F444586

General Info

Members Datasets Scaffolds Average Seq Length
441 310 882 202

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100012154|Ga0070683_1000121547
Length 225
Sequence VQDAVFKKTKLCVNLSLSEIIMASVPKVLVLYYSAYGHIETMAYAEADGARAAGAHVDIKRVPELVPEDVARNAHFKLDQAAPIARIDDLADYDAVIVGAGTRFGRLPSQLASFLDQAGGLWQRGAMHGKVGGAFSCSATQHGGQETTLFSIITNLLHFGMVIVGMDYGHAGQMTLAEITGGSPYGATTIAGSDGSRKPTENELQGARYQGRKIAETAKRLVQGQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
200 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
201 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
202 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
270 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
282 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
283 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
284 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
285 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
286 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
287 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
288 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
289 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
290 2643221640 Caulobacter sp. Root342 Isolate Unclassified
291 2643221642 Caulobacter sp. Root343 Isolate Unclassified
292 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
293 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
294 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
295 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
296 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
297 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
298 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
299 2884411467 Dyella sp. AD56 Isolate Rhizosphere
300 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
301 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
302 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
303 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
304 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
305 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
306 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
307 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
308 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
309 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
310 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.52
Metatranscriptomes 0
Isolates 7.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 13.38
Nodule 0.68
Rhizoplane 4.54
Rhizosphere 72.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100012154 3300005329 Bacteria 7472
2 JGI24739J22299_10000187 3300001989 Bacteria 20509
3 JGI24739J22299_10004073 3300001989 Bacteria 5588
4 JGI24738J21930_10013414 3300002075 Bacteria 1773
5 JGI25150J39212_1000398 3300002774 Bacteria 20361
6 JGI25151J46595_10050349 3300003187 Bacteria 1420
7 JGI25153J46596_10000091 3300003215 Bacteria 105614
8 JGI25153J46596_10015585 3300003215 Bacteria 3087
9 rootL2_10181224 3300003322 Bacteria 3591
10 Ga0055526_1011643 3300003771 Bacteria 3937
11 Ga0055537_1001470 3300003773 Bacteria 9160
12 Ga0055537_1001547 3300003773 Bacteria 8796
13 Ga0055524_1001171 3300003775 Bacteria 15663
14 Ga0055536_1022900 3300003781 Bacteria 1849
15 Ga0055530_10038540 3300003791 Bacteria 1187
16 Ga0055540_1003107 3300003792 Bacteria 8242
17 Ga0055531_10000116 3300003794 Bacteria 88368
18 Ga0055531_10016434 3300003794 Bacteria 3191
19 Ga0070676_10114046 3300005328 Bacteria 1687
20 Ga0070683_100645829 3300005329 Bacteria 1013
21 Ga0070690_100011616 3300005330 Bacteria 5155
22 Ga0070690_100068072 3300005330 Bacteria 2309
23 Ga0070670_100015212 3300005331 Bacteria 6604
24 Ga0070670_100367459 3300005331 Bacteria 1266
25 Ga0070666_10032078 3300005335 Bacteria 3469
26 Ga0070680_100295190 3300005336 Bacteria 1374
27 Ga0070689_100005535 3300005340 Bacteria 8640
28 Ga0070687_100322212 3300005343 Bacteria 988
29 Ga0070669_100000048 3300005353 Bacteria 118472
30 Ga0070669_100078138 3300005353 Bacteria 2459
31 Ga0070669_100199859 3300005353 Bacteria 1572
32 Ga0070671_100434795 3300005355 Bacteria 1125
33 Ga0070674_100074560 3300005356 Bacteria 2408
34 Ga0070688_100156024 3300005365 Bacteria 1564
35 Ga0070667_100013798 3300005367 Bacteria 6678
36 Ga0070667_100196335 3300005367 Bacteria 1789
37 Ga0070667_100410982 3300005367 Bacteria 1233
38 Ga0070667_101008622 3300005367 Bacteria 777
39 Ga0070703_10147694 3300005406 Bacteria 880
40 Ga0070709_10167097 3300005434 Bacteria 1534
41 Ga0070709_10723891 3300005434 Bacteria 776
42 Ga0070714_100465814 3300005435 Bacteria 1202
43 Ga0070713_100218775 3300005436 Bacteria 1727
44 Ga0070713_100261759 3300005436 Bacteria 1581
45 Ga0070713_100292313 3300005436 Bacteria 1498
46 Ga0070701_10019277 3300005438 Bacteria 3220
47 Ga0070711_100488195 3300005439 Bacteria 1014
48 Ga0070700_100082962 3300005441 Bacteria 2074
49 Ga0070700_100105616 3300005441 Bacteria 1863
50 Ga0070663_100181016 3300005455 Bacteria 1635
51 Ga0070678_100103936 3300005456 Bacteria 2208
52 Ga0070662_100111467 3300005457 Bacteria 2085
53 Ga0070662_100628624 3300005457 Bacteria 905
54 Ga0070681_10061334 3300005458 Bacteria 3735
55 Ga0068867_100210568 3300005459 Bacteria 1561
56 Ga0070698_100244150 3300005471 Bacteria 1729
57 Ga0070684_100038055 3300005535 Bacteria 4130
58 Ga0068853_100003308 3300005539 Bacteria 12328
59 Ga0070672_100013803 3300005543 Bacteria 5713
60 Ga0070672_100018096 3300005543 Bacteria 5086
61 Ga0070686_100011665 3300005544 Bacteria 4992
62 Ga0070695_100025959 3300005545 Bacteria 3622
63 Ga0070693_100350753 3300005547 Bacteria 1010
64 Ga0070665_100001518 3300005548 Bacteria 26902
65 Ga0070665_100033290 3300005548 Bacteria 5187
66 Ga0070665_100442050 3300005548 Bacteria 1310
67 Ga0068855_100829450 3300005563 Bacteria 981
68 Ga0068857_100015451 3300005577 Bacteria 6668
69 Ga0068857_100100477 3300005577 Bacteria 2595
70 Ga0068857_100476835 3300005577 Bacteria 1169
71 Ga0068854_100103914 3300005578 Bacteria 2133
72 Ga0068854_100114747 3300005578 Bacteria 2037
73 Ga0068856_100166150 3300005614 Bacteria 2218
74 Ga0070702_100023095 3300005615 Bacteria 3300
75 Ga0070702_100319660 3300005615 Bacteria 1081
76 Ga0068852_100040621 3300005616 Bacteria 3926
77 Ga0068852_100161441 3300005616 Bacteria 2093
78 Ga0068852_100616019 3300005616 Bacteria 1091
79 Ga0068859_100080765 3300005617 Bacteria 3293
80 Ga0068859_100080948 3300005617 Bacteria 3289
81 Ga0068864_100030628 3300005618 Bacteria 4561
82 Ga0068864_100176295 3300005618 Bacteria 1952
83 Ga0068861_100013245 3300005719 Bacteria 5769
84 Ga0068861_100023529 3300005719 Bacteria 4444
85 Ga0068870_10263909 3300005840 Bacteria 1073
86 Ga0068863_100009439 3300005841 Bacteria 9522
87 Ga0068858_100042308 3300005842 Bacteria 4224
88 Ga0068858_100514419 3300005842 Bacteria 1157
89 Ga0068860_100003140 3300005843 Bacteria 17062
90 Ga0068862_100000128 3300005844 Bacteria 88625
91 Ga0068862_100018129 3300005844 Bacteria 5862
92 Ga0081540_1079531 3300005983 Bacteria 1482
93 Ga0081540_1110481 3300005983 Bacteria 1163
94 Ga0070715_10006908 3300006163 Bacteria 3882
95 Ga0070716_100093407 3300006173 Bacteria 1826
96 Ga0070716_100478570 3300006173 Bacteria 914
97 Ga0070712_100301214 3300006175 Bacteria 1298
98 Ga0070712_100434911 3300006175 Bacteria 1090
99 Ga0070712_100499769 3300006175 Bacteria 1019
100 Ga0070712_100504633 3300006175 Bacteria 1014
101 Ga0070712_100539682 3300006175 Bacteria 982
102 Ga0075367_10140624 3300006178 Bacteria 1495
103 Ga0097621_100005591 3300006237 Bacteria 8862
104 Ga0097621_100035992 3300006237 Bacteria 3957
105 Ga0097621_100164191 3300006237 Bacteria 1911
106 Ga0068871_100009486 3300006358 Bacteria 7056
107 Ga0075428_100192132 3300006844 Bacteria 2208
108 Ga0075431_100033581 3300006847 Bacteria 5287
109 Ga0075434_100616883 3300006871 Bacteria 1104
110 Ga0075429_100033627 3300006880 Bacteria 4455
111 Ga0068865_100556386 3300006881 Bacteria 964
112 Ga0097620_100080771 3300006931 Bacteria 3293
113 Ga0097620_100080948 3300006931 Bacteria 3289
114 Ga0079104_1025245 3300006946 Bacteria 1554
115 Ga0099795_10135000 3300007788 Bacteria 999
116 Ga0099795_10144347 3300007788 Bacteria 970
117 Ga0105240_10271431 3300009093 Bacteria 1952
118 Ga0105240_10424330 3300009093 Bacteria 1493
119 Ga0105240_10823402 3300009093 Bacteria 1004
120 Ga0111539_10004917 3300009094 Bacteria 17386
121 Ga0105245_10059426 3300009098 Bacteria 3443
122 Ga0105247_10301597 3300009101 Bacteria 1112
123 Ga0105241_10040059 3300009174 Bacteria 3536
124 Ga0105248_10006025 3300009177 Bacteria 13310
125 Ga0105237_10055213 3300009545 Bacteria 3979
126 Ga0105237_10356146 3300009545 Bacteria 1468
127 Ga0105238_10003746 3300009551 Bacteria 15114
128 Ga0105238_10415273 3300009551 Bacteria 1340
129 Ga0105249_10017944 3300009553 Bacteria 6288
130 Ga0099796_10018016 3300010159 Bacteria 2113
131 Ga0105239_10210111 3300010375 Bacteria 2181
132 Ga0105239_10479976 3300010375 Bacteria 1412
133 Ga0157369_10000203 3300013105 Bacteria 82075
134 Ga0157369_10047048 3300013105 Bacteria 4686
135 Ga0157374_10014743 3300013296 Bacteria 6845
136 Ga0163162_11091412 3300013306 Bacteria 904
137 Ga0157372_11089811 3300013307 Bacteria 924
138 Ga0157375_10008148 3300013308 Bacteria 9168
139 Ga0157375_10058145 3300013308 Bacteria 3825
140 Ga0163163_10010812 3300014325 Bacteria 8239
141 Ga0157380_10001615 3300014326 Bacteria 14859
142 Ga0157380_10001902 3300014326 Bacteria 13842
143 Ga0157380_10019159 3300014326 Bacteria 5097
144 Ga0157379_10040277 3300014968 Bacteria 4169
145 Ga0157379_10493701 3300014968 Bacteria 1134
146 Ga0157376_10012042 3300014969 Bacteria 6402
147 Ga0157376_10438534 3300014969 Bacteria 1271
148 Ga0157376_10514801 3300014969 Bacteria 1178
149 Ga0183363_1006 3300015690 Bacteria 400466
150 Ga0213872_10200437 3300021361 Bacteria 856
151 Ga0207425_1000049 3300025245 Bacteria 180735
152 Ga0209129_1001668 3300025258 Bacteria 12020
153 Ga0209565_1000007 3300025263 Bacteria 784361
154 Ga0209565_1000170 3300025263 Bacteria 84580
155 Ga0209673_1007604 3300025273 Bacteria 4953
156 Ga0209673_1011741 3300025273 Bacteria 3587
157 Ga0209673_1026853 3300025273 Bacteria 1883
158 Ga0209675_1004240 3300025291 Bacteria 6463
159 Ga0209025_1000068 3300025294 Bacteria 294129
160 Ga0209564_1000003 3300025295 Bacteria 1585848
161 Ga0209564_1000335 3300025295 Bacteria 91079
162 Ga0209758_1000004 3300025297 Bacteria 1375322
163 Ga0209758_1011544 3300025297 Bacteria 5098
164 Ga0209050_1000001 3300025298 Bacteria 3563507
165 Ga0209050_1000196 3300025298 Bacteria 135678
166 Ga0209050_1006899 3300025298 Bacteria 6573
167 Ga0209050_1009345 3300025298 Bacteria 5034
168 Ga0209256_1000009 3300025299 Bacteria 922071
169 Ga0209256_1000010 3300025299 Bacteria 912110
170 Ga0209051_1000191 3300025303 Bacteria 108763
171 Ga0209257_1000228 3300025304 Bacteria 133390
172 Ga0209257_1003180 3300025304 Bacteria 14609
173 Ga0209257_1003572 3300025304 Bacteria 13185
174 Ga0209257_1003678 3300025304 Bacteria 12808
175 Ga0209257_1017255 3300025304 Bacteria 2857
176 Ga0207697_10000121 3300025315 Bacteria 37017
177 Ga0207682_10040628 3300025893 Bacteria 1896
178 Ga0207688_10265855 3300025901 Bacteria 1042
179 Ga0207647_10158858 3300025904 Bacteria 1319
180 Ga0207685_10046675 3300025905 Bacteria 1650
181 Ga0207645_10138227 3300025907 Bacteria 1587
182 Ga0207654_10421846 3300025911 Bacteria 931
183 Ga0207695_10143982 3300025913 Bacteria 2329
184 Ga0207671_10012108 3300025914 Bacteria 6965
185 Ga0207671_10417264 3300025914 Bacteria 1068
186 Ga0207693_10049743 3300025915 Bacteria 3292
187 Ga0207693_10140223 3300025915 Bacteria 1901
188 Ga0207662_10163293 3300025918 Bacteria 1424
189 Ga0207681_10000050 3300025923 Bacteria 118481
190 Ga0207681_10157855 3300025923 Bacteria 1706
191 Ga0207681_10163083 3300025923 Bacteria 1682
192 Ga0207694_10000156 3300025924 Bacteria 70186
193 Ga0207694_10143037 3300025924 Bacteria 1924
194 Ga0207650_10025436 3300025925 Bacteria 4216
195 Ga0207659_10687758 3300025926 Bacteria 875
196 Ga0207700_10064965 3300025928 Bacteria 2782
197 Ga0207706_10673618 3300025933 Bacteria 885
198 Ga0207686_10399439 3300025934 Bacteria 1047
199 Ga0207670_10039997 3300025936 Bacteria 3075
200 Ga0207669_10230327 3300025937 Bacteria 1366
201 Ga0207704_10289622 3300025938 Bacteria 1249
202 Ga0207704_10539106 3300025938 Bacteria 946
203 Ga0207665_10037340 3300025939 Bacteria 3233
204 Ga0207691_10011743 3300025940 Bacteria 8411
205 Ga0207691_10870986 3300025940 Bacteria 755
206 Ga0207711_10000001 3300025941 Bacteria 1325674
207 Ga0207689_10159272 3300025942 Bacteria 1860
208 Ga0207679_10077157 3300025945 Bacteria 2534
209 Ga0207679_10238576 3300025945 Bacteria 1539
210 Ga0207679_10855550 3300025945 Bacteria 831
211 Ga0207667_10000068 3300025949 Bacteria 180716
212 Ga0207667_10858155 3300025949 Bacteria 902
213 Ga0207712_10009031 3300025961 Bacteria 6306
214 Ga0207668_10455061 3300025972 Bacteria 1093
215 Ga0207640_10033155 3300025981 Bacteria 3211
216 Ga0207640_10045007 3300025981 Bacteria 2832
217 Ga0207658_10015230 3300025986 Bacteria 5275
218 Ga0207658_10274338 3300025986 Bacteria 1443
219 Ga0207658_10345265 3300025986 Bacteria 1295
220 Ga0207703_10025739 3300026035 Bacteria 4629
221 Ga0207703_10552901 3300026035 Bacteria 1085
222 Ga0207639_10013049 3300026041 Bacteria 5801
223 Ga0207639_10038916 3300026041 Bacteria 3540
224 Ga0207678_10245170 3300026067 Bacteria 1534
225 Ga0207708_10046743 3300026075 Bacteria 3296
226 Ga0207708_10049054 3300026075 Bacteria 3214
227 Ga0207702_10261774 3300026078 Bacteria 1629
228 Ga0207641_10842462 3300026088 Bacteria 909
229 Ga0207648_10234868 3300026089 Bacteria 1631
230 Ga0207676_10119246 3300026095 Bacteria 2222
231 Ga0207676_10246969 3300026095 Bacteria 1604
232 Ga0207674_10018140 3300026116 Bacteria 7657
233 Ga0207674_10203543 3300026116 Bacteria 1929
234 Ga0207674_10629631 3300026116 Bacteria 1036
235 Ga0207675_100019225 3300026118 Bacteria 6374
236 Ga0207675_100026894 3300026118 Bacteria 5355
237 Ga0207675_100084745 3300026118 Bacteria 2974
238 Ga0207675_100178561 3300026118 Bacteria 2032
239 Ga0207683_10104012 3300026121 Bacteria 2537
240 Ga0207698_10073640 3300026142 Bacteria 2721
241 Ga0207698_10720180 3300026142 Bacteria 994
242 Ga0209588_1119422 3300027671 Bacteria 844
243 Ga0265356_1001571 3300028017 Bacteria 3325
244 Ga0268266_10001573 3300028379 Bacteria 26671
245 Ga0268266_10087063 3300028379 Bacteria 2732
246 Ga0268265_10000102 3300028380 Bacteria 106737
247 Ga0268264_10025820 3300028381 Bacteria 4797
248 Ga0265334_10014803 3300028573 Bacteria 3247
249 Ga0265318_10000078 3300028577 Bacteria 90755
250 Ga0265318_10004942 3300028577 Bacteria 6360
251 Ga0307517_10176347 3300028786 Bacteria 1391
252 Ga0265338_10000043 3300028800 Bacteria 226293
253 Ga0265330_10016096 3300031235 Bacteria 3454
254 Ga0265332_10012204 3300031238 Bacteria 3812
255 Ga0265325_10000002 3300031241 Bacteria 396758
256 Ga0265340_10039226 3300031247 Bacteria 2338
257 Ga0265339_10000216 3300031249 Bacteria 47017
258 Ga0265331_10011034 3300031250 Bacteria 4958
259 Ga0265327_10003282 3300031251 Bacteria 15669
260 Ga0307513_10173344 3300031456 Bacteria 2031
261 Ga0307513_10599181 3300031456 Bacteria 811
262 Ga0307408_100052870 3300031548 Bacteria 2932
263 Ga0307408_100060793 3300031548 Bacteria 2755
264 Ga0307408_100143556 3300031548 Bacteria 1876
265 Ga0265313_10001374 3300031595 Bacteria 22847
266 Ga0307508_10117653 3300031616 Bacteria 2259
267 Ga0265314_10021331 3300031711 Bacteria 4983
268 Ga0265314_10344900 3300031711 Bacteria 821
269 Ga0265342_10048271 3300031712 Bacteria 2553
270 Ga0265342_10086061 3300031712 Bacteria 1808
271 Ga0307516_10032551 3300031730 Bacteria 5250
272 Ga0307405_10076332 3300031731 Bacteria 2173
273 Ga0307413_10007820 3300031824 Bacteria 4998
274 Ga0307406_10009523 3300031901 Bacteria 5453
275 Ga0307406_10028440 3300031901 Bacteria 3377
276 Ga0307406_10605444 3300031901 Bacteria 904
277 Ga0307407_10007455 3300031903 Bacteria 4957
278 Ga0307407_10099316 3300031903 Bacteria 1803
279 Ga0307412_10082796 3300031911 Bacteria 2222
280 Ga0307412_10129044 3300031911 Bacteria 1833
281 Ga0307409_100039036 3300031995 Bacteria 3519
282 Ga0307409_100118023 3300031995 Bacteria 2240
283 Ga0307409_100330613 3300031995 Bacteria 1430
284 Ga0307416_100019723 3300032002 Bacteria 4789
285 Ga0307414_10930625 3300032004 Bacteria 798
286 Ga0307411_10048029 3300032005 Bacteria 2763
287 Ga0307415_100439979 3300032126 Bacteria 1124
288 Ga0373954_0344424 3300035118 Bacteria 736
289 Ga0373955_0339355 3300035172 Bacteria 909
290 Ga0373927_0035173 3300035695 Bacteria 3258
291 Ga0373947_0326313 3300035725 Bacteria 1027
292 Ga0373925_0251703 3300037068 Bacteria 1417
293 Ga0395905_0026307 3300037471 Bacteria 5487
294 Ga0395905_0867592 3300037471 Bacteria 806
295 Ga0436364_0887588 3300037853 Bacteria 796
296 Ga0395901_0220414 3300038443 Bacteria 1983
297 Ga0436360_0889201 3300039438 Bacteria 999
298 Ga0436361_0656345 3300039447 Bacteria 1224
299 Ga0436363_1040323 3300039450 Bacteria 956
300 Ga0439436_0055204 3300041404 Bacteria 1116
301 Ga0439439_0000197 3300041406 Bacteria 9225
302 Ga0439461_0014747 3300041410 Bacteria 1490
303 Ga0439465_0006757 3300041413 Bacteria 3643
304 Ga0451791_0180526 3300041451 Bacteria 679
305 Ga0451849_1579085 3300041505 Bacteria 1389
306 Ga0439431_0085488 3300041997 Bacteria 854
307 Ga0439432_043912 3300042006 Bacteria 1409
308 Ga0450888_040420 3300042126 Bacteria 647
309 Ga0439458_0097291 3300042157 Bacteria 762
310 Ga0451577_0888450 3300042876 Bacteria 803
311 Ga0495590_0295845 3300046457 Bacteria 608
312 Ga0495638_0001099 3300046460 Bacteria 26383
313 Ga0495638_0076725 3300046460 Bacteria 2036
314 Ga0495606_0279658 3300046507 Bacteria 913
315 Ga0495608_0393956 3300046511 Bacteria 848
316 Ga0495616_0000360 3300046513 Bacteria 35740
317 Ga0495628_0372853 3300046516 Bacteria 1046
318 Ga0495628_0384822 3300046516 Bacteria 1027
319 Ga0495668_0078747 3300046616 Bacteria 1809
320 Ga0495625_0000054 3300046660 Bacteria 187599
321 Ga0495625_0120696 3300046660 Bacteria 1784
322 Ga0495661_0033296 3300046665 Bacteria 3252
323 Ga0495670_0000015 3300046691 Bacteria 131137
324 Ga0495670_0401545 3300046691 Bacteria 740
325 Ga0495671_0083767 3300046692 Bacteria 1563
326 Ga0495660_0372904 3300046810 Bacteria 630
327 Ga0495674_0146134 3300047319 Bacteria 1985
328 Ga0495674_0603112 3300047319 Bacteria 870
329 Ga0495673_0000600 3300047469 Bacteria 35843
330 Ga0495681_0025398 3300047470 Bacteria 3100
331 Ga0495686_0137553 3300047472 Bacteria 1444
332 Ga0496101_0833909 3300048904 Bacteria 727
333 Ga0496102_0492594 3300048905 Bacteria 1147
334 Ga0496102_0646273 3300048905 Bacteria 981
335 Ga0496103_0000037 3300048906 Bacteria 179474
336 Ga0496104_0008260 3300048907 Bacteria 9243
337 Ga0496104_0024084 3300048907 Bacteria 5602
338 Ga0496104_0097029 3300048907 Bacteria 2821
339 Ga0496104_0419721 3300048907 Bacteria 1250
340 Ga0496105_0002020 3300048908 Bacteria 14656
341 Ga0496105_0033403 3300048908 Bacteria 4225
342 Ga0496108_0003757 3300048911 Bacteria 12168
343 Ga0496109_0001984 3300048912 Bacteria 16959
344 Ga0496109_0293576 3300048912 Bacteria 1533
345 Ga0496110_0097886 3300048913 Bacteria 2628
346 Ga0496111_0379381 3300048914 Bacteria 1045
347 Ga0496114_0087188 3300048917 Bacteria 2646
348 Ga0496114_0459556 3300048917 Bacteria 1127
349 Ga0496115_0001359 3300048918 Bacteria 17461
350 Ga0496116_0002416 3300048919 Bacteria 19675
351 Ga0496117_0000115 3300048920 Bacteria 179488
352 Ga0496118_0000086 3300048921 Bacteria 179488
353 Ga0496118_0330231 3300048921 Bacteria 823
354 Ga0496119_0009737 3300048922 Bacteria 8182
355 Ga0496120_0074129 3300048923 Bacteria 1860
356 Ga0496121_0000105 3300048924 Bacteria 191437
357 Ga0496124_0000102 3300048927 Bacteria 179488
358 Ga0496124_0000129 3300048927 Bacteria 156648
359 Ga0496124_0018814 3300048927 Bacteria 6452
360 Ga0496124_0040847 3300048927 Bacteria 4008
361 Ga0496124_0356267 3300048927 Bacteria 1033
362 Ga0496125_0124827 3300048928 Bacteria 1827
363 Ga0496125_0146798 3300048928 Bacteria 1628
364 Ga0496126_0001609 3300048929 Bacteria 34276
365 Ga0496126_0004119 3300048929 Bacteria 17590
366 Ga0496126_0005832 3300048929 Bacteria 13922
367 Ga0496126_0402304 3300048929 Bacteria 1110
368 Ga0495682_0002446 3300049460 Bacteria 8778
369 Ga0501036_1311913 3300049572 Bacteria 588
370 Ga0501042_0159021 3300049578 Bacteria 1630
371 Ga0501047_0065937 3300049581 Bacteria 3490
372 Ga0501068_0000771 3300049584 Bacteria 16509
373 Ga0501069_0095231 3300049585 Bacteria 1686
374 Ga0501070_0064531 3300049586 Bacteria 3032
375 Ga0501071_0011277 3300049587 Bacteria 6014
376 Ga0501073_0002694 3300049589 Bacteria 13298
377 Ga0501076_0016598 3300049592 Bacteria 5583
378 Ga0501077_0012798 3300049593 Bacteria 5257
379 Ga0501225_0002106 3300049705 Bacteria 6185
380 Ga0501079_0000016 3300049741 Bacteria 65975
381 Ga0501080_0000319 3300049742 Bacteria 36724
382 Ga0501083_0015178 3300049744 Bacteria 5393
383 Ga0501241_022387 3300049758 Bacteria 1167
384 nmdc:mga06z11_62275_c1 3300050494 Bacteria 1948
385 nmdc:mga06r32_26358_c1 3300050510 Bacteria 5418
386 nmdc:mga0rr50_1260189_c1 3300050513 Bacteria 627
387 nmdc:mga0rr50_1368332_c1 3300050513 Bacteria 599
388 nmdc:mga0sz30_13312_c1 3300050516 Bacteria 3219
389 Ga0500643_056086 3300053087 Bacteria 1115
390 Ga0500644_0000228 3300053088 Bacteria 32096
391 Ga0500566_0089168 3300053094 Bacteria 1706
392 Ga0500556_0006177 3300053104 Bacteria 3397
393 Ga0500562_028128 3300053108 Bacteria 1477
394 Ga0500607_000052 3300053121 Bacteria 80355
395 Ga0500614_177200 3300053123 Bacteria 651
396 Ga0500655_002963 3300053133 Bacteria 3080
397 Ga0500658_0009388 3300053134 Bacteria 3608
398 Ga0500658_0161825 3300053134 Bacteria 1013
399 Ga0500559_0003408 3300053136 Bacteria 7828
400 Ga0500564_000157 3300053138 Bacteria 17802
401 Ga0500564_021329 3300053138 Bacteria 2967
402 Ga0500604_0019199 3300053151 Bacteria 1912
403 Ga0500619_010208 3300053154 Bacteria 2365
404 Ga0500622_0008175 3300053156 Bacteria 5876
405 Ga0500622_0015639 3300053156 Bacteria 4062
406 Ga0500637_0178320 3300053178 Bacteria 1219
407 Ga0501084_0003301 3300054114 Bacteria 13049
408 Ga0501082_0110085 3300060353 Bacteria 2384
409 2512644680 2512564014 Bacteria 4639632
410 2513859768 2513237137 Bacteria 9558895
411 2517890012 2517572143 Bacteria 9484767
412 2585146330 2582581279 Bacteria 4980720
413 2585148451 2582581279 Bacteria 4980720
414 2585324499 2582581315 Bacteria 7318924
415 2587916390 2585428106 Bacteria 5179711
416 2587917622 2585428106 Bacteria 5179711
417 2595447820 2593339238 Bacteria 4182970
418 2600228612 2599185359 Bacteria 4772316
419 2644125901 2643221622 Bacteria 4212502
420 2644226853 2643221640 Bacteria 5258820
421 2644233678 2643221642 Bacteria 5357871
422 2809062223 2808606401 Bacteria 4586670
423 2809078437 2808606404 Bacteria 4652788
424 2809082612 2808606405 Bacteria 4586632
425 2819714577 2818991466 Bacteria 4748179
426 2857507122 2857504554 Bacteria 5369913
427 2879165611 2879163058 Bacteria 4223965
428 2880518970 2880518877 Bacteria 5012590
429 2884413130 2884411467 Bacteria 5246714
430 2884961834 2884960567 Bacteria 5437054
431 2884964914 2884960567 Bacteria 5437054
432 2886633999 2886627955 Bacteria 7618130
433 2899262798 2899259804 Bacteria 3320927
434 2919710511 2919709256 Bacteria 4318106
435 2928529080 2928526807 Bacteria 4760224
436 2928536060 2928531327 Bacteria 5101314
437 2928968597 2928968154 Bacteria 4633371
438 2990266069 2990265787 Bacteria 3943888
439 2993696138 2993693658 Bacteria 4040749
440 8054304142 8054302542 Bacteria 5698134
441 8054565013 8054563764 Bacteria 5592885
442 Ga0070683_100012154
443 JGI24739J22299_10000187
444 JGI24739J22299_10004073
445 JGI24738J21930_10013414
446 JGI25150J39212_1000398
447 JGI25151J46595_10050349
448 JGI25153J46596_10000091
449 JGI25153J46596_10015585
450 rootL2_10181224
451 Ga0055526_1011643
452 Ga0055537_1001470
453 Ga0055537_1001547
454 Ga0055524_1001171
455 Ga0055536_1022900
456 Ga0055530_10038540
457 Ga0055540_1003107
458 Ga0055531_10000116
459 Ga0055531_10016434
460 Ga0070676_10114046
461 Ga0070683_100645829
462 Ga0070690_100011616
463 Ga0070690_100068072
464 Ga0070670_100015212
465 Ga0070670_100367459
466 Ga0070666_10032078
467 Ga0070680_100295190
468 Ga0070689_100005535
469 Ga0070687_100322212
470 Ga0070669_100000048
471 Ga0070669_100078138
472 Ga0070669_100199859
473 Ga0070671_100434795
474 Ga0070674_100074560
475 Ga0070688_100156024
476 Ga0070667_100013798
477 Ga0070667_100196335
478 Ga0070667_100410982
479 Ga0070667_101008622
480 Ga0070703_10147694
481 Ga0070709_10167097
482 Ga0070709_10723891
483 Ga0070714_100465814
484 Ga0070713_100218775
485 Ga0070713_100261759
486 Ga0070713_100292313
487 Ga0070701_10019277
488 Ga0070711_100488195
489 Ga0070700_100082962
490 Ga0070700_100105616
491 Ga0070663_100181016
492 Ga0070678_100103936
493 Ga0070662_100111467
494 Ga0070662_100628624
495 Ga0070681_10061334
496 Ga0068867_100210568
497 Ga0070698_100244150
498 Ga0070684_100038055
499 Ga0068853_100003308
500 Ga0070672_100013803
501 Ga0070672_100018096
502 Ga0070686_100011665
503 Ga0070695_100025959
504 Ga0070693_100350753
505 Ga0070665_100001518
506 Ga0070665_100033290
507 Ga0070665_100442050
508 Ga0068855_100829450
509 Ga0068857_100015451
510 Ga0068857_100100477
511 Ga0068857_100476835
512 Ga0068854_100103914
513 Ga0068854_100114747
514 Ga0068856_100166150
515 Ga0070702_100023095
516 Ga0070702_100319660
517 Ga0068852_100040621
518 Ga0068852_100161441
519 Ga0068852_100616019
520 Ga0068859_100080765
521 Ga0068859_100080948
522 Ga0068864_100030628
523 Ga0068864_100176295
524 Ga0068861_100013245
525 Ga0068861_100023529
526 Ga0068870_10263909
527 Ga0068863_100009439
528 Ga0068858_100042308
529 Ga0068858_100514419
530 Ga0068860_100003140
531 Ga0068862_100000128
532 Ga0068862_100018129
533 Ga0081540_1079531
534 Ga0081540_1110481
535 Ga0070715_10006908
536 Ga0070716_100093407
537 Ga0070716_100478570
538 Ga0070712_100301214
539 Ga0070712_100434911
540 Ga0070712_100499769
541 Ga0070712_100504633
542 Ga0070712_100539682
543 Ga0075367_10140624
544 Ga0097621_100005591
545 Ga0097621_100035992
546 Ga0097621_100164191
547 Ga0068871_100009486
548 Ga0075428_100192132
549 Ga0075431_100033581
550 Ga0075434_100616883
551 Ga0075429_100033627
552 Ga0068865_100556386
553 Ga0097620_100080771
554 Ga0097620_100080948
555 Ga0079104_1025245
556 Ga0099795_10135000
557 Ga0099795_10144347
558 Ga0105240_10271431
559 Ga0105240_10424330
560 Ga0105240_10823402
561 Ga0111539_10004917
562 Ga0105245_10059426
563 Ga0105247_10301597
564 Ga0105241_10040059
565 Ga0105248_10006025
566 Ga0105237_10055213
567 Ga0105237_10356146
568 Ga0105238_10003746
569 Ga0105238_10415273
570 Ga0105249_10017944
571 Ga0099796_10018016
572 Ga0105239_10210111
573 Ga0105239_10479976
574 Ga0157369_10000203
575 Ga0157369_10047048
576 Ga0157374_10014743
577 Ga0163162_11091412
578 Ga0157372_11089811
579 Ga0157375_10008148
580 Ga0157375_10058145
581 Ga0163163_10010812
582 Ga0157380_10001615
583 Ga0157380_10001902
584 Ga0157380_10019159
585 Ga0157379_10040277
586 Ga0157379_10493701
587 Ga0157376_10012042
588 Ga0157376_10438534
589 Ga0157376_10514801
590 Ga0183363_1006
591 Ga0213872_10200437
592 Ga0207425_1000049
593 Ga0209129_1001668
594 Ga0209565_1000007
595 Ga0209565_1000170
596 Ga0209673_1007604
597 Ga0209673_1011741
598 Ga0209673_1026853
599 Ga0209675_1004240
600 Ga0209025_1000068
601 Ga0209564_1000003
602 Ga0209564_1000335
603 Ga0209758_1000004
604 Ga0209758_1011544
605 Ga0209050_1000001
606 Ga0209050_1000196
607 Ga0209050_1006899
608 Ga0209050_1009345
609 Ga0209256_1000009
610 Ga0209256_1000010
611 Ga0209051_1000191
612 Ga0209257_1000228
613 Ga0209257_1003180
614 Ga0209257_1003572
615 Ga0209257_1003678
616 Ga0209257_1017255
617 Ga0207697_10000121
618 Ga0207682_10040628
619 Ga0207688_10265855
620 Ga0207647_10158858
621 Ga0207685_10046675
622 Ga0207645_10138227
623 Ga0207654_10421846
624 Ga0207695_10143982
625 Ga0207671_10012108
626 Ga0207671_10417264
627 Ga0207693_10049743
628 Ga0207693_10140223
629 Ga0207662_10163293
630 Ga0207681_10000050
631 Ga0207681_10157855
632 Ga0207681_10163083
633 Ga0207694_10000156
634 Ga0207694_10143037
635 Ga0207650_10025436
636 Ga0207659_10687758
637 Ga0207700_10064965
638 Ga0207706_10673618
639 Ga0207686_10399439
640 Ga0207670_10039997
641 Ga0207669_10230327
642 Ga0207704_10289622
643 Ga0207704_10539106
644 Ga0207665_10037340
645 Ga0207691_10011743
646 Ga0207691_10870986
647 Ga0207711_10000001
648 Ga0207689_10159272
649 Ga0207679_10077157
650 Ga0207679_10238576
651 Ga0207679_10855550
652 Ga0207667_10000068
653 Ga0207667_10858155
654 Ga0207712_10009031
655 Ga0207668_10455061
656 Ga0207640_10033155
657 Ga0207640_10045007
658 Ga0207658_10015230
659 Ga0207658_10274338
660 Ga0207658_10345265
661 Ga0207703_10025739
662 Ga0207703_10552901
663 Ga0207639_10013049
664 Ga0207639_10038916
665 Ga0207678_10245170
666 Ga0207708_10046743
667 Ga0207708_10049054
668 Ga0207702_10261774
669 Ga0207641_10842462
670 Ga0207648_10234868
671 Ga0207676_10119246
672 Ga0207676_10246969
673 Ga0207674_10018140
674 Ga0207674_10203543
675 Ga0207674_10629631
676 Ga0207675_100019225
677 Ga0207675_100026894
678 Ga0207675_100084745
679 Ga0207675_100178561
680 Ga0207683_10104012
681 Ga0207698_10073640
682 Ga0207698_10720180
683 Ga0209588_1119422
684 Ga0265356_1001571
685 Ga0268266_10001573
686 Ga0268266_10087063
687 Ga0268265_10000102
688 Ga0268264_10025820
689 Ga0265334_10014803
690 Ga0265318_10000078
691 Ga0265318_10004942
692 Ga0307517_10176347
693 Ga0265338_10000043
694 Ga0265330_10016096
695 Ga0265332_10012204
696 Ga0265325_10000002
697 Ga0265340_10039226
698 Ga0265339_10000216
699 Ga0265331_10011034
700 Ga0265327_10003282
701 Ga0307513_10173344
702 Ga0307513_10599181
703 Ga0307408_100052870
704 Ga0307408_100060793
705 Ga0307408_100143556
706 Ga0265313_10001374
707 Ga0307508_10117653
708 Ga0265314_10021331
709 Ga0265314_10344900
710 Ga0265342_10048271
711 Ga0265342_10086061
712 Ga0307516_10032551
713 Ga0307405_10076332
714 Ga0307413_10007820
715 Ga0307406_10009523
716 Ga0307406_10028440
717 Ga0307406_10605444
718 Ga0307407_10007455
719 Ga0307407_10099316
720 Ga0307412_10082796
721 Ga0307412_10129044
722 Ga0307409_100039036
723 Ga0307409_100118023
724 Ga0307409_100330613
725 Ga0307416_100019723
726 Ga0307414_10930625
727 Ga0307411_10048029
728 Ga0307415_100439979
729 Ga0373954_0344424
730 Ga0373955_0339355
731 Ga0373927_0035173
732 Ga0373947_0326313
733 Ga0373925_0251703
734 Ga0395905_0026307
735 Ga0395905_0867592
736 Ga0436364_0887588
737 Ga0395901_0220414
738 Ga0436360_0889201
739 Ga0436361_0656345
740 Ga0436363_1040323
741 Ga0439436_0055204
742 Ga0439439_0000197
743 Ga0439461_0014747
744 Ga0439465_0006757
745 Ga0451791_0180526
746 Ga0451849_1579085
747 Ga0439431_0085488
748 Ga0439432_043912
749 Ga0450888_040420
750 Ga0439458_0097291
751 Ga0451577_0888450
752 Ga0495590_0295845
753 Ga0495638_0001099
754 Ga0495638_0076725
755 Ga0495606_0279658
756 Ga0495608_0393956
757 Ga0495616_0000360
758 Ga0495628_0372853
759 Ga0495628_0384822
760 Ga0495668_0078747
761 Ga0495625_0000054
762 Ga0495625_0120696
763 Ga0495661_0033296
764 Ga0495670_0000015
765 Ga0495670_0401545
766 Ga0495671_0083767
767 Ga0495660_0372904
768 Ga0495674_0146134
769 Ga0495674_0603112
770 Ga0495673_0000600
771 Ga0495681_0025398
772 Ga0495686_0137553
773 Ga0496101_0833909
774 Ga0496102_0492594
775 Ga0496102_0646273
776 Ga0496103_0000037
777 Ga0496104_0008260
778 Ga0496104_0024084
779 Ga0496104_0097029
780 Ga0496104_0419721
781 Ga0496105_0002020
782 Ga0496105_0033403
783 Ga0496108_0003757
784 Ga0496109_0001984
785 Ga0496109_0293576
786 Ga0496110_0097886
787 Ga0496111_0379381
788 Ga0496114_0087188
789 Ga0496114_0459556
790 Ga0496115_0001359
791 Ga0496116_0002416
792 Ga0496117_0000115
793 Ga0496118_0000086
794 Ga0496118_0330231
795 Ga0496119_0009737
796 Ga0496120_0074129
797 Ga0496121_0000105
798 Ga0496124_0000102
799 Ga0496124_0000129
800 Ga0496124_0018814
801 Ga0496124_0040847
802 Ga0496124_0356267
803 Ga0496125_0124827
804 Ga0496125_0146798
805 Ga0496126_0001609
806 Ga0496126_0004119
807 Ga0496126_0005832
808 Ga0496126_0402304
809 Ga0495682_0002446
810 Ga0501036_1311913
811 Ga0501042_0159021
812 Ga0501047_0065937
813 Ga0501068_0000771
814 Ga0501069_0095231
815 Ga0501070_0064531
816 Ga0501071_0011277
817 Ga0501073_0002694
818 Ga0501076_0016598
819 Ga0501077_0012798
820 Ga0501225_0002106
821 Ga0501079_0000016
822 Ga0501080_0000319
823 Ga0501083_0015178
824 Ga0501241_022387
825 nmdc:mga06z11_62275_c1
826 nmdc:mga06r32_26358_c1
827 nmdc:mga0rr50_1260189_c1
828 nmdc:mga0rr50_1368332_c1
829 nmdc:mga0sz30_13312_c1
830 Ga0500643_056086
831 Ga0500644_0000228
832 Ga0500566_0089168
833 Ga0500556_0006177
834 Ga0500562_028128
835 Ga0500607_000052
836 Ga0500614_177200
837 Ga0500655_002963
838 Ga0500658_0009388
839 Ga0500658_0161825
840 Ga0500559_0003408
841 Ga0500564_000157
842 Ga0500564_021329
843 Ga0500604_0019199
844 Ga0500619_010208
845 Ga0500622_0008175
846 Ga0500622_0015639
847 Ga0500637_0178320
848 Ga0501084_0003301
849 Ga0501082_0110085
850 2512644680
851 2513859768
852 2517890012
853 2585146330
854 2585148451
855 2585324499
856 2587916390
857 2587917622
858 2595447820
859 2600228612
860 2644125901
861 2644226853
862 2644233678
863 2809062223
864 2809078437
865 2809082612
866 2819714577
867 2857507122
868 2879165611
869 2880518970
870 2884413130
871 2884961834
872 2884964914
873 2886633999
874 2899262798
875 2919710511
876 2928529080
877 2928536060
878 2928968597
879 2990266069
880 2993696138
881 8054304142
882 8054565013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

26

174

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7q6n-assembly1.cif.gz_A structure of wrba from salmonella typhimurium bound to me0052 0.9758 1 197
3b6i-assembly1.cif.gz_A wrba from escherichia coli, native structure 0.9731 2 199
4la4-assembly1.cif.gz_B-2 crystal structure of native pnpb 0.9726 1 198
5f51-assembly1.cif.gz_A structure of b. abortus wrba-related protein a (apo) 0.9708 1 197
7q6m-assembly1.cif.gz_D structure of wrba from yersinia pseudotuberculosis in p1 0.9702 1 197
ID Description Score Start End Superfamily
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9654 1 199 3.40.50.360
3zhoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9635 2 199 3.40.50.360
af_A0A0R0H261_1_202_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9607 1 199 3.40.50.360
3zhoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9582 2 199 3.40.50.360
5mp4F00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9563 3 196 3.40.50.360
ID Description Score Start End GO Terms
AF-T1CAN3-F1-model_v4 TrpR binding protein WrbA 0.9905 1 111 GO:0003955
GO:0010181
GO:0016020
AF-A0A162AC88-F1-model_v4 Flavodoxin-like domain-containing protein 0.9904 1 114 GO:0003955
GO:0010181
GO:0016020
AF-A0A059WTJ3-F1-model_v4 Putative ACR, COG1399 0.9899 1 132 GO:0003955
GO:0010181
GO:0016020
AF-A0A370NSV5-F1-model_v4 NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) 0.9876 2 198 GO:0008753
GO:0009055
GO:0010181
GO:0016020
GO:0050136
GO:0050660
GO:0050661
GO:0051287
AF-H5Y7Q2-F1-model_v4 NAD(P)H dehydrogenase (quinone) (EC 1.6.5.2) (NAD(P)H:quinone oxidoreductase) (NQO) 0.9875 1 197 GO:0008753
GO:0010181
GO:0016020
GO:0050136
GO:0050660
GO:0050661
GO:0051287

Map