 | Ga0496107_0032332 | 3300048910 | Bacteria | 3739 |
| 324 | Ga0496107_0132853 | 3300048910 | Bacteria | 1838 |
| 325 | Ga0496108_0001195 | 3300048911 | Bacteria | 20324 |
| 326 | Ga0496108_0076438 | 3300048911 | Bacteria | 2830 |
| 327 | Ga0496108_0324367 | 3300048911 | Bacteria | 1342 |
| 328 | Ga0496109_0023070 | 3300048912 | Bacteria | 5519 |
| 329 | Ga0496109_0034013 | 3300048912 | Bacteria | 4587 |
| 330 | Ga0496109_0242203 | 3300048912 | Bacteria | 1697 |
| 331 | Ga0496110_0006030 | 3300048913 | Bacteria | 9546 |
| 332 | Ga0496110_0026898 | 3300048913 | Bacteria | 4927 |
| 333 | Ga0496111_0002920 | 3300048914 | Bacteria | 10447 |
| 334 | Ga0496112_0002488 | 3300048915 | Bacteria | 14875 |
| 335 | Ga0496112_0070724 | 3300048915 | Bacteria | 3448 |
| 336 | Ga0496112_0178625 | 3300048915 | Bacteria | 2086 |
| 337 | Ga0496113_0000701 | 3300048916 | Bacteria | 17130 |
| 338 | Ga0496113_0003376 | 3300048916 | Bacteria | 9544 |
| 339 | Ga0496113_0007063 | 3300048916 | Bacteria | 7187 |
| 340 | Ga0496115_0043004 | 3300048918 | Bacteria | 3601 |
| 341 | Ga0496115_0226025 | 3300048918 | Bacteria | 1544 |
| 342 | Ga0496116_0000107 | 3300048919 | Bacteria | 188067 |
| 343 | Ga0496117_0000038 | 3300048920 | Bacteria | 322781 |
| 344 | Ga0496118_0000019 | 3300048921 | Bacteria | 489649 |
| 345 | Ga0496120_0061782 | 3300048923 | Bacteria | 2089 |
| 346 | Ga0496121_0000260 | 3300048924 | Bacteria | 110424 |
| 347 | Ga0496121_0004923 | 3300048924 | Bacteria | 17526 |
| 348 | Ga0496121_0010378 | 3300048924 | Bacteria | 10518 |
| 349 | Ga0496122_0002607 | 3300048925 | Bacteria | 25253 |
| 350 | Ga0496124_0008573 | 3300048927 | Bacteria | 10667 |
| 351 | Ga0496124_0009546 | 3300048927 | Bacteria | 9974 |
| 352 | Ga0496125_0120253 | 3300048928 | Bacteria | 1875 |
| 353 | Ga0496126_0001190 | 3300048929 | Bacteria | 42445 |
| 354 | Ga0496126_0001621 | 3300048929 | Bacteria | 34028 |
| 355 | Ga0501300_003011 | 3300049523 | Bacteria | 2516 |
| 356 | Ga0501033_0065261 | 3300049570 | Bacteria | 2678 |
| 357 | Ga0501034_0002147 | 3300049571 | Bacteria | 24490 |
| 358 | Ga0501036_0084140 | 3300049572 | Bacteria | 2690 |
| 359 | Ga0501038_0159855 | 3300049574 | Bacteria | 1831 |
| 360 | Ga0501039_0029298 | 3300049575 | Bacteria | 4239 |
| 361 | Ga0501040_0012256 | 3300049576 | Bacteria | 5616 |
| 362 | Ga0501041_0027669 | 3300049577 | Bacteria | 3417 |
| 363 | Ga0501041_0027967 | 3300049577 | Bacteria | 3401 |
| 364 | Ga0501047_0085092 | 3300049581 | Bacteria | 3038 |
| 365 | Ga0501067_0001949 | 3300049583 | Bacteria | 11364 |
| 366 | Ga0501067_0031689 | 3300049583 | Bacteria | 2933 |
| 367 | Ga0501067_0039952 | 3300049583 | Bacteria | 2605 |
| 368 | Ga0501067_0075973 | 3300049583 | Bacteria | 1861 |
| 369 | Ga0501068_0000282 | 3300049584 | Bacteria | 25222 |
| 370 | Ga0501068_0002719 | 3300049584 | Bacteria | 9382 |
| 371 | Ga0501069_0000249 | 3300049585 | Bacteria | 24317 |
| 372 | Ga0501069_0003100 | 3300049585 | Bacteria | 8520 |
| 373 | Ga0501069_0016452 | 3300049585 | Bacteria | 3974 |
| 374 | Ga0501069_0066238 | 3300049585 | Bacteria | 2020 |
| 375 | Ga0501070_0007323 | 3300049586 | Bacteria | 9372 |
| 376 | Ga0501070_0009089 | 3300049586 | Bacteria | 8404 |
| 377 | Ga0501070_0030297 | 3300049586 | Bacteria | 4533 |
| 378 | Ga0501070_0112289 | 3300049586 | Bacteria | 2252 |
| 379 | Ga0501071_0003950 | 3300049587 | Bacteria | 9351 |
| 380 | Ga0501071_0004594 | 3300049587 | Bacteria | 8755 |
| 381 | Ga0501072_0000197 | 3300049588 | Bacteria | 44108 |
| 382 | Ga0501072_0105448 | 3300049588 | Bacteria | 2241 |
| 383 | Ga0501072_0140137 | 3300049588 | Bacteria | 1928 |
| 384 | Ga0501073_0006478 | 3300049589 | Bacteria | 8710 |
| 385 | Ga0501073_0007528 | 3300049589 | Bacteria | 8085 |
| 386 | Ga0501074_0001562 | 3300049590 | Bacteria | 15490 |
| 387 | Ga0501074_0002319 | 3300049590 | Bacteria | 13245 |
| 388 | Ga0501074_0098589 | 3300049590 | Bacteria | 2092 |
| 389 | Ga0501075_0050040 | 3300049591 | Bacteria | 3141 |
| 390 | Ga0501076_0067872 | 3300049592 | Bacteria | 2848 |
| 391 | Ga0501077_0002017 | 3300049593 | Bacteria | 12264 |
| 392 | Ga0501206_003424 | 3300049653 | Bacteria | 2015 |
| 393 | Ga0501209_006305 | 3300049656 | Unclassified | 2205 |
| 394 | Ga0501216_001022 | 3300049660 | Bacteria | 3612 |
| 395 | Ga0501235_006898 | 3300049669 | Bacteria | 2472 |
| 396 | Ga0501239_000555 | 3300049672 | Bacteria | 2948 |
| 397 | Ga0501249_012048 | 3300049679 | Bacteria | 1824 |
| 398 | Ga0501080_0001113 | 3300049742 | Bacteria | 22136 |
| 399 | Ga0501080_0016734 | 3300049742 | Bacteria | 6771 |
| 400 | Ga0501080_0160701 | 3300049742 | Bacteria | 2075 |
| 401 | Ga0501081_0259725 | 3300049743 | Bacteria | 1269 |
| 402 | Ga0501083_0000798 | 3300049744 | Bacteria | 20654 |
| 403 | Ga0501083_0001548 | 3300049744 | Bacteria | 15725 |
| 404 | Ga0501273_000907 | 3300049770 | Bacteria | 2618 |
| 405 | Ga0501035_0002683 | 3300049822 | Bacteria | 17321 |
| 406 | Ga0501035_0064784 | 3300049822 | Bacteria | 3247 |
| 407 | Ga0501044_0275205 | 3300049823 | Bacteria | 1618 |
| 408 | Ga0501045_0025290 | 3300049824 | Bacteria | 4267 |
| 409 | Ga0501045_0034223 | 3300049824 | Bacteria | 3687 |
| 410 | nmdc:mga0k408_21245_c1 | 3300050493 | Bacteria | 3645 |
| 411 | nmdc:mga0k408_59675_c1 | 3300050493 | Bacteria | 2217 |
| 412 | nmdc:mga04h51_14953_c1 | 3300050495 | Bacteria | 2228 |
| 413 | nmdc:mga07m45_3882_c1 | 3300050496 | Bacteria | 7255 |
| 414 | nmdc:mga05p37_3119_c1 | 3300050507 | Bacteria | 19270 |
| 415 | nmdc:mga05p37_437323_c1 | 3300050507 | Bacteria | 1518 |
| 416 | nmdc:mga09592_49579_c1 | 3300050508 | Bacteria | 3540 |
| 417 | nmdc:mga0qj67_64914_c1 | 3300050509 | Bacteria | 2905 |
| 418 | nmdc:mga06r32_2236_c1 | 3300050510 | Bacteria | 17323 |
| 419 | nmdc:mga06r32_297118_c1 | 3300050510 | Bacteria | 1601 |
| 420 | nmdc:mga06r32_42639_c1 | 3300050510 | Bacteria | 4316 |
| 421 | nmdc:mga06r32_499419_c1 | 3300050510 | Bacteria | 1193 |
| 422 | nmdc:mga06r32_55518_c1 | 3300050510 | Bacteria | 3799 |
| 423 | nmdc:mga08y16_12154_c1 | 3300050511 | Bacteria | 9049 |
| 424 | nmdc:mga08y16_2466_c1 | 3300050511 | Bacteria | 18996 |
| 425 | nmdc:mga08y16_95033_c1 | 3300050511 | Bacteria | 3105 |
| 426 | nmdc:mga0rr50_56247_c1 | 3300050513 | Bacteria | 2938 |
| 427 | nmdc:mga0a205_134981_c1 | 3300050515 | Bacteria | 2368 |
| 428 | Ga0500658_0000949 | 3300053134 | Bacteria | 11845 |
| 429 | Ga0501084_0002833 | 3300054114 | Bacteria | 13995 |
| 430 | Ga0501084_0002944 | 3300054114 | Bacteria | 13788 |
| 431 | Ga0501084_0197222 | 3300054114 | Bacteria | 1698 |
| 432 | Ga0590071_001243 | 3300059421 | Bacteria | 6884 |
| 433 | Ga0590071_002564 | 3300059421 | Bacteria | 4573 |
| 434 | Ga0590075_014398 | 3300059424 | Bacteria | 1933 |
| 435 | Ga0590077_005273 | 3300059426 | Bacteria | 2648 |
| 436 | Ga0501082_0003671 | 3300060353 | Bacteria | 13412 |
| 437 | Ga0501082_0007888 | 3300060353 | Bacteria | 9191 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006844 | Ga0075428_100000452 | Ga0075428_10000045214 | 335 |
| 2 | 3300009094 | Ga0111539_10020138 | Ga0111539_100201383 | 335 |
| 3 | 3300027907 | Ga0207428_10182995 | Ga0207428_101829951 | 335 |
| 4 | 3300050511 | nmdc:mga08y16_12154_c1 | nmdc:mga08y16_12154_c1_5898_6959 | 335 |
| 5 | 3300005355 | Ga0070671_100009821 | Ga0070671_1000098216 | 341 |
| 6 | iso_pu_bacteria | 2857453340 | 2857459126 | 341 |
| 7 | iso_pu_bacteria | 2643221585 | 2643937391 | 348 |
| 8 | iso_pu_bacteria | 2643221656 | 2644318556 | 348 |
| 9 | 3300005335 | Ga0070666_10145169 | Ga0070666_101451691 | 349 |
| 10 | 3300005347 | Ga0070668_100238701 | Ga0070668_1002387011 | 349 |
| 11 | 3300005457 | Ga0070662_100035429 | Ga0070662_1000354292 | 349 |
| 12 | 3300006048 | Ga0075363_100107349 | Ga0075363_1001073492 | 349 |
| 13 | 3300006178 | Ga0075367_10042578 | Ga0075367_100425782 | 349 |
| 14 | 3300006178 | Ga0075367_10157437 | Ga0075367_101574372 | 349 |
| 15 | 3300006195 | Ga0075366_10001435 | Ga0075366_1000143513 | 349 |
| 16 | 3300006353 | Ga0075370_10000365 | Ga0075370_1000036516 | 349 |
| 17 | 3300006353 | Ga0075370_10041710 | Ga0075370_100417102 | 349 |
| 18 | 3300009093 | Ga0105240_10117892 | Ga0105240_101178922 | 349 |
| 19 | 3300009098 | Ga0105245_10317965 | Ga0105245_103179652 | 349 |
| 20 | 3300009176 | Ga0105242_10264246 | Ga0105242_102642462 | 349 |
| 21 | 3300009545 | Ga0105237_10142843 | Ga0105237_101428432 | 349 |
| 22 | 3300010375 | Ga0105239_10126573 | Ga0105239_101265733 | 349 |
| 23 | 3300025933 | Ga0207706_10083464 | Ga0207706_100834642 | 349 |
| 24 | 3300025933 | Ga0207706_10179891 | Ga0207706_101798912 | 349 |
| 25 | 3300025942 | Ga0207689_10175877 | Ga0207689_101758772 | 349 |
| 26 | 3300025972 | Ga0207668_10310460 | Ga0207668_103104602 | 349 |
| 27 | 3300026089 | Ga0207648_10058138 | Ga0207648_100581382 | 349 |
| 28 | 3300026116 | Ga0207674_10012557 | Ga0207674_100125572 | 349 |
| 29 | 3300028786 | Ga0307517_10153888 | Ga0307517_101538882 | 349 |
| 30 | 3300028794 | Ga0307515_10154515 | Ga0307515_101545152 | 349 |
| 31 | 3300031456 | Ga0307513_10050202 | Ga0307513_100502022 | 349 |
| 32 | 3300031730 | Ga0307516_10175646 | Ga0307516_101756463 | 349 |
| 33 | 3300037471 | Ga0395905_0085447 | Ga0395905_0085447_334_1392 | 349 |
| 34 | 3300042007 | Ga0439449_0058914 | Ga0439449_0058914_70_1128 | 349 |
| 35 | 3300042007 | Ga0439449_0077367 | Ga0439449_0077367_159_1217 | 349 |
| 36 | 3300042134 | Ga0450898_001528 | Ga0450898_001528_704_1762 | 349 |
| 37 | 3300046519 | Ga0495632_0009885 | Ga0495632_0009885_192_1250 | 349 |
| 38 | 3300046694 | Ga0495649_0003047 | Ga0495649_0003047_7942_9000 | 349 |
| 39 | 3300046810 | Ga0495660_0120710 | Ga0495660_0120710_58_1116 | 349 |
| 40 | 3300047443 | Ga0495687_000327 | Ga0495687_000327_50501_51559 | 349 |
| 41 | 3300047443 | Ga0495687_000615 | Ga0495687_000615_3165_4223 | 349 |
| 42 | 3300047443 | Ga0495687_005459 | Ga0495687_005459_3522_4580 | 349 |
| 43 | 3300050493 | nmdc:mga0k408_21245_c1 | nmdc:mga0k408_21245_c1_1950_3008 | 349 |
| 44 | 3300050493 | nmdc:mga0k408_59675_c1 | nmdc:mga0k408_59675_c1_85_1143 | 349 |
| 45 | 3300050495 | nmdc:mga04h51_14953_c1 | nmdc:mga04h51_14953_c1_75_1133 | 349 |
| 46 | 3300050496 | nmdc:mga07m45_3882_c1 | nmdc:mga07m45_3882_c1_3959_5017 | 349 |
| 47 | 3300053134 | Ga0500658_0000949 | Ga0500658_0000949_10463_11521 | 349 |
| 48 | 3300005548 | Ga0070665_100052949 | Ga0070665_1000529494 | 350 |
| 49 | 3300044656 | Ga0466969_0000978 | Ga0466969_0000978_9561_10613 | 350 |
| 50 | 3300044683 | Ga0466965_0004262 | Ga0466965_0004262_4939_5991 | 350 |
| 51 | 3300044684 | Ga0466966_0012604 | Ga0466966_0012604_3115_4167 | 350 |
| 52 | 3300044693 | Ga0466961_0004528 | Ga0466961_0004528_6313_7365 | 350 |
| 53 | 3300044712 | Ga0453684_0000276 | Ga0453684_0000276_136286_137338 | 350 |
| 54 | 3300045049 | Ga0466959_0003388 | Ga0466959_0003388_7676_8728 | 350 |
| 55 | 3300045051 | Ga0451576_0002097 | Ga0451576_0002097_8201_9253 | 350 |
| 56 | 3300048905 | Ga0496102_0014970 | Ga0496102_0014970_1611_2663 | 350 |
| 57 | 3300048920 | Ga0496117_0000038 | Ga0496117_0000038_314494_315546 | 350 |
| 58 | 3300048921 | Ga0496118_0000019 | Ga0496118_0000019_413112_414164 | 350 |
| 59 | 3300048923 | Ga0496120_0061782 | Ga0496120_0061782_646_1698 | 350 |
| 60 | 3300048927 | Ga0496124_0008573 | Ga0496124_0008573_7889_8941 | 350 |
| 61 | 3300048929 | Ga0496126_0001190 | Ga0496126_0001190_12691_13743 | 350 |
| 62 | 3300005468 | Ga0070707_100014812 | Ga0070707_1000148126 | 351 |
| 63 | 3300005518 | Ga0070699_100000036 | Ga0070699_10000003615 | 351 |
| 64 | 3300014968 | Ga0157379_10245737 | Ga0157379_102457372 | 351 |
| 65 | 3300025922 | Ga0207646_10192972 | Ga0207646_101929722 | 351 |
| 66 | 3300046472 | Ga0495580_0225744 | Ga0495580_0225744_181_1239 | 351 |
| 67 | 3300046499 | Ga0495594_0050931 | Ga0495594_0050931_1132_2190 | 351 |
| 68 | 3300046517 | Ga0495630_0135352 | Ga0495630_0135352_414_1472 | 351 |
| 69 | 3300046526 | Ga0495666_0044759 | Ga0495666_0044759_1064_2122 | 351 |
| 70 | 3300046642 | Ga0495634_0114201 | Ga0495634_0114201_556_1614 | 351 |
| 71 | 3300046683 | Ga0495658_0043420 | Ga0495658_0043420_1012_2070 | 351 |
| 72 | 3300047319 | Ga0495674_0055205 | Ga0495674_0055205_1467_2525 | 351 |
| 73 | 3300047321 | Ga0495676_0145182 | Ga0495676_0145182_32_1090 | 351 |
| 74 | 3300048919 | Ga0496116_0000107 | Ga0496116_0000107_126788_127843 | 351 |
| 75 | 3300048924 | Ga0496121_0000260 | Ga0496121_0000260_49095_50150 | 351 |
| 76 | 3300005262 | Ga0065165_1000691 | Ga0065165_10006918 | 352 |
| 77 | 3300028379 | Ga0268266_10008344 | Ga0268266_100083449 | 352 |
| 78 | 3300049577 | Ga0501041_0027669 | Ga0501041_0027669_2160_3218 | 352 |
| 79 | 3300049824 | Ga0501045_0025290 | Ga0501045_0025290_171_1229 | 352 |
| 80 | 3300002704 | JGI25155J39150_1000028 | JGI25155J39150_100002830 | 353 |
| 81 | 3300002705 | JGI25156J39149_1000013 | JGI25156J39149_100001383 | 353 |
| 82 | 3300002738 | JGI25154J39366_1000032 | JGI25154J39366_100003283 | 353 |
| 83 | 3300002741 | JGI25157J39369_1000017 | JGI25157J39369_100001783 | 353 |
| 84 | 3300003187 | JGI25151J46595_10001607 | JGI25151J46595_100016075 | 353 |
| 85 | 3300003759 | Ga0055525_1000047 | Ga0055525_100004737 | 353 |
| 86 | 3300005327 | Ga0070658_10006880 | Ga0070658_100068808 | 353 |
| 87 | 3300005327 | Ga0070658_10011248 | Ga0070658_100112486 | 353 |
| 88 | 3300005327 | Ga0070658_10044477 | Ga0070658_100444773 | 353 |
| 89 | 3300005329 | Ga0070683_100068801 | Ga0070683_1000688012 | 353 |
| 90 | 3300005338 | Ga0068868_100016415 | Ga0068868_1000164153 | 353 |
| 91 | 3300005339 | Ga0070660_100004993 | Ga0070660_1000049932 | 353 |
| 92 | 3300005339 | Ga0070660_100005123 | Ga0070660_1000051235 | 353 |
| 93 | 3300005339 | Ga0070660_100046983 | Ga0070660_1000469833 | 353 |
| 94 | 3300005365 | Ga0070688_100083551 | Ga0070688_1000835512 | 353 |
| 95 | 3300005435 | Ga0070714_100100274 | Ga0070714_1001002743 | 353 |
| 96 | 3300005440 | Ga0070705_100027109 | Ga0070705_1000271092 | 353 |
| 97 | 3300005444 | Ga0070694_100108417 | Ga0070694_1001084172 | 353 |
| 98 | 3300005445 | Ga0070708_100056023 | Ga0070708_1000560233 | 353 |
| 99 | 3300005455 | Ga0070663_100028872 | Ga0070663_1000288721 | 353 |
| 100 | 3300005457 | Ga0070662_100075648 | Ga0070662_1000756482 | 353 |
| 101 | 3300005466 | Ga0070685_10015243 | Ga0070685_100152434 | 353 |
| 102 | 3300005468 | Ga0070707_100072947 | Ga0070707_1000729474 | 353 |
| 103 | 3300005468 | Ga0070707_100284571 | Ga0070707_1002845711 | 353 |
| 104 | 3300005518 | Ga0070699_100011473 | Ga0070699_1000114735 | 353 |
| 105 | 3300005518 | Ga0070699_100012146 | Ga0070699_1000121465 | 353 |
| 106 | 3300005536 | Ga0070697_100001922 | Ga0070697_10000192214 | 353 |
| 107 | 3300005536 | Ga0070697_100214910 | Ga0070697_1002149101 | 353 |
| 108 | 3300005546 | Ga0070696_100001123 | Ga0070696_1000011232 | 353 |
| 109 | 3300005546 | Ga0070696_100022549 | Ga0070696_1000225494 | 353 |
| 110 | 3300005547 | Ga0070693_100067630 | Ga0070693_1000676302 | 353 |
| 111 | 3300005563 | Ga0068855_100004247 | Ga0068855_1000042478 | 353 |
| 112 | 3300005563 | Ga0068855_100023796 | Ga0068855_1000237965 | 353 |
| 113 | 3300005563 | Ga0068855_100101134 | Ga0068855_1001011342 | 353 |
| 114 | 3300005563 | Ga0068855_100153703 | Ga0068855_1001537032 | 353 |
| 115 | 3300005564 | Ga0070664_100042719 | Ga0070664_1000427194 | 353 |
| 116 | 3300005564 | Ga0070664_100123244 | Ga0070664_1001232442 | 353 |
| 117 | 3300005578 | Ga0068854_100000860 | Ga0068854_10000086014 | 353 |
| 118 | 3300005614 | Ga0068856_100008649 | Ga0068856_1000086497 | 353 |
| 119 | 3300005618 | Ga0068864_100177414 | Ga0068864_1001774142 | 353 |
| 120 | 3300005842 | Ga0068858_100009795 | Ga0068858_1000097957 | 353 |
| 121 | 3300005937 | Ga0081455_10083914 | Ga0081455_100839143 | 353 |
| 122 | 3300006048 | Ga0075363_100048578 | Ga0075363_1000485782 | 353 |
| 123 | 3300006173 | Ga0070716_100003928 | Ga0070716_1000039283 | 353 |
| 124 | 3300006175 | Ga0070712_100006429 | Ga0070712_1000064292 | 353 |
| 125 | 3300006177 | Ga0075362_10001998 | Ga0075362_100019986 | 353 |
| 126 | 3300006237 | Ga0097621_100025588 | Ga0097621_1000255883 | 353 |
| 127 | 3300006358 | Ga0068871_100045854 | Ga0068871_1000458542 | 353 |
| 128 | 3300006844 | Ga0075428_100064717 | Ga0075428_1000647173 | 353 |
| 129 | 3300006846 | Ga0075430_100002016 | Ga0075430_10000201614 | 353 |
| 130 | 3300006846 | Ga0075430_100048693 | Ga0075430_1000486932 | 353 |
| 131 | 3300006846 | Ga0075430_100089790 | Ga0075430_1000897901 | 353 |
| 132 | 3300006847 | Ga0075431_100000364 | Ga0075431_10000036421 | 353 |
| 133 | 3300006847 | Ga0075431_100002500 | Ga0075431_10000250018 | 353 |
| 134 | 3300006847 | Ga0075431_100029231 | Ga0075431_1000292313 | 353 |
| 135 | 3300006852 | Ga0075433_10014025 | Ga0075433_100140252 | 353 |
| 136 | 3300006880 | Ga0075429_100023304 | Ga0075429_1000233044 | 353 |
| 137 | 3300006880 | Ga0075429_100118927 | Ga0075429_1001189272 | 353 |
| 138 | 3300006931 | Ga0097620_100178620 | Ga0097620_1001786202 | 353 |
| 139 | 3300009093 | Ga0105240_10002013 | Ga0105240_1000201310 | 353 |
| 140 | 3300009093 | Ga0105240_10015675 | Ga0105240_100156752 | 353 |
| 141 | 3300009093 | Ga0105240_10023342 | Ga0105240_100233423 | 353 |
| 142 | 3300009093 | Ga0105240_10080289 | Ga0105240_100802892 | 353 |
| 143 | 3300009094 | Ga0111539_10011937 | Ga0111539_100119379 | 353 |
| 144 | 3300009094 | Ga0111539_10018275 | Ga0111539_100182754 | 353 |
| 145 | 3300009147 | Ga0114129_10004357 | Ga0114129_1000435717 | 353 |
| 146 | 3300009147 | Ga0114129_10255073 | Ga0114129_102550732 | 353 |
| 147 | 3300009147 | Ga0114129_10311021 | Ga0114129_103110212 | 353 |
| 148 | 3300009174 | Ga0105241_10002118 | Ga0105241_1000211814 | 353 |
| 149 | 3300009174 | Ga0105241_10085829 | Ga0105241_100858293 | 353 |
| 150 | 3300009176 | Ga0105242_10001278 | Ga0105242_1000127814 | 353 |
| 151 | 3300009176 | Ga0105242_10004433 | Ga0105242_100044338 | 353 |
| 152 | 3300009176 | Ga0105242_10069382 | Ga0105242_100693822 | 353 |
| 153 | 3300009177 | Ga0105248_10015852 | Ga0105248_100158524 | 353 |
| 154 | 3300009551 | Ga0105238_10331850 | Ga0105238_103318502 | 353 |
| 155 | 3300009553 | Ga0105249_10124581 | Ga0105249_101245812 | 353 |
| 156 | 3300010375 | Ga0105239_10037783 | Ga0105239_100377832 | 353 |
| 157 | 3300013102 | Ga0157371_10002796 | Ga0157371_1000279613 | 353 |
| 158 | 3300013104 | Ga0157370_10005186 | Ga0157370_100051863 | 353 |
| 159 | 3300013104 | Ga0157370_10005893 | Ga0157370_1000589312 | 353 |
| 160 | 3300013104 | Ga0157370_10018950 | Ga0157370_100189503 | 353 |
| 161 | 3300013105 | Ga0157369_10004352 | Ga0157369_100043522 | 353 |
| 162 | 3300013296 | Ga0157374_10006650 | Ga0157374_100066507 | 353 |
| 163 | 3300013297 | Ga0157378_10003575 | Ga0157378_100035756 | 353 |
| 164 | 3300013307 | Ga0157372_10139159 | Ga0157372_101391593 | 353 |
| 165 | 3300013308 | Ga0157375_10029392 | Ga0157375_100293925 | 353 |
| 166 | 3300014325 | Ga0163163_10135713 | Ga0163163_101357132 | 353 |
| 167 | 3300025206 | Ga0209435_100003 | Ga0209435_10000388 | 353 |
| 168 | 3300025230 | Ga0209563_100003 | Ga0209563_100003567 | 353 |
| 169 | 3300025245 | Ga0207425_1001030 | Ga0207425_10010304 | 353 |
| 170 | 3300025246 | Ga0209646_1000008 | Ga0209646_100000888 | 353 |
| 171 | 3300025250 | Ga0209026_1000007 | Ga0209026_100000788 | 353 |
| 172 | 3300025254 | Ga0209148_1002087 | Ga0209148_10020873 | 353 |
| 173 | 3300025256 | Ga0209759_1000026 | Ga0209759_1000026191 | 353 |
| 174 | 3300025263 | Ga0209565_1000758 | Ga0209565_100075816 | 353 |
| 175 | 3300025291 | Ga0209675_1001795 | Ga0209675_10017957 | 353 |
| 176 | 3300025294 | Ga0209025_1001036 | Ga0209025_100103615 | 353 |
| 177 | 3300025299 | Ga0209256_1017522 | Ga0209256_10175222 | 353 |
| 178 | 3300025903 | Ga0207680_10047440 | Ga0207680_100474403 | 353 |
| 179 | 3300025907 | Ga0207645_10232011 | Ga0207645_102320111 | 353 |
| 180 | 3300025908 | Ga0207643_10171287 | Ga0207643_101712872 | 353 |
| 181 | 3300025909 | Ga0207705_10000640 | Ga0207705_1000064014 | 353 |
| 182 | 3300025909 | Ga0207705_10002230 | Ga0207705_1000223013 | 353 |
| 183 | 3300025909 | Ga0207705_10030677 | Ga0207705_100306771 | 353 |
| 184 | 3300025910 | Ga0207684_10077709 | Ga0207684_100777092 | 353 |
| 185 | 3300025912 | Ga0207707_10142589 | Ga0207707_101425892 | 353 |
| 186 | 3300025913 | Ga0207695_10002190 | Ga0207695_1000219010 | 353 |
| 187 | 3300025913 | Ga0207695_10005662 | Ga0207695_100056624 | 353 |
| 188 | 3300025913 | Ga0207695_10020685 | Ga0207695_100206856 | 353 |
| 189 | 3300025913 | Ga0207695_10035180 | Ga0207695_100351803 | 353 |
| 190 | 3300025913 | Ga0207695_10237645 | Ga0207695_102376452 | 353 |
| 191 | 3300025913 | Ga0207695_10263640 | Ga0207695_102636402 | 353 |
| 192 | 3300025919 | Ga0207657_10000973 | Ga0207657_1000097326 | 353 |
| 193 | 3300025919 | Ga0207657_10008871 | Ga0207657_100088717 | 353 |
| 194 | 3300025919 | Ga0207657_10018985 | Ga0207657_100189854 | 353 |
| 195 | 3300025922 | Ga0207646_10036376 | Ga0207646_100363761 | 353 |
| 196 | 3300025922 | Ga0207646_10068247 | Ga0207646_100682472 | 353 |
| 197 | 3300025922 | Ga0207646_10099992 | Ga0207646_100999922 | 353 |
| 198 | 3300025927 | Ga0207687_10129006 | Ga0207687_101290062 | 353 |
| 199 | 3300025928 | Ga0207700_10022999 | Ga0207700_100229993 | 353 |
| 200 | 3300025929 | Ga0207664_10175542 | Ga0207664_101755422 | 353 |
| 201 | 3300025931 | Ga0207644_10004083 | Ga0207644_100040836 | 353 |
| 202 | 3300025932 | Ga0207690_10016606 | Ga0207690_100166064 | 353 |
| 203 | 3300025933 | Ga0207706_10088114 | Ga0207706_100881143 | 353 |
| 204 | 3300025933 | Ga0207706_10203966 | Ga0207706_102039661 | 353 |
| 205 | 3300025934 | Ga0207686_10047029 | Ga0207686_100470293 | 353 |
| 206 | 3300025936 | Ga0207670_10004820 | Ga0207670_100048207 | 353 |
| 207 | 3300025938 | Ga0207704_10135472 | Ga0207704_101354722 | 353 |
| 208 | 3300025939 | Ga0207665_10001989 | Ga0207665_100019895 | 353 |
| 209 | 3300025945 | Ga0207679_10136506 | Ga0207679_101365062 | 353 |
| 210 | 3300025949 | Ga0207667_10003719 | Ga0207667_100037196 | 353 |
| 211 | 3300025949 | Ga0207667_10028093 | Ga0207667_100280933 | 353 |
| 212 | 3300025949 | Ga0207667_10091215 | Ga0207667_100912153 | 353 |
| 213 | 3300025960 | Ga0207651_10010742 | Ga0207651_100107424 | 353 |
| 214 | 3300025981 | Ga0207640_10004526 | Ga0207640_100045264 | 353 |
| 215 | 3300026023 | Ga0207677_10020308 | Ga0207677_100203084 | 353 |
| 216 | 3300026067 | Ga0207678_10006453 | Ga0207678_1000645310 | 353 |
| 217 | 3300026067 | Ga0207678_10008719 | Ga0207678_100087195 | 353 |
| 218 | 3300026078 | Ga0207702_10060165 | Ga0207702_100601652 | 353 |
| 219 | 3300026078 | Ga0207702_10400535 | Ga0207702_104005351 | 353 |
| 220 | 3300026088 | Ga0207641_10067181 | Ga0207641_100671814 | 353 |
| 221 | 3300026088 | Ga0207641_10138204 | Ga0207641_101382042 | 353 |
| 222 | 3300026089 | Ga0207648_10074014 | Ga0207648_100740143 | 353 |
| 223 | 3300026095 | Ga0207676_10010440 | Ga0207676_100104402 | 353 |
| 224 | 3300026095 | Ga0207676_10080617 | Ga0207676_100806172 | 353 |
| 225 | 3300026121 | Ga0207683_10009611 | Ga0207683_100096112 | 353 |
| 226 | 3300027876 | Ga0209974_10021171 | Ga0209974_100211711 | 353 |
| 227 | 3300027907 | Ga0207428_10115080 | Ga0207428_101150802 | 353 |
| 228 | 3300031548 | Ga0307408_100024658 | Ga0307408_1000246582 | 353 |
| 229 | 3300031731 | Ga0307405_10125236 | Ga0307405_101252362 | 353 |
| 230 | 3300031824 | Ga0307413_10013140 | Ga0307413_100131403 | 353 |
| 231 | 3300031824 | Ga0307413_10014619 | Ga0307413_100146192 | 353 |
| 232 | 3300031824 | Ga0307413_10051933 | Ga0307413_100519331 | 353 |
| 233 | 3300031824 | Ga0307413_10064047 | Ga0307413_100640472 | 353 |
| 234 | 3300031852 | Ga0307410_10000629 | Ga0307410_100006297 | 353 |
| 235 | 3300031852 | Ga0307410_10012904 | Ga0307410_100129042 | 353 |
| 236 | 3300031852 | Ga0307410_10016990 | Ga0307410_100169902 | 353 |
| 237 | 3300031852 | Ga0307410_10028879 | Ga0307410_100288792 | 353 |
| 238 | 3300031852 | Ga0307410_10096515 | Ga0307410_100965151 | 353 |
| 239 | 3300031852 | Ga0307410_10181562 | Ga0307410_101815622 | 353 |
| 240 | 3300031901 | Ga0307406_10018586 | Ga0307406_100185862 | 353 |
| 241 | 3300031901 | Ga0307406_10154078 | Ga0307406_101540782 | 353 |
| 242 | 3300031903 | Ga0307407_10047245 | Ga0307407_100472452 | 353 |
| 243 | 3300031903 | Ga0307407_10054817 | Ga0307407_100548172 | 353 |
| 244 | 3300031903 | Ga0307407_10076331 | Ga0307407_100763312 | 353 |
| 245 | 3300031903 | Ga0307407_10087141 | Ga0307407_100871412 | 353 |
| 246 | 3300031903 | Ga0307407_10201086 | Ga0307407_102010861 | 353 |
| 247 | 3300031995 | Ga0307409_100000080 | Ga0307409_10000008019 | 353 |
| 248 | 3300031995 | Ga0307409_100063236 | Ga0307409_1000632362 | 353 |
| 249 | 3300032002 | Ga0307416_100000433 | Ga0307416_10000043313 | 353 |
| 250 | 3300032002 | Ga0307416_100001388 | Ga0307416_10000138812 | 353 |
| 251 | 3300032002 | Ga0307416_100079432 | Ga0307416_1000794322 | 353 |
| 252 | 3300032002 | Ga0307416_100135136 | Ga0307416_1001351362 | 353 |
| 253 | 3300032004 | Ga0307414_10007884 | Ga0307414_100078845 | 353 |
| 254 | 3300032004 | Ga0307414_10019795 | Ga0307414_100197952 | 353 |
| 255 | 3300032005 | Ga0307411_10000388 | Ga0307411_100003886 | 353 |
| 256 | 3300032005 | Ga0307411_10004258 | Ga0307411_100042582 | 353 |
| 257 | 3300032005 | Ga0307411_10007269 | Ga0307411_100072693 | 353 |
| 258 | 3300032005 | Ga0307411_10135524 | Ga0307411_101355242 | 353 |
| 259 | 3300032126 | Ga0307415_100000280 | Ga0307415_1000002805 | 353 |
| 260 | 3300032126 | Ga0307415_100163467 | Ga0307415_1001634672 | 353 |
| 261 | 3300035172 | Ga0373955_0106534 | Ga0373955_0106534_471_1532 | 353 |
| 262 | 3300035241 | Ga0373961_0014655 | Ga0373961_0014655_116_1177 | 353 |
| 263 | 3300037312 | Ga0395899_0003829 | Ga0395899_0003829_10385_11446 | 353 |
| 264 | 3300037312 | Ga0395899_0020667 | Ga0395899_0020667_1959_3020 | 353 |
| 265 | 3300037312 | Ga0395899_0024721 | Ga0395899_0024721_1646_2707 | 353 |
| 266 | 3300037312 | Ga0395899_0033563 | Ga0395899_0033563_2288_3349 | 353 |
| 267 | 3300037312 | Ga0395899_0048119 | Ga0395899_0048119_1079_2152 | 353 |
| 268 | 3300037312 | Ga0395899_0127327 | Ga0395899_0127327_501_1562 | 353 |
| 269 | 3300037418 | Ga0395900_0000331 | Ga0395900_0000331_28591_29652 | 353 |
| 270 | 3300037418 | Ga0395900_0000763 | Ga0395900_0000763_29881_30942 | 353 |
| 271 | 3300037418 | Ga0395900_0003744 | Ga0395900_0003744_8710_9783 | 353 |
| 272 | 3300037418 | Ga0395900_0004504 | Ga0395900_0004504_12349_13410 | 353 |
| 273 | 3300037418 | Ga0395900_0063442 | Ga0395900_0063442_864_1925 | 353 |
| 274 | 3300037418 | Ga0395900_0131765 | Ga0395900_0131765_650_1711 | 353 |
| 275 | 3300037466 | Ga0395898_0085197 | Ga0395898_0085197_1437_2510 | 353 |
| 276 | 3300037471 | Ga0395905_0004263 | Ga0395905_0004263_6646_7719 | 353 |
| 277 | 3300038443 | Ga0395901_0000003 | Ga0395901_0000003_295834_296895 | 353 |
| 278 | 3300038443 | Ga0395901_0000097 | Ga0395901_0000097_62267_63328 | 353 |
| 279 | 3300038443 | Ga0395901_0001055 | Ga0395901_0001055_9293_10366 | 353 |
| 280 | 3300038443 | Ga0395901_0077622 | Ga0395901_0077622_2001_3062 | 353 |
| 281 | 3300038996 | Ga0242420_001097 | Ga0242420_001097_1350_2411 | 353 |
| 282 | 3300039450 | Ga0436363_0283447 | Ga0436363_0283447_3934_4995 | 353 |
| 283 | 3300041406 | Ga0439439_0002360 | Ga0439439_0002360_1089_2150 | 353 |
| 284 | 3300042005 | Ga0439448_0000646 | Ga0439448_0000646_3919_4980 | 353 |
| 285 | 3300042007 | Ga0439449_0016445 | Ga0439449_0016445_1498_2559 | 353 |
| 286 | 3300042012 | Ga0439455_0002698 | Ga0439455_0002698_1706_2767 | 353 |
| 287 | 3300042012 | Ga0439455_0033108 | Ga0439455_0033108_112_1179 | 353 |
| 288 | 3300042134 | Ga0450898_009105 | Ga0450898_009105_491_1552 | 353 |
| 289 | 3300042157 | Ga0439458_0005842 | Ga0439458_0005842_833_1894 | 353 |
| 290 | 3300044656 | Ga0466969_0013595 | Ga0466969_0013595_3213_4274 | 353 |
| 291 | 3300044658 | Ga0466972_0000657 | Ga0466972_0000657_13392_14453 | 353 |
| 292 | 3300044658 | Ga0466972_0061160 | Ga0466972_0061160_621_1682 | 353 |
| 293 | 3300044673 | Ga0453683_0231676 | Ga0453683_0231676_99_1160 | 353 |
| 294 | 3300044683 | Ga0466965_0005611 | Ga0466965_0005611_2474_3535 | 353 |
| 295 | 3300044683 | Ga0466965_0096761 | Ga0466965_0096761_313_1374 | 353 |
| 296 | 3300044684 | Ga0466966_0011506 | Ga0466966_0011506_3292_4353 | 353 |
| 297 | 3300044693 | Ga0466961_0019736 | Ga0466961_0019736_134_1195 | 353 |
| 298 | 3300044693 | Ga0466961_0124267 | Ga0466961_0124267_78_1139 | 353 |
| 299 | 3300044706 | Ga0466964_0000327 | Ga0466964_0000327_6770_7831 | 353 |
| 300 | 3300044706 | Ga0466964_0030434 | Ga0466964_0030434_784_1845 | 353 |
| 301 | 3300044719 | Ga0466971_0060750 | Ga0466971_0060750_515_1576 | 353 |
| 302 | 3300044735 | Ga0466968_0102533 | Ga0466968_0102533_84_1145 | 353 |
| 303 | 3300044842 | Ga0466957_0000007 | Ga0466957_0000007_52224_53285 | 353 |
| 304 | 3300045049 | Ga0466959_0004938 | Ga0466959_0004938_7896_8957 | 353 |
| 305 | 3300045976 | Ga0466967_0008718 | Ga0466967_0008718_4689_5750 | 353 |
| 306 | 3300045976 | Ga0466967_0087736 | Ga0466967_0087736_1731_2792 | 353 |
| 307 | 3300046472 | Ga0495580_0001312 | Ga0495580_0001312_2447_3508 | 353 |
| 308 | 3300046472 | Ga0495580_0017904 | Ga0495580_0017904_573_1634 | 353 |
| 309 | 3300046491 | Ga0495584_0000097 | Ga0495584_0000097_27356_28417 | 353 |
| 310 | 3300046491 | Ga0495584_0014823 | Ga0495584_0014823_780_1841 | 353 |
| 311 | 3300046501 | Ga0495607_0000524 | Ga0495607_0000524_31703_32764 | 353 |
| 312 | 3300046507 | Ga0495606_0007078 | Ga0495606_0007078_2670_3731 | 353 |
| 313 | 3300046513 | Ga0495616_0001262 | Ga0495616_0001262_5802_6863 | 353 |
| 314 | 3300046514 | Ga0495618_0175986 | Ga0495618_0175986_262_1323 | 353 |
| 315 | 3300046528 | Ga0495642_0000065 | Ga0495642_0000065_37054_38115 | 353 |
| 316 | 3300046538 | Ga0495609_0000030 | Ga0495609_0000030_126098_127159 | 353 |
| 317 | 3300046543 | Ga0495645_0021148 | Ga0495645_0021148_1529_2590 | 353 |
| 318 | 3300046615 | Ga0495656_0010492 | Ga0495656_0010492_273_1334 | 353 |
| 319 | 3300046660 | Ga0495625_0018491 | Ga0495625_0018491_2339_3400 | 353 |
| 320 | 3300046665 | Ga0495661_0000209 | Ga0495661_0000209_34959_36020 | 353 |
| 321 | 3300046674 | Ga0495588_0000078 | Ga0495588_0000078_186_1247 | 353 |
| 322 | 3300046683 | Ga0495658_0025106 | Ga0495658_0025106_175_1236 | 353 |
| 323 | 3300046794 | Ga0495589_0000021 | Ga0495589_0000021_126398_127459 | 353 |
| 324 | 3300047319 | Ga0495674_0056790 | Ga0495674_0056790_822_1883 | 353 |
| 325 | 3300047443 | Ga0495687_000276 | Ga0495687_000276_31773_32834 | 353 |
| 326 | 3300047443 | Ga0495687_000319 | Ga0495687_000319_35792_36853 | 353 |
| 327 | 3300047445 | Ga0495677_0000050 | Ga0495677_0000050_35350_36411 | 353 |
| 328 | 3300048904 | Ga0496101_0024481 | Ga0496101_0024481_2510_3571 | 353 |
| 329 | 3300048905 | Ga0496102_0000598 | Ga0496102_0000598_24148_25209 | 353 |
| 330 | 3300048905 | Ga0496102_0010261 | Ga0496102_0010261_1956_3017 | 353 |
| 331 | 3300048905 | Ga0496102_0274197 | Ga0496102_0274197_70_1131 | 353 |
| 332 | 3300048905 | Ga0496102_0368315 | Ga0496102_0368315_180_1241 | 353 |
| 333 | 3300048906 | Ga0496103_0036884 | Ga0496103_0036884_1362_2423 | 353 |
| 334 | 3300048907 | Ga0496104_0001146 | Ga0496104_0001146_9856_10917 | 353 |
| 335 | 3300048907 | Ga0496104_0014907 | Ga0496104_0014907_1481_2542 | 353 |
| 336 | 3300048907 | Ga0496104_0155736 | Ga0496104_0155736_132_1193 | 353 |
| 337 | 3300048908 | Ga0496105_0086968 | Ga0496105_0086968_682_1743 | 353 |
| 338 | 3300048909 | Ga0496106_0001474 | Ga0496106_0001474_12031_13092 | 353 |
| 339 | 3300048909 | Ga0496106_0006465 | Ga0496106_0006465_380_1441 | 353 |
| 340 | 3300048909 | Ga0496106_0097510 | Ga0496106_0097510_848_1909 | 353 |
| 341 | 3300048910 | Ga0496107_0032332 | Ga0496107_0032332_326_1387 | 353 |
| 342 | 3300048910 | Ga0496107_0132853 | Ga0496107_0132853_183_1244 | 353 |
| 343 | 3300048911 | Ga0496108_0001195 | Ga0496108_0001195_2928_3989 | 353 |
| 344 | 3300048911 | Ga0496108_0076438 | Ga0496108_0076438_191_1252 | 353 |
| 345 | 3300048911 | Ga0496108_0324367 | Ga0496108_0324367_80_1141 | 353 |
| 346 | 3300048912 | Ga0496109_0023070 | Ga0496109_0023070_2258_3319 | 353 |
| 347 | 3300048912 | Ga0496109_0034013 | Ga0496109_0034013_2780_3841 | 353 |
| 348 | 3300048912 | Ga0496109_0242203 | Ga0496109_0242203_189_1250 | 353 |
| 349 | 3300048913 | Ga0496110_0006030 | Ga0496110_0006030_6545_7606 | 353 |
| 350 | 3300048913 | Ga0496110_0026898 | Ga0496110_0026898_2293_3354 | 353 |
| 351 | 3300048914 | Ga0496111_0002920 | Ga0496111_0002920_3495_4556 | 353 |
| 352 | 3300048915 | Ga0496112_0002488 | Ga0496112_0002488_11363_12424 | 353 |
| 353 | 3300048915 | Ga0496112_0070724 | Ga0496112_0070724_688_1749 | 353 |
| 354 | 3300048915 | Ga0496112_0178625 | Ga0496112_0178625_79_1140 | 353 |
| 355 | 3300048916 | Ga0496113_0000701 | Ga0496113_0000701_3251_4312 | 353 |
| 356 | 3300048916 | Ga0496113_0003376 | Ga0496113_0003376_1004_2065 | 353 |
| 357 | 3300048916 | Ga0496113_0007063 | Ga0496113_0007063_5370_6431 | 353 |
| 358 | 3300048918 | Ga0496115_0043004 | Ga0496115_0043004_132_1193 | 353 |
| 359 | 3300048918 | Ga0496115_0226025 | Ga0496115_0226025_192_1253 | 353 |
| 360 | 3300048924 | Ga0496121_0004923 | Ga0496121_0004923_4872_5933 | 353 |
| 361 | 3300048924 | Ga0496121_0010378 | Ga0496121_0010378_6757_7818 | 353 |
| 362 | 3300048925 | Ga0496122_0002607 | Ga0496122_0002607_17709_18770 | 353 |
| 363 | 3300048927 | Ga0496124_0009546 | Ga0496124_0009546_4008_5069 | 353 |
| 364 | 3300048928 | Ga0496125_0120253 | Ga0496125_0120253_232_1293 | 353 |
| 365 | 3300048929 | Ga0496126_0001621 | Ga0496126_0001621_18663_19724 | 353 |
| 366 | 3300049523 | Ga0501300_003011 | Ga0501300_003011_499_1560 | 353 |
| 367 | 3300049570 | Ga0501033_0065261 | Ga0501033_0065261_899_1960 | 353 |
| 368 | 3300049571 | Ga0501034_0002147 | Ga0501034_0002147_8744_9805 | 353 |
| 369 | 3300049572 | Ga0501036_0084140 | Ga0501036_0084140_475_1536 | 353 |
| 370 | 3300049574 | Ga0501038_0159855 | Ga0501038_0159855_286_1347 | 353 |
| 371 | 3300049575 | Ga0501039_0029298 | Ga0501039_0029298_557_1618 | 353 |
| 372 | 3300049576 | Ga0501040_0012256 | Ga0501040_0012256_1976_3037 | 353 |
| 373 | 3300049577 | Ga0501041_0027967 | Ga0501041_0027967_209_1270 | 353 |
| 374 | 3300049581 | Ga0501047_0085092 | Ga0501047_0085092_1278_2339 | 353 |
| 375 | 3300049583 | Ga0501067_0001949 | Ga0501067_0001949_8294_9355 | 353 |
| 376 | 3300049583 | Ga0501067_0031689 | Ga0501067_0031689_1195_2256 | 353 |
| 377 | 3300049583 | Ga0501067_0039952 | Ga0501067_0039952_504_1565 | 353 |
| 378 | 3300049583 | Ga0501067_0075973 | Ga0501067_0075973_394_1455 | 353 |
| 379 | 3300049584 | Ga0501068_0000282 | Ga0501068_0000282_6650_7711 | 353 |
| 380 | 3300049584 | Ga0501068_0002719 | Ga0501068_0002719_7276_8337 | 353 |
| 381 | 3300049585 | Ga0501069_0000249 | Ga0501069_0000249_11730_12791 | 353 |
| 382 | 3300049585 | Ga0501069_0003100 | Ga0501069_0003100_6274_7335 | 353 |
| 383 | 3300049585 | Ga0501069_0016452 | Ga0501069_0016452_2671_3732 | 353 |
| 384 | 3300049585 | Ga0501069_0066238 | Ga0501069_0066238_931_1992 | 353 |
| 385 | 3300049586 | Ga0501070_0007323 | Ga0501070_0007323_6514_7575 | 353 |
| 386 | 3300049586 | Ga0501070_0009089 | Ga0501070_0009089_827_1888 | 353 |
| 387 | 3300049586 | Ga0501070_0030297 | Ga0501070_0030297_1817_2878 | 353 |
| 388 | 3300049586 | Ga0501070_0112289 | Ga0501070_0112289_582_1643 | 353 |
| 389 | 3300049587 | Ga0501071_0003950 | Ga0501071_0003950_7204_8265 | 353 |
| 390 | 3300049587 | Ga0501071_0004594 | Ga0501071_0004594_1091_2152 | 353 |
| 391 | 3300049588 | Ga0501072_0000197 | Ga0501072_0000197_36040_37101 | 353 |
| 392 | 3300049588 | Ga0501072_0105448 | Ga0501072_0105448_178_1239 | 353 |
| 393 | 3300049588 | Ga0501072_0140137 | Ga0501072_0140137_720_1781 | 353 |
| 394 | 3300049589 | Ga0501073_0006478 | Ga0501073_0006478_1161_2222 | 353 |
| 395 | 3300049589 | Ga0501073_0007528 | Ga0501073_0007528_656_1717 | 353 |
| 396 | 3300049590 | Ga0501074_0001562 | Ga0501074_0001562_118_1179 | 353 |
| 397 | 3300049590 | Ga0501074_0002319 | Ga0501074_0002319_6504_7565 | 353 |
| 398 | 3300049590 | Ga0501074_0098589 | Ga0501074_0098589_129_1190 | 353 |
| 399 | 3300049591 | Ga0501075_0050040 | Ga0501075_0050040_1383_2444 | 353 |
| 400 | 3300049592 | Ga0501076_0067872 | Ga0501076_0067872_1775_2836 | 353 |
| 401 | 3300049593 | Ga0501077_0002017 | Ga0501077_0002017_1988_3049 | 353 |
| 402 | 3300049653 | Ga0501206_003424 | Ga0501206_003424_612_1790 | 353 |
| 403 | 3300049656 | Ga0501209_006305 | Ga0501209_006305_983_2161 | 353 |
| 404 | 3300049660 | Ga0501216_001022 | Ga0501216_001022_531_1709 | 353 |
| 405 | 3300049669 | Ga0501235_006898 | Ga0501235_006898_262_1323 | 353 |
| 406 | 3300049672 | Ga0501239_000555 | Ga0501239_000555_1146_2324 | 353 |
| 407 | 3300049679 | Ga0501249_012048 | Ga0501249_012048_343_1404 | 353 |
| 408 | 3300049742 | Ga0501080_0001113 | Ga0501080_0001113_6517_7578 | 353 |
| 409 | 3300049742 | Ga0501080_0016734 | Ga0501080_0016734_638_1699 | 353 |
| 410 | 3300049742 | Ga0501080_0160701 | Ga0501080_0160701_84_1145 | 353 |
| 411 | 3300049743 | Ga0501081_0259725 | Ga0501081_0259725_96_1157 | 353 |
| 412 | 3300049744 | Ga0501083_0000798 | Ga0501083_0000798_8390_9451 | 353 |
| 413 | 3300049744 | Ga0501083_0001548 | Ga0501083_0001548_6381_7442 | 353 |
| 414 | 3300049770 | Ga0501273_000907 | Ga0501273_000907_138_1199 | 353 |
| 415 | 3300049822 | Ga0501035_0002683 | Ga0501035_0002683_12009_13070 | 353 |
| 416 | 3300049822 | Ga0501035_0064784 | Ga0501035_0064784_1474_2535 | 353 |
| 417 | 3300049823 | Ga0501044_0275205 | Ga0501044_0275205_89_1150 | 353 |
| 418 | 3300049824 | Ga0501045_0034223 | Ga0501045_0034223_2261_3322 | 353 |
| 419 | 3300050507 | nmdc:mga05p37_3119_c1 | nmdc:mga05p37_3119_c1_10968_12029 | 353 |
| 420 | 3300050507 | nmdc:mga05p37_437323_c1 | nmdc:mga05p37_437323_c1_306_1367 | 353 |
| 421 | 3300050508 | nmdc:mga09592_49579_c1 | nmdc:mga09592_49579_c1_324_1403 | 353 |
| 422 | 3300050509 | nmdc:mga0qj67_64914_c1 | nmdc:mga0qj67_64914_c1_866_1927 | 353 |
| 423 | 3300050510 | nmdc:mga06r32_2236_c1 | nmdc:mga06r32_2236_c1_4914_5975 | 353 |
| 424 | 3300050510 | nmdc:mga06r32_297118_c1 | nmdc:mga06r32_297118_c1_304_1365 | 353 |
| 425 | 3300050510 | nmdc:mga06r32_42639_c1 | nmdc:mga06r32_42639_c1_1985_3046 | 353 |
| 426 | 3300050510 | nmdc:mga06r32_499419_c1 | nmdc:mga06r32_499419_c1_114_1175 | 353 |
| 427 | 3300050510 | nmdc:mga06r32_55518_c1 | nmdc:mga06r32_55518_c1_2268_3329 | 353 |
| 428 | 3300050511 | nmdc:mga08y16_2466_c1 | nmdc:mga08y16_2466_c1_1926_2987 | 353 |
| 429 | 3300050511 | nmdc:mga08y16_95033_c1 | nmdc:mga08y16_95033_c1_586_1647 | 353 |
| 430 | 3300050513 | nmdc:mga0rr50_56247_c1 | nmdc:mga0rr50_56247_c1_380_1459 | 353 |
| 431 | 3300050515 | nmdc:mga0a205_134981_c1 | nmdc:mga0a205_134981_c1_1148_2209 | 353 |
| 432 | 3300054114 | Ga0501084_0002833 | Ga0501084_0002833_7077_8138 | 353 |
| 433 | 3300054114 | Ga0501084_0002944 | Ga0501084_0002944_7248_8309 | 353 |
| 434 | 3300054114 | Ga0501084_0197222 | Ga0501084_0197222_535_1596 | 353 |
| 435 | 3300059421 | Ga0590071_001243 | Ga0590071_001243_3154_4215 | 353 |
| 436 | 3300059421 | Ga0590071_002564 | Ga0590071_002564_1707_2768 | 353 |
| 437 | 3300059424 | Ga0590075_014398 | Ga0590075_014398_565_1626 | 353 |
| 438 | 3300059426 | Ga0590077_005273 | Ga0590077_005273_678_1739 | 353 |
| 439 | 3300060353 | Ga0501082_0003671 | Ga0501082_0003671_6514_7575 | 353 |
| 440 | 3300060353 | Ga0501082_0007888 | Ga0501082_0007888_7043_8104 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q2k-assembly1.cif.gz_E | crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca | 0.9953 | 11 | 352 |
| 3q2k-assembly2.cif.gz_P | crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca | 0.9951 | 11 | 352 |
| 3q2k-assembly2.cif.gz_L | crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca | 0.9941 | 11 | 352 |
| 3q2k-assembly2.cif.gz_O | crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca | 0.9933 | 7 | 352 |
| 3q2k-assembly1.cif.gz_E | crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca | 0.9922 | 11 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q2kD02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9949 | 141 | 352 | 3.30.360.10 |
| 3q2kH01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9841 | 11 | 141 | 3.40.50.720 |
| 3q2kD02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9827 | 141 | 352 | 3.30.360.10 |
| af_P39353_1_125_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9527 | 13 | 130 | 3.40.50.720 |
| af_Q04869_4_115_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.952 | 13 | 119 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N1WB29-F1-model_v4 | Oxidoreductase | 0.9898 | 9 | 148 |
GO:0000166
|
| AF-Q9KHV5-F1-model_v4 | WlbA | 0.9861 | 5 | 131 |
GO:0000166
|
| AF-Q9KHV5-F1-model_v4 | WlbA | 0.9783 | 5 | 131 |
GO:0000166
|
| AF-A0A011QT55-F1-model_v4 | 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.1.1.312) | 0.9765 | 1 | 130 |
GO:0000166
GO:0050606 |
| AF-A0A2N1WB29-F1-model_v4 | Oxidoreductase | 0.9759 | 9 | 148 |
GO:0000166
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar