F444635

General Info

Members Datasets Scaffolds Average Seq Length
441 273 882 556

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10004446|Ga0111539_100044462
Length 626
Sequence MLRTTDRHGVIRALGKAQLTVNVRQPACRRHLRGVRLRAPSRLRENPMSVTTMDDVAVRGRPMSREEKRVILASSLGTVFEWYDFYLYGSLAAIIGAQFFSQYPEATRNVFALLAFAAGFLVRPFGALVFGRLGDLVGRKYTFLITILIMGISTFLVGCLPSYETIGFLAPVILIALRMAQGLALGGEYGGAAIYVAEHAPSGKRGFFTSWIQTTATLGLLLSLIVIMFTQIYVNANFAEVTTAAGAKLTPFAAWGWRIPFLVSIALLAISVWIRLQMHESPAFKKMKEEGSMSKAPLTEAFGQWKNAKIALLALLGLVAGQAVVWYTGQFYALFFLQSILKVDAFTANVLIAWSLILGTGGFVVFGALSDRIGRKPIILAGCLIAALTYFPLFKLMTKTANPALYEAQERAQVTIIADPADCSFQFNPTGTAKFTNSCDVAKALLARSSVNATTVSAPGGTVASVRIGDKEFSAKDPNFTRDVGAALTAVGYPGANNPTVVKIPIDPKAGLANFAQMFDIFSAQRLTLIAILTXXXIYVTMVYGPIAAALVEFFPTRIRYSGMSLPYHIGNGWFGGLLPATSFAMVAQTGDIYFGLWYPIVVALMTFVIGTLFVPETYKRDIFKQ

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
170 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
229 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
230 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
235 2508501050 Microvirga lupini Lut6 Isolate Nodule
236 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
237 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
238 2643221733 Bosea sp. Root381 Isolate Unclassified
239 2643221736 Bosea sp. Root483D1 Isolate Unclassified
240 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
241 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
242 2773857925 Microvirga vignae BR3299 Isolate Unclassified
243 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
244 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
245 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
246 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
247 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
248 2831864461 Roseateles noduli HZ7 Isolate Nodule
249 2841760612 Bosea sp. Tri-49 Isolate Nodule
250 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
251 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
252 2844104063 Bosea sp. Tri-39 Isolate Nodule
253 2851182111 Bosea sp. Tri-44 Isolate Nodule
254 2851246043 Bosea sp. Tri-54 Isolate Nodule
255 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
256 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
257 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
258 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
259 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
260 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
261 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
262 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
263 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
264 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
265 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
266 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
267 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
268 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
269 641522639 Methylobacterium sp. 4-46 Isolate Nodule
270 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
271 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
272 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
273 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.93
Metatranscriptomes 0.23
Isolates 8.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 2.95
Rhizoplane 1.59
Rhizosphere 77.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10004446 3300009094 Bacteria 18317
2 JGI24740J21852_10015226 3300001979 Bacteria 2813
3 JGI24735J21928_10003548 3300002067 Bacteria 5309
4 JGI25160J50197_1000480 3300003354 Bacteria 24293
5 JGI25161J50226_1000077 3300003374 Bacteria 83588
6 Ga0055538_1000002 3300003751 Bacteria 999437
7 Ga0055526_1000051 3300003771 Bacteria 116101
8 Ga0055526_1005225 3300003771 Bacteria 7539
9 Ga0055537_1000606 3300003773 Bacteria 19848
10 Ga0055540_1011705 3300003792 Bacteria 2806
11 Ga0055531_10006878 3300003794 Bacteria 6340
12 Ga0055531_10008827 3300003794 Bacteria 5245
13 Ga0065165_1000006 3300005262 Bacteria 352298
14 Ga0065165_1000667 3300005262 Bacteria 49547
15 Ga0070676_10001104 3300005328 Bacteria 13479
16 Ga0070676_10015470 3300005328 Bacteria 4209
17 Ga0070670_100000065 3300005331 Bacteria 108496
18 Ga0070670_100000859 3300005331 Bacteria 23823
19 Ga0070670_100030201 3300005331 Bacteria 4667
20 Ga0070677_10008377 3300005333 Bacteria 3478
21 Ga0070677_10019407 3300005333 Bacteria 2462
22 Ga0068869_100004613 3300005334 Bacteria 8591
23 Ga0070666_10002089 3300005335 Bacteria 12139
24 Ga0070680_100003997 3300005336 Bacteria 11035
25 Ga0068868_100007743 3300005338 Bacteria 7665
26 Ga0068868_100016211 3300005338 Bacteria 5529
27 Ga0068868_100027100 3300005338 Bacteria 4370
28 Ga0068868_100048299 3300005338 Bacteria 3338
29 Ga0070660_100038457 3300005339 Bacteria 3633
30 Ga0070691_10008549 3300005341 Bacteria 4688
31 Ga0070661_100008604 3300005344 Bacteria 7059
32 Ga0070661_100027933 3300005344 Bacteria 4067
33 Ga0070661_100047356 3300005344 Bacteria 3146
34 Ga0070668_100028331 3300005347 Bacteria 4253
35 Ga0070668_100054889 3300005347 Bacteria 3074
36 Ga0070675_100004029 3300005354 Bacteria 11155
37 Ga0070675_100031332 3300005354 Bacteria 4299
38 Ga0070675_100033600 3300005354 Bacteria 4160
39 Ga0070675_100090054 3300005354 Bacteria 2569
40 Ga0070671_100044034 3300005355 Bacteria 3708
41 Ga0070688_100010014 3300005365 Bacteria 5208
42 Ga0070659_100005105 3300005366 Bacteria 9416
43 Ga0070659_100008021 3300005366 Bacteria 7697
44 Ga0070659_100049073 3300005366 Bacteria 3318
45 Ga0070667_100027525 3300005367 Bacteria 4730
46 Ga0070709_10013319 3300005434 Bacteria 4620
47 Ga0070711_100098132 3300005439 Bacteria 2126
48 Ga0070708_100085421 3300005445 Bacteria 2864
49 Ga0070663_100004060 3300005455 Bacteria 8547
50 Ga0070678_100019052 3300005456 Bacteria 4463
51 Ga0070681_10025956 3300005458 Bacteria 5890
52 Ga0070681_10190105 3300005458 Bacteria 1973
53 Ga0068867_100006127 3300005459 Bacteria 8514
54 Ga0070706_100001550 3300005467 Bacteria 24024
55 Ga0070706_100126659 3300005467 Bacteria 2382
56 Ga0070707_100161840 3300005468 Bacteria 2181
57 Ga0070679_100098252 3300005530 Bacteria 2915
58 Ga0070684_100019651 3300005535 Bacteria 5590
59 Ga0070697_100098327 3300005536 Bacteria 2429
60 Ga0068853_100007158 3300005539 Bacteria 8927
61 Ga0068853_100160977 3300005539 Bacteria 2025
62 Ga0070672_100000715 3300005543 Bacteria 19671
63 Ga0070672_100027275 3300005543 Bacteria 4259
64 Ga0070672_100028927 3300005543 Bacteria 4149
65 Ga0070672_100058126 3300005543 Bacteria 3038
66 Ga0070693_100057710 3300005547 Bacteria 2245
67 Ga0070665_100001028 3300005548 Bacteria 34986
68 Ga0068855_100000046 3300005563 Bacteria 147225
69 Ga0068855_100005243 3300005563 Bacteria 15811
70 Ga0068855_100037088 3300005563 Bacteria 5800
71 Ga0070664_100003412 3300005564 Bacteria 12829
72 Ga0070664_100018549 3300005564 Bacteria 5718
73 Ga0068857_100011068 3300005577 Bacteria 7848
74 Ga0068857_100125317 3300005577 Bacteria 2314
75 Ga0068854_100001191 3300005578 Bacteria 15592
76 Ga0068856_100000413 3300005614 Bacteria 47108
77 Ga0068856_100014735 3300005614 Bacteria 7546
78 Ga0068856_100023554 3300005614 Bacteria 5987
79 Ga0070702_100015053 3300005615 Bacteria 3939
80 Ga0068852_100001668 3300005616 Bacteria 15131
81 Ga0068852_100004312 3300005616 Bacteria 10039
82 Ga0068852_100016290 3300005616 Bacteria 5791
83 Ga0068852_100069429 3300005616 Bacteria 3088
84 Ga0068859_100023484 3300005617 Bacteria 6188
85 Ga0068864_100002106 3300005618 Bacteria 16447
86 Ga0068864_100002202 3300005618 Bacteria 16085
87 Ga0068864_100015046 3300005618 Bacteria 6431
88 Ga0068861_100067158 3300005719 Bacteria 2766
89 Ga0068851_10002471 3300005834 Bacteria 8123
90 Ga0068851_10002800 3300005834 Bacteria 7685
91 Ga0068863_100030998 3300005841 Bacteria 5105
92 Ga0068863_100041252 3300005841 Bacteria 4388
93 Ga0068858_100002151 3300005842 Bacteria 19975
94 Ga0068860_100084337 3300005843 Bacteria 3023
95 Ga0081455_10031537 3300005937 Bacteria 4792
96 Ga0081538_10001450 3300005981 Bacteria 24368
97 Ga0075365_10035485 3300006038 Bacteria 3226
98 Ga0075363_100001403 3300006048 Bacteria 9106
99 Ga0075362_10000094 3300006177 Bacteria 24911
100 Ga0075367_10005464 3300006178 Bacteria 6314
101 Ga0075367_10043171 3300006178 Bacteria 2641
102 Ga0075366_10028749 3300006195 Bacteria 3264
103 Ga0097621_100016725 3300006237 Bacteria 5555
104 Ga0075370_10001282 3300006353 Bacteria 10727
105 Ga0068871_100041883 3300006358 Bacteria 3674
106 Ga0068871_100044900 3300006358 Bacteria 3555
107 Ga0068871_100049635 3300006358 Bacteria 3392
108 Ga0075428_100001784 3300006844 Bacteria 22987
109 Ga0075428_100018833 3300006844 Bacteria 7634
110 Ga0075428_100027618 3300006844 Bacteria 6278
111 Ga0075430_100005809 3300006846 Bacteria 10410
112 Ga0075431_100001191 3300006847 Bacteria 23471
113 Ga0075431_100135846 3300006847 Bacteria 2535
114 Ga0075433_10054484 3300006852 Bacteria 3489
115 Ga0097620_100023485 3300006931 Bacteria 6188
116 Ga0099823_1008208 3300006944 Bacteria 10624
117 Ga0105240_10005496 3300009093 Bacteria 18888
118 Ga0105240_10009285 3300009093 Bacteria 13946
119 Ga0105240_10042848 3300009093 Bacteria 5765
120 Ga0111539_10010958 3300009094 Bacteria 11412
121 Ga0111539_10032929 3300009094 Bacteria 6293
122 Ga0114129_10000067 3300009147 Bacteria 93755
123 Ga0105243_10016971 3300009148 Bacteria 5506
124 Ga0105243_10025781 3300009148 Bacteria 4496
125 Ga0105241_10001014 3300009174 Bacteria 21357
126 Ga0105241_10095713 3300009174 Bacteria 2351
127 Ga0105241_10119521 3300009174 Bacteria 2120
128 Ga0105242_10178385 3300009176 Bacteria 1872
129 Ga0105248_10000661 3300009177 Bacteria 39161
130 Ga0105248_10002785 3300009177 Bacteria 19425
131 Ga0105248_10066543 3300009177 Bacteria 4046
132 Ga0105237_10122942 3300009545 Bacteria 2589
133 Ga0105238_10003379 3300009551 Bacteria 15932
134 Ga0105238_10009053 3300009551 Bacteria 9961
135 Ga0105238_10026790 3300009551 Bacteria 5876
136 Ga0105238_10123820 3300009551 Bacteria 2565
137 Ga0105238_10131988 3300009551 Bacteria 2476
138 Ga0105249_10007813 3300009553 Bacteria 9313
139 Ga0105249_10096257 3300009553 Bacteria 2777
140 Ga0105239_10017835 3300010375 Bacteria 7850
141 Ga0157319_1000010 3300012497 Bacteria 197331
142 Ga0157369_10037841 3300013105 Bacteria 5279
143 Ga0157374_10003234 3300013296 Bacteria 13682
144 Ga0157374_10022831 3300013296 Bacteria 5587
145 Ga0157374_10066992 3300013296 Bacteria 3374
146 Ga0157374_10074214 3300013296 Bacteria 3211
147 Ga0163162_10004711 3300013306 Bacteria 13150
148 Ga0157372_10003093 3300013307 Bacteria 17922
149 Ga0157375_10068932 3300013308 Bacteria 3541
150 Ga0157375_10077880 3300013308 Bacteria 3347
151 Ga0157375_10193869 3300013308 Bacteria 2187
152 Ga0163163_10014735 3300014325 Bacteria 7194
153 Ga0163163_10082540 3300014325 Bacteria 3218
154 Ga0157380_10000286 3300014326 Bacteria 30329
155 Ga0157380_10015452 3300014326 Bacteria 5611
156 Ga0157379_10009580 3300014968 Bacteria 8434
157 Ga0157376_10001763 3300014969 Bacteria 14410
158 Ga0182007_10003693 3300015262 Bacteria 7160
159 Ga0213876_10001767 3300021384 Bacteria 13101
160 Ga0209673_1008508 3300025273 Bacteria 4558
161 Ga0209130_1000040 3300025284 Bacteria 262926
162 Ga0209130_1000106 3300025284 Bacteria 134559
163 Ga0209675_1009674 3300025291 Bacteria 3381
164 Ga0209025_1004920 3300025294 Bacteria 11232
165 Ga0209564_1000003 3300025295 Bacteria 1585848
166 Ga0209564_1000054 3300025295 Bacteria 350653
167 Ga0209050_1002810 3300025298 Bacteria 13906
168 Ga0209050_1015501 3300025298 Bacteria 3194
169 Ga0209256_1000204 3300025299 Bacteria 112000
170 Ga0209256_1003985 3300025299 Bacteria 9690
171 Ga0207426_1000999 3300025302 Bacteria 27595
172 Ga0207426_1027242 3300025302 Bacteria 1906
173 Ga0209051_1000740 3300025303 Bacteria 35260
174 Ga0209257_1001275 3300025304 Bacteria 30852
175 Ga0209257_1001707 3300025304 Bacteria 24608
176 Ga0207656_10002688 3300025321 Bacteria 6032
177 Ga0207656_10013777 3300025321 Bacteria 3099
178 Ga0207656_10033314 3300025321 Bacteria 2145
179 Ga0207682_10011793 3300025893 Bacteria 3414
180 Ga0207680_10000754 3300025903 Bacteria 15248
181 Ga0207699_10011363 3300025906 Bacteria 4495
182 Ga0207705_10081522 3300025909 Bacteria 2358
183 Ga0207705_10088164 3300025909 Bacteria 2269
184 Ga0207684_10006230 3300025910 Bacteria 10894
185 Ga0207684_10111726 3300025910 Bacteria 2339
186 Ga0207654_10000131 3300025911 Bacteria 48376
187 Ga0207707_10086442 3300025912 Bacteria 2740
188 Ga0207695_10000463 3300025913 Bacteria 88316
189 Ga0207695_10003006 3300025913 Bacteria 24241
190 Ga0207695_10003703 3300025913 Bacteria 21297
191 Ga0207693_10015346 3300025915 Bacteria 6147
192 Ga0207663_10064701 3300025916 Bacteria 2334
193 Ga0207657_10021593 3300025919 Bacteria 6053
194 Ga0207657_10051497 3300025919 Bacteria 3579
195 Ga0207657_10072200 3300025919 Bacteria 2920
196 Ga0207649_10007824 3300025920 Bacteria 5815
197 Ga0207649_10042924 3300025920 Bacteria 2761
198 Ga0207652_10082262 3300025921 Bacteria 2817
199 Ga0207681_10000311 3300025923 Bacteria 35603
200 Ga0207694_10000086 3300025924 Bacteria 108152
201 Ga0207694_10012378 3300025924 Bacteria 6428
202 Ga0207694_10074475 3300025924 Bacteria 2657
203 Ga0207650_10001471 3300025925 Bacteria 16902
204 Ga0207650_10006627 3300025925 Bacteria 7898
205 Ga0207650_10046259 3300025925 Bacteria 3205
206 Ga0207650_10103602 3300025925 Bacteria 2194
207 Ga0207659_10005178 3300025926 Bacteria 7903
208 Ga0207659_10010445 3300025926 Bacteria 5837
209 Ga0207659_10023129 3300025926 Bacteria 4144
210 Ga0207659_10044356 3300025926 Bacteria 3128
211 Ga0207659_10081557 3300025926 Bacteria 2392
212 Ga0207659_10088664 3300025926 Bacteria 2305
213 Ga0207687_10070905 3300025927 Bacteria 2489
214 Ga0207644_10010856 3300025931 Bacteria 6013
215 Ga0207644_10067651 3300025931 Bacteria 2604
216 Ga0207690_10000352 3300025932 Bacteria 30589
217 Ga0207690_10034533 3300025932 Bacteria 3259
218 Ga0207690_10069755 3300025932 Bacteria 2419
219 Ga0207709_10003750 3300025935 Bacteria 8945
220 Ga0207669_10024811 3300025937 Bacteria 3228
221 Ga0207704_10004967 3300025938 Bacteria 6119
222 Ga0207704_10027254 3300025938 Bacteria 3149
223 Ga0207691_10005187 3300025940 Bacteria 12580
224 Ga0207691_10006501 3300025940 Bacteria 11285
225 Ga0207691_10068969 3300025940 Bacteria 3194
226 Ga0207711_10000316 3300025941 Bacteria 51683
227 Ga0207711_10003356 3300025941 Bacteria 13865
228 Ga0207711_10023916 3300025941 Bacteria 5113
229 Ga0207711_10038411 3300025941 Bacteria 4071
230 Ga0207689_10000578 3300025942 Bacteria 34981
231 Ga0207661_10149828 3300025944 Bacteria 2015
232 Ga0207679_10020236 3300025945 Bacteria 4488
233 Ga0207679_10107730 3300025945 Bacteria 2193
234 Ga0207667_10009755 3300025949 Bacteria 11291
235 Ga0207667_10035941 3300025949 Bacteria 5313
236 Ga0207667_10061585 3300025949 Bacteria 3925
237 Ga0207651_10003959 3300025960 Bacteria 7354
238 Ga0207651_10026382 3300025960 Bacteria 3628
239 Ga0207712_10005408 3300025961 Bacteria 8060
240 Ga0207712_10023597 3300025961 Bacteria 4062
241 Ga0207712_10053741 3300025961 Bacteria 2827
242 Ga0207668_10003171 3300025972 Bacteria 9631
243 Ga0207668_10035116 3300025972 Bacteria 3335
244 Ga0207668_10092402 3300025972 Bacteria 2227
245 Ga0207640_10018098 3300025981 Bacteria 4133
246 Ga0207640_10018214 3300025981 Bacteria 4122
247 Ga0207640_10100660 3300025981 Bacteria 2025
248 Ga0207658_10000459 3300025986 Bacteria 38145
249 Ga0207658_10059491 3300025986 Bacteria 2847
250 Ga0207677_10018408 3300026023 Bacteria 4191
251 Ga0207677_10028755 3300026023 Bacteria 3522
252 Ga0207677_10072904 3300026023 Bacteria 2429
253 Ga0207703_10001017 3300026035 Bacteria 26943
254 Ga0207703_10002090 3300026035 Bacteria 17554
255 Ga0207703_10007591 3300026035 Bacteria 8599
256 Ga0207639_10007057 3300026041 Bacteria 7660
257 Ga0207639_10014431 3300026041 Bacteria 5557
258 Ga0207639_10065560 3300026041 Bacteria 2820
259 Ga0207678_10016210 3300026067 Bacteria 6539
260 Ga0207678_10171386 3300026067 Bacteria 1853
261 Ga0207702_10000098 3300026078 Bacteria 101326
262 Ga0207702_10000627 3300026078 Bacteria 38862
263 Ga0207702_10010139 3300026078 Bacteria 7890
264 Ga0207641_10000594 3300026088 Bacteria 39811
265 Ga0207641_10035186 3300026088 Bacteria 4171
266 Ga0207641_10081470 3300026088 Bacteria 2810
267 Ga0207641_10099818 3300026088 Bacteria 2555
268 Ga0207676_10001477 3300026095 Bacteria 17437
269 Ga0207676_10011882 3300026095 Bacteria 6231
270 Ga0207676_10033897 3300026095 Bacteria 3862
271 Ga0207676_10152595 3300026095 Bacteria 1991
272 Ga0207676_10157554 3300026095 Bacteria 1963
273 Ga0207674_10003892 3300026116 Bacteria 18168
274 Ga0207674_10014227 3300026116 Bacteria 8792
275 Ga0207674_10052218 3300026116 Bacteria 4169
276 Ga0207674_10065641 3300026116 Bacteria 3657
277 Ga0207675_100003184 3300026118 Bacteria 16099
278 Ga0207683_10059285 3300026121 Bacteria 3363
279 Ga0207683_10062668 3300026121 Bacteria 3275
280 Ga0207683_10074714 3300026121 Bacteria 2999
281 Ga0207698_10009481 3300026142 Bacteria 6211
282 Ga0207698_10010271 3300026142 Bacteria 6004
283 Ga0207698_10049305 3300026142 Bacteria 3204
284 Ga0207428_10002251 3300027907 Bacteria 19383
285 Ga0207428_10003714 3300027907 Bacteria 14663
286 Ga0268266_10000189 3300028379 Bacteria 109217
287 Ga0268264_10001252 3300028381 Bacteria 24211
288 Ga0268264_10035441 3300028381 Bacteria 4108
289 Ga0268264_10037816 3300028381 Bacteria 3981
290 Ga0268264_10038668 3300028381 Bacteria 3939
291 Ga0265338_10001025 3300028800 Bacteria 46870
292 Ga0265331_10002139 3300031250 Bacteria 13583
293 Ga0265327_10002474 3300031251 Bacteria 19424
294 Ga0265316_10127117 3300031344 Bacteria 1922
295 Ga0307513_10005691 3300031456 Bacteria 16403
296 Ga0307513_10172473 3300031456 Bacteria 2039
297 Ga0373936_0001185 3300035113 Bacteria 9380
298 Ga0373945_0008925 3300035116 Bacteria 3276
299 Ga0373925_0017438 3300037068 Bacteria 5204
300 Ga0373925_0057331 3300037068 Bacteria 2918
301 Ga0395899_0063517 3300037312 Bacteria 2716
302 Ga0395900_0000072 3300037418 Bacteria 187428
303 Ga0395900_0007306 3300037418 Bacteria 11426
304 Ga0395898_0004864 3300037466 Bacteria 14586
305 Ga0395898_0013377 3300037466 Bacteria 8452
306 Ga0395905_0005411 3300037471 Bacteria 13044
307 Ga0395905_0006177 3300037471 Bacteria 12094
308 Ga0395905_0024502 3300037471 Bacteria 5694
309 Ga0395905_0040339 3300037471 Bacteria 4379
310 Ga0395905_0156345 3300037471 Bacteria 2144
311 Ga0395901_0000052 3300038443 Bacteria 165888
312 Ga0395901_0069170 3300038443 Bacteria 3676
313 Ga0436365_0176299 3300039437 Bacteria 12512
314 Ga0436365_0711381 3300039437 Bacteria 5665
315 Ga0436365_1279257 3300039437 Bacteria 36311
316 Ga0439453_0003261 3300041408 Bacteria 2320
317 Ga0450890_001506 3300042127 Bacteria 3352
318 Ga0466968_0043857 3300044735 Bacteria 1895
319 Ga0451576_0049720 3300045051 Bacteria 4400
320 Ga0495590_0002070 3300046457 Bacteria 8419
321 Ga0495638_0000697 3300046460 Bacteria 36411
322 Ga0495651_0012083 3300046462 Bacteria 6646
323 Ga0495610_0003725 3300046512 Bacteria 11669
324 Ga0495632_0004506 3300046519 Bacteria 9441
325 Ga0495642_0010987 3300046528 Bacteria 3471
326 Ga0495598_0001506 3300046537 Bacteria 4644
327 Ga0495598_0009002 3300046537 Bacteria 2344
328 Ga0495597_0065433 3300046542 Bacteria 1577
329 Ga0495633_0000423 3300046558 Bacteria 43996
330 Ga0495656_0021119 3300046615 Bacteria 2532
331 Ga0495611_0001744 3300046648 Bacteria 10530
332 Ga0495625_0030310 3300046660 Bacteria 4038
333 Ga0495658_0017716 3300046683 Bacteria 3687
334 Ga0495658_0066165 3300046683 Bacteria 2087
335 Ga0495649_0001645 3300046694 Bacteria 16624
336 Ga0495687_000359 3300047443 Bacteria 57119
337 Ga0495687_004477 3300047443 Bacteria 9413
338 Ga0495675_0087303 3300047444 Bacteria 1960
339 Ga0495684_0053906 3300047471 Bacteria 3068
340 Ga0495684_0098994 3300047471 Bacteria 2205
341 Ga0496106_0015493 3300048909 Bacteria 5641
342 Ga0496107_0002208 3300048910 Bacteria 12509
343 Ga0496107_0102240 3300048910 Bacteria 2101
344 Ga0496110_0014445 3300048913 Bacteria 6558
345 Ga0496114_0054305 3300048917 Bacteria 3341
346 Ga0496115_0001097 3300048918 Bacteria 19591
347 Ga0496115_0002362 3300048918 Bacteria 13536
348 Ga0496116_0013457 3300048919 Bacteria 6595
349 Ga0496121_0007143 3300048924 Bacteria 13549
350 Ga0496121_0025451 3300048924 Bacteria 5613
351 Ga0496121_0039914 3300048924 Bacteria 4127
352 Ga0496122_0002454 3300048925 Bacteria 26240
353 Ga0496123_0005921 3300048926 Bacteria 12045
354 Ga0496126_0008705 3300048929 Bacteria 10897
355 Ga0496126_0077300 3300048929 Bacteria 2951
356 Ga0501308_002015 3300049128 Bacteria 1730
357 Ga0495678_001180 3300049459 Bacteria 21531
358 Ga0501046_0000108 3300049580 Bacteria 87513
359 Ga0501046_0017217 3300049580 Bacteria 6039
360 Ga0501047_0108180 3300049581 Bacteria 2662
361 Ga0501048_0044489 3300049582 Bacteria 3175
362 Ga0501067_0008094 3300049583 Bacteria 5840
363 Ga0501068_0080154 3300049584 Bacteria 2002
364 Ga0501070_0003924 3300049586 Bacteria 12830
365 Ga0501073_0065214 3300049589 Bacteria 2540
366 Ga0501074_0060868 3300049590 Bacteria 2720
367 Ga0501075_0062499 3300049591 Bacteria 2807
368 Ga0501077_0000783 3300049593 Bacteria 19244
369 Ga0501080_0028780 3300049742 Bacteria 5172
370 Ga0501266_000304 3300049763 Bacteria 6530
371 nmdc:mga03683_2643_c1 3300050489 Bacteria 5606
372 nmdc:mga0k408_1108_c1 3300050493 Bacteria 14757
373 nmdc:mga0k408_37701_c1 3300050493 Bacteria 2775
374 nmdc:mga0k408_6222_c1 3300050493 Bacteria 6368
375 nmdc:mga06z11_31537_c1 3300050494 Bacteria 2576
376 nmdc:mga07m45_2070_c1 3300050496 Bacteria 9318
377 nmdc:mga07m45_22702_c1 3300050496 Bacteria 3428
378 nmdc:mga07m45_33233_c1 3300050496 Bacteria 2864
379 nmdc:mga07m45_70822_c1 3300050496 Bacteria 1763
380 nmdc:mga05p37_322_c1 3300050507 Bacteria 43725
381 nmdc:mga09592_1363_c1 3300050508 Bacteria 19542
382 nmdc:mga0qj67_25331_c1 3300050509 Bacteria 4583
383 nmdc:mga06r32_11454_c1 3300050510 Bacteria 7986
384 nmdc:mga06r32_146573_c1 3300050510 Bacteria 2338
385 nmdc:mga06r32_166032_c1 3300050510 Bacteria 2190
386 nmdc:mga06r32_503_c1 3300050510 Bacteria 33642
387 nmdc:mga08y16_19517_c1 3300050511 Bacteria 7148
388 nmdc:mga08y16_339_c1 3300050511 Bacteria 42408
389 nmdc:mga0n895_3632_c1 3300050512 Bacteria 12469
390 nmdc:mga0a205_61616_c1 3300050515 Bacteria 3624
391 nmdc:mga0a205_9387_c1 3300050515 Bacteria 8940
392 Ga0495619_0016423 3300053085 Bacteria 4687
393 Ga0500578_0000008 3300053086 Bacteria 223557
394 Ga0500556_0000361 3300053104 Bacteria 33823
395 Ga0500562_010592 3300053108 Bacteria 2338
396 Ga0500562_012681 3300053108 Bacteria 2146
397 Ga0500593_000607 3300053117 Bacteria 13785
398 Ga0500594_0000071 3300053118 Bacteria 31990
399 Ga0500618_001381 3300053125 Bacteria 10986
400 Ga0500636_0018268 3300053177 Bacteria 4146
401 Ga0500645_005009 3300053730 Bacteria 4962
402 Ga0500601_000405 3300053737 Bacteria 7280
403 2508735840 2508501050 Bacteria 9633614
404 2511398898 2511231028 Bacteria 8046582
405 2545674984 2545555834 Bacteria 8130841
406 2644731950 2643221733 Bacteria 5690728
407 2644746784 2643221736 Bacteria 6608466
408 2738743302 2738541281 Bacteria 5112672
409 2739352919 2738543032 Bacteria 5115625
410 2774869896 2773857925 Bacteria 6472445
411 2808984600 2808606386 Bacteria 4471946
412 2809130855 2808606415 Bacteria 4576710
413 2809150810 2808606419 Bacteria 4576925
414 2828305987 2828305725 Bacteria 4916900
415 2829746883 2829745981 Bacteria 5406054
416 2831868413 2831864461 Bacteria 6502356
417 2841762575 2841760612 Bacteria 6454112
418 2842700847 2842698319 Bacteria 5190321
419 2842777290 2842775625 Bacteria 5587290
420 2844110113 2844104063 Bacteria 6440972
421 2851187023 2851182111 Bacteria 6047226
422 2851248588 2851246043 Bacteria 6439203
423 2852622329 2852618963 Bacteria 4577824
424 2861696673 2861691609 Bacteria 5628931
425 2874629379 2874628541 Bacteria 8630250
426 2882461919 2882456835 Bacteria 6863978
427 2883580845 2883577096 Bacteria 4709178
428 2894773237 2894772417 Bacteria 5305674
429 2899259896 2899259804 Bacteria 3320927
430 2904479450 2904479285 Bacteria 5073931
431 2928973322 2928972540 Bacteria 3058286
432 2929204754 2929199973 Bacteria 7260745
433 2941532183 2941531003 Bacteria 7653939
434 2977240684 2977240413 Bacteria 3191065
435 2990710976 2990710928 Bacteria 5002431
436 3003668505 3003665799 Bacteria 7279786
437 641645312 641522639 Bacteria 7737025
438 643603935 643348564 Bacteria 8839022
439 8006973078 8006964411 Bacteria 8966052
440 8055915567 8055909800 Bacteria 7278581
441 8057535366 8057529695 Bacteria 6306553
442 Ga0111539_10004446
443 JGI24740J21852_10015226
444 JGI24735J21928_10003548
445 JGI25160J50197_1000480
446 JGI25161J50226_1000077
447 Ga0055538_1000002
448 Ga0055526_1000051
449 Ga0055526_1005225
450 Ga0055537_1000606
451 Ga0055540_1011705
452 Ga0055531_10006878
453 Ga0055531_10008827
454 Ga0065165_1000006
455 Ga0065165_1000667
456 Ga0070676_10001104
457 Ga0070676_10015470
458 Ga0070670_100000065
459 Ga0070670_100000859
460 Ga0070670_100030201
461 Ga0070677_10008377
462 Ga0070677_10019407
463 Ga0068869_100004613
464 Ga0070666_10002089
465 Ga0070680_100003997
466 Ga0068868_100007743
467 Ga0068868_100016211
468 Ga0068868_100027100
469 Ga0068868_100048299
470 Ga0070660_100038457
471 Ga0070691_10008549
472 Ga0070661_100008604
473 Ga0070661_100027933
474 Ga0070661_100047356
475 Ga0070668_100028331
476 Ga0070668_100054889
477 Ga0070675_100004029
478 Ga0070675_100031332
479 Ga0070675_100033600
480 Ga0070675_100090054
481 Ga0070671_100044034
482 Ga0070688_100010014
483 Ga0070659_100005105
484 Ga0070659_100008021
485 Ga0070659_100049073
486 Ga0070667_100027525
487 Ga0070709_10013319
488 Ga0070711_100098132
489 Ga0070708_100085421
490 Ga0070663_100004060
491 Ga0070678_100019052
492 Ga0070681_10025956
493 Ga0070681_10190105
494 Ga0068867_100006127
495 Ga0070706_100001550
496 Ga0070706_100126659
497 Ga0070707_100161840
498 Ga0070679_100098252
499 Ga0070684_100019651
500 Ga0070697_100098327
501 Ga0068853_100007158
502 Ga0068853_100160977
503 Ga0070672_100000715
504 Ga0070672_100027275
505 Ga0070672_100028927
506 Ga0070672_100058126
507 Ga0070693_100057710
508 Ga0070665_100001028
509 Ga0068855_100000046
510 Ga0068855_100005243
511 Ga0068855_100037088
512 Ga0070664_100003412
513 Ga0070664_100018549
514 Ga0068857_100011068
515 Ga0068857_100125317
516 Ga0068854_100001191
517 Ga0068856_100000413
518 Ga0068856_100014735
519 Ga0068856_100023554
520 Ga0070702_100015053
521 Ga0068852_100001668
522 Ga0068852_100004312
523 Ga0068852_100016290
524 Ga0068852_100069429
525 Ga0068859_100023484
526 Ga0068864_100002106
527 Ga0068864_100002202
528 Ga0068864_100015046
529 Ga0068861_100067158
530 Ga0068851_10002471
531 Ga0068851_10002800
532 Ga0068863_100030998
533 Ga0068863_100041252
534 Ga0068858_100002151
535 Ga0068860_100084337
536 Ga0081455_10031537
537 Ga0081538_10001450
538 Ga0075365_10035485
539 Ga0075363_100001403
540 Ga0075362_10000094
541 Ga0075367_10005464
542 Ga0075367_10043171
543 Ga0075366_10028749
544 Ga0097621_100016725
545 Ga0075370_10001282
546 Ga0068871_100041883
547 Ga0068871_100044900
548 Ga0068871_100049635
549 Ga0075428_100001784
550 Ga0075428_100018833
551 Ga0075428_100027618
552 Ga0075430_100005809
553 Ga0075431_100001191
554 Ga0075431_100135846
555 Ga0075433_10054484
556 Ga0097620_100023485
557 Ga0099823_1008208
558 Ga0105240_10005496
559 Ga0105240_10009285
560 Ga0105240_10042848
561 Ga0111539_10010958
562 Ga0111539_10032929
563 Ga0114129_10000067
564 Ga0105243_10016971
565 Ga0105243_10025781
566 Ga0105241_10001014
567 Ga0105241_10095713
568 Ga0105241_10119521
569 Ga0105242_10178385
570 Ga0105248_10000661
571 Ga0105248_10002785
572 Ga0105248_10066543
573 Ga0105237_10122942
574 Ga0105238_10003379
575 Ga0105238_10009053
576 Ga0105238_10026790
577 Ga0105238_10123820
578 Ga0105238_10131988
579 Ga0105249_10007813
580 Ga0105249_10096257
581 Ga0105239_10017835
582 Ga0157319_1000010
583 Ga0157369_10037841
584 Ga0157374_10003234
585 Ga0157374_10022831
586 Ga0157374_10066992
587 Ga0157374_10074214
588 Ga0163162_10004711
589 Ga0157372_10003093
590 Ga0157375_10068932
591 Ga0157375_10077880
592 Ga0157375_10193869
593 Ga0163163_10014735
594 Ga0163163_10082540
595 Ga0157380_10000286
596 Ga0157380_10015452
597 Ga0157379_10009580
598 Ga0157376_10001763
599 Ga0182007_10003693
600 Ga0213876_10001767
601 Ga0209673_1008508
602 Ga0209130_1000040
603 Ga0209130_1000106
604 Ga0209675_1009674
605 Ga0209025_1004920
606 Ga0209564_1000003
607 Ga0209564_1000054
608 Ga0209050_1002810
609 Ga0209050_1015501
610 Ga0209256_1000204
611 Ga0209256_1003985
612 Ga0207426_1000999
613 Ga0207426_1027242
614 Ga0209051_1000740
615 Ga0209257_1001275
616 Ga0209257_1001707
617 Ga0207656_10002688
618 Ga0207656_10013777
619 Ga0207656_10033314
620 Ga0207682_10011793
621 Ga0207680_10000754
622 Ga0207699_10011363
623 Ga0207705_10081522
624 Ga0207705_10088164
625 Ga0207684_10006230
626 Ga0207684_10111726
627 Ga0207654_10000131
628 Ga0207707_10086442
629 Ga0207695_10000463
630 Ga0207695_10003006
631 Ga0207695_10003703
632 Ga0207693_10015346
633 Ga0207663_10064701
634 Ga0207657_10021593
635 Ga0207657_10051497
636 Ga0207657_10072200
637 Ga0207649_10007824
638 Ga0207649_10042924
639 Ga0207652_10082262
640 Ga0207681_10000311
641 Ga0207694_10000086
642 Ga0207694_10012378
643 Ga0207694_10074475
644 Ga0207650_10001471
645 Ga0207650_10006627
646 Ga0207650_10046259
647 Ga0207650_10103602
648 Ga0207659_10005178
649 Ga0207659_10010445
650 Ga0207659_10023129
651 Ga0207659_10044356
652 Ga0207659_10081557
653 Ga0207659_10088664
654 Ga0207687_10070905
655 Ga0207644_10010856
656 Ga0207644_10067651
657 Ga0207690_10000352
658 Ga0207690_10034533
659 Ga0207690_10069755
660 Ga0207709_10003750
661 Ga0207669_10024811
662 Ga0207704_10004967
663 Ga0207704_10027254
664 Ga0207691_10005187
665 Ga0207691_10006501
666 Ga0207691_10068969
667 Ga0207711_10000316
668 Ga0207711_10003356
669 Ga0207711_10023916
670 Ga0207711_10038411
671 Ga0207689_10000578
672 Ga0207661_10149828
673 Ga0207679_10020236
674 Ga0207679_10107730
675 Ga0207667_10009755
676 Ga0207667_10035941
677 Ga0207667_10061585
678 Ga0207651_10003959
679 Ga0207651_10026382
680 Ga0207712_10005408
681 Ga0207712_10023597
682 Ga0207712_10053741
683 Ga0207668_10003171
684 Ga0207668_10035116
685 Ga0207668_10092402
686 Ga0207640_10018098
687 Ga0207640_10018214
688 Ga0207640_10100660
689 Ga0207658_10000459
690 Ga0207658_10059491
691 Ga0207677_10018408
692 Ga0207677_10028755
693 Ga0207677_10072904
694 Ga0207703_10001017
695 Ga0207703_10002090
696 Ga0207703_10007591
697 Ga0207639_10007057
698 Ga0207639_10014431
699 Ga0207639_10065560
700 Ga0207678_10016210
701 Ga0207678_10171386
702 Ga0207702_10000098
703 Ga0207702_10000627
704 Ga0207702_10010139
705 Ga0207641_10000594
706 Ga0207641_10035186
707 Ga0207641_10081470
708 Ga0207641_10099818
709 Ga0207676_10001477
710 Ga0207676_10011882
711 Ga0207676_10033897
712 Ga0207676_10152595
713 Ga0207676_10157554
714 Ga0207674_10003892
715 Ga0207674_10014227
716 Ga0207674_10052218
717 Ga0207674_10065641
718 Ga0207675_100003184
719 Ga0207683_10059285
720 Ga0207683_10062668
721 Ga0207683_10074714
722 Ga0207698_10009481
723 Ga0207698_10010271
724 Ga0207698_10049305
725 Ga0207428_10002251
726 Ga0207428_10003714
727 Ga0268266_10000189
728 Ga0268264_10001252
729 Ga0268264_10035441
730 Ga0268264_10037816
731 Ga0268264_10038668
732 Ga0265338_10001025
733 Ga0265331_10002139
734 Ga0265327_10002474
735 Ga0265316_10127117
736 Ga0307513_10005691
737 Ga0307513_10172473
738 Ga0373936_0001185
739 Ga0373945_0008925
740 Ga0373925_0017438
741 Ga0373925_0057331
742 Ga0395899_0063517
743 Ga0395900_0000072
744 Ga0395900_0007306
745 Ga0395898_0004864
746 Ga0395898_0013377
747 Ga0395905_0005411
748 Ga0395905_0006177
749 Ga0395905_0024502
750 Ga0395905_0040339
751 Ga0395905_0156345
752 Ga0395901_0000052
753 Ga0395901_0069170
754 Ga0436365_0176299
755 Ga0436365_0711381
756 Ga0436365_1279257
757 Ga0439453_0003261
758 Ga0450890_001506
759 Ga0466968_0043857
760 Ga0451576_0049720
761 Ga0495590_0002070
762 Ga0495638_0000697
763 Ga0495651_0012083
764 Ga0495610_0003725
765 Ga0495632_0004506
766 Ga0495642_0010987
767 Ga0495598_0001506
768 Ga0495598_0009002
769 Ga0495597_0065433
770 Ga0495633_0000423
771 Ga0495656_0021119
772 Ga0495611_0001744
773 Ga0495625_0030310
774 Ga0495658_0017716
775 Ga0495658_0066165
776 Ga0495649_0001645
777 Ga0495687_000359
778 Ga0495687_004477
779 Ga0495675_0087303
780 Ga0495684_0053906
781 Ga0495684_0098994
782 Ga0496106_0015493
783 Ga0496107_0002208
784 Ga0496107_0102240
785 Ga0496110_0014445
786 Ga0496114_0054305
787 Ga0496115_0001097
788 Ga0496115_0002362
789 Ga0496116_0013457
790 Ga0496121_0007143
791 Ga0496121_0025451
792 Ga0496121_0039914
793 Ga0496122_0002454
794 Ga0496123_0005921
795 Ga0496126_0008705
796 Ga0496126_0077300
797 Ga0501308_002015
798 Ga0495678_001180
799 Ga0501046_0000108
800 Ga0501046_0017217
801 Ga0501047_0108180
802 Ga0501048_0044489
803 Ga0501067_0008094
804 Ga0501068_0080154
805 Ga0501070_0003924
806 Ga0501073_0065214
807 Ga0501074_0060868
808 Ga0501075_0062499
809 Ga0501077_0000783
810 Ga0501080_0028780
811 Ga0501266_000304
812 nmdc:mga03683_2643_c1
813 nmdc:mga0k408_1108_c1
814 nmdc:mga0k408_37701_c1
815 nmdc:mga0k408_6222_c1
816 nmdc:mga06z11_31537_c1
817 nmdc:mga07m45_2070_c1
818 nmdc:mga07m45_22702_c1
819 nmdc:mga07m45_33233_c1
820 nmdc:mga07m45_70822_c1
821 nmdc:mga05p37_322_c1
822 nmdc:mga09592_1363_c1
823 nmdc:mga0qj67_25331_c1
824 nmdc:mga06r32_11454_c1
825 nmdc:mga06r32_146573_c1
826 nmdc:mga06r32_166032_c1
827 nmdc:mga06r32_503_c1
828 nmdc:mga08y16_19517_c1
829 nmdc:mga08y16_339_c1
830 nmdc:mga0n895_3632_c1
831 nmdc:mga0a205_61616_c1
832 nmdc:mga0a205_9387_c1
833 Ga0495619_0016423
834 Ga0500578_0000008
835 Ga0500556_0000361
836 Ga0500562_010592
837 Ga0500562_012681
838 Ga0500593_000607
839 Ga0500594_0000071
840 Ga0500618_001381
841 Ga0500636_0018268
842 Ga0500645_005009
843 Ga0500601_000405
844 2508735840
845 2511398898
846 2545674984
847 2644731950
848 2644746784
849 2738743302
850 2739352919
851 2774869896
852 2808984600
853 2809130855
854 2809150810
855 2828305987
856 2829746883
857 2831868413
858 2841762575
859 2842700847
860 2842777290
861 2844110113
862 2851187023
863 2851248588
864 2852622329
865 2861696673
866 2874629379
867 2882461919
868 2883580845
869 2894773237
870 2899259896
871 2904479450
872 2928973322
873 2929204754
874 2941532183
875 2977240684
876 2990710976
877 3003668505
878 641645312
879 643603935
880 8006973078
881 8055915567
882 8057535366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

70

310

0.9

PF07690

MFS_1

Major Facilitator Superfamily

74

407

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.7581 23 548
8et9-assembly1.cif.gz_A cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium 0.7525 64 552
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.7488 23 548
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.7431 16 544
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.7424 23 548
ID Description Score Start End Superfamily
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9745 21 233 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.965 22 238 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9609 21 233 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.952 22 238 1.20.1250.20
af_P76350_21_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9298 20 238 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V9PLT9-F1-model_v4 deleted 0.9626 19 187
AF-A0A7V9PLT9-F1-model_v4 deleted 0.9463 19 187
AF-A0A3N2H7W3-F1-model_v4 Sugar transport protein 0.9412 15 557 GO:0005886
GO:0022857
AF-A0A2S8MBV9-F1-model_v4 deleted 0.9388 11 217
AF-A0A4P6RMN8-F1-model_v4 deleted 0.9378 20 136

Map