F444703

General Info

Members Datasets Scaffolds Average Seq Length
441 290 406 233

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0035227|Ga0439436_0035227_555_1355
Length 266
Sequence LAKAAFLFPFLEPNIRAKETNAMNDNTTSAGGATLHYIFDPMCGWCYAAAPLVDAAREVPGLQVAFHGGGMMTGANRRAITPQWRDYVLPHDRRIAELSGQPFGEAYFEGLLRDIGAVMDSEPPTTAILAAEALRAGGGLDMIHRLQRAHYVEGRRIADPQVLAAIAKELGFDSDAFASAVSRLSGEATSKHMAESRQWLQRAGGQGFPTFVLAQADGTASRIEIGPWLGRPEEWKAQLTKLVPPLPMASDDGAGPASCGPDSCAI

Samples

Sample ID Description Type Environment
1 2511231031 Pseudomonas sp. GM16 Isolate Nodule
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2721755523 Delftia sp. HK171 Isolate Unclassified
15 2738541307 Variovorax sp. GV008 Isolate Unclassified
16 2818991446 Variovorax sp. 1180 Isolate Unclassified
17 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
18 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
19 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
20 2842677519 Variovorax sp. R-72495 Isolate Unclassified
21 2899924645 Variovorax sp. 369 Isolate Unclassified
22 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
23 2904456579 Variovorax sp. 2002 Isolate Unclassified
24 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
25 2928037797 Variovorax sp. 1126 Isolate Unclassified
26 2928044640 Variovorax sp. 1128 Isolate Unclassified
27 2928051484 Variovorax sp. 1133 Isolate Unclassified
28 2928058823 Ralstonia sp. 1138 Isolate Unclassified
29 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
30 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
31 2929520902 Variovorax beijingensis 502 Isolate Unclassified
32 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
33 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
34 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
35 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
43 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
47 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
48 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
49 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
50 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
51 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
52 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
64 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
124 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
125 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
157 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
158 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
195 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
198 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
209 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
271 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
272 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
273 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
274 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
275 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
276 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
277 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
278 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
279 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
280 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
281 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
282 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
285 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
290 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.61
Metatranscriptomes 0.45
Isolates 7.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.55
Nodule 1.13
Rhizoplane 3.17
Rhizosphere 41.5
Stem 0
Stem Tuber 0
Unclassified 15.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002176 3300001979 Bacteria 8961
2 JGI25154J39366_1000728 3300002738 Bacteria 14852
3 JGI25152J39213_1004260 3300002773 Bacteria 4571
4 JGI25150J39212_1002064 3300002774 Bacteria 5219
5 JGI25159J45721_1003932 3300002987 Bacteria 5076
6 JGI25151J46595_10002505 3300003187 Bacteria 10953
7 JGI25151J46595_10005576 3300003187 Bacteria 6476
8 JGI25151J46595_10009579 3300003187 Bacteria 4571
9 JGI25151J46595_10032976 3300003187 Bacteria 2000
10 JGI25153J46596_10009355 3300003215 Bacteria 4571
11 JGI25153J46596_10027324 3300003215 Bacteria 2000
12 rootH1_10023862 3300003316 Bacteria 6750
13 rootL2_10063325 3300003322 Bacteria 8266
14 rootL2_10077671 3300003322 Bacteria 5907
15 rootL2_10089550 3300003322 Bacteria 3116
16 rootL2_10118035 3300003322 Bacteria 2923
17 rootH1_10006562 3300003323 Bacteria 2087
18 JGI25160J50197_1005823 3300003354 Bacteria 5075
19 JGI25160J50197_1047861 3300003354 Bacteria 928
20 JGI25161J50226_1002265 3300003374 Bacteria 5046
21 JGI25161J50226_1008394 3300003374 Bacteria 1596
22 Ga0006562J51391_1041496 3300003578 Bacteria 2550
23 Ga0006562J51391_1041498 3300003578 Bacteria 1170
24 Ga0055539_1005505 3300003752 Bacteria 1644
25 Ga0055533_1001092 3300003756 Bacteria 7766
26 Ga0055525_1000001 3300003759 Bacteria 1016948
27 Ga0055535_1000084 3300003761 Bacteria 104652
28 Ga0055542_1000033 3300003762 Bacteria 233997
29 Ga0055542_1000998 3300003762 Bacteria 18140
30 Ga0055526_1008564 3300003771 Bacteria 5075
31 Ga0055526_1014019 3300003771 Bacteria 3335
32 Ga0055537_1000304 3300003773 Bacteria 34030
33 Ga0055537_1001934 3300003773 Bacteria 7407
34 Ga0055524_1006474 3300003775 Bacteria 5075
35 Ga0055524_1016802 3300003775 Bacteria 2606
36 Ga0055536_1002635 3300003781 Bacteria 9992
37 Ga0055536_1008104 3300003781 Bacteria 4579
38 Ga0055536_1015572 3300003781 Bacteria 2591
39 Ga0055534_1000289 3300003784 Bacteria 34030
40 Ga0055534_1002126 3300003784 Bacteria 7111
41 Ga0055534_1009187 3300003784 Bacteria 2167
42 Ga0055534_1016796 3300003784 Bacteria 1306
43 Ga0055528_1001591 3300003790 Bacteria 13460
44 Ga0055528_1003827 3300003790 Bacteria 7407
45 Ga0055528_1008354 3300003790 Bacteria 4449
46 Ga0055530_10002739 3300003791 Bacteria 10912
47 Ga0055530_10005477 3300003791 Bacteria 6014
48 Ga0055540_1001631 3300003792 Bacteria 13023
49 Ga0055540_1002247 3300003792 Bacteria 10436
50 Ga0055540_1003189 3300003792 Bacteria 8072
51 Ga0055540_1016460 3300003792 Bacteria 2104
52 Ga0055531_10003251 3300003794 Bacteria 10436
53 Ga0055531_10022613 3300003794 Bacteria 2389
54 Ga0055531_10023811 3300003794 Bacteria 2280
55 Ga0055541_1001160 3300003841 Bacteria 5904
56 Ga0055543_1004070 3300004625 Bacteria 4095
57 Ga0055543_1004536 3300004625 Bacteria 3751
58 Ga0065165_1005230 3300005262 Bacteria 7445
59 Ga0065704_10080737 3300005289 Bacteria 3888
60 Ga0070658_10067074 3300005327 Bacteria 2932
61 Ga0068869_100409435 3300005334 Bacteria 1117
62 Ga0070659_100001403 3300005366 Bacteria 17373
63 Ga0070663_100003407 3300005455 Bacteria 9182
64 Ga0070662_100014013 3300005457 Bacteria 5344
65 Ga0070665_100592387 3300005548 Bacteria 1122
66 Ga0070664_100014166 3300005564 Bacteria 6504
67 Ga0070664_100063871 3300005564 Bacteria 3139
68 Ga0068857_100128106 3300005577 Bacteria 2288
69 Ga0068854_100074464 3300005578 Bacteria 2491
70 Ga0068859_100292493 3300005617 Bacteria 1722
71 Ga0068851_10009449 3300005834 Bacteria 4535
72 Ga0068858_100346603 3300005842 Bacteria 1422
73 Ga0068860_100382663 3300005843 Bacteria 1389
74 Ga0075365_10001357 3300006038 Bacteria 10977
75 Ga0075363_100025734 3300006048 Bacteria 3004
76 Ga0075364_10009520 3300006051 Bacteria 5832
77 Ga0075432_10012826 3300006058 Bacteria 2849
78 Ga0075432_10021241 3300006058 Bacteria 2218
79 Ga0075362_10026555 3300006177 Bacteria 2474
80 Ga0075367_10106416 3300006178 Bacteria 1719
81 Ga0075367_10115978 3300006178 Bacteria 1647
82 Ga0075369_10034228 3300006186 Bacteria 2156
83 Ga0075366_10010210 3300006195 Bacteria 5268
84 Ga0075366_10014967 3300006195 Bacteria 4436
85 Ga0075366_10134041 3300006195 Bacteria 1495
86 Ga0075370_10001132 3300006353 Bacteria 11187
87 Ga0075370_10002513 3300006353 Bacteria 8516
88 Ga0075370_10002672 3300006353 Bacteria 8336
89 Ga0075370_10005589 3300006353 Bacteria 6270
90 Ga0075370_10010790 3300006353 Bacteria 4790
91 Ga0075370_10065901 3300006353 Bacteria 2065
92 Ga0075370_10095699 3300006353 Bacteria 1715
93 Ga0097620_100292495 3300006931 Bacteria 1722
94 Ga0079104_1000051 3300006946 Bacteria 171217
95 Ga0099826_10006070 3300006948 Bacteria 8754
96 Ga0105251_10071289 3300009011 Bacteria 1617
97 Ga0105244_10001156 3300009036 Bacteria 21857
98 Ga0105244_10054961 3300009036 Bacteria 2018
99 Ga0105243_10000314 3300009148 Bacteria 53404
100 Ga0105243_10002240 3300009148 Bacteria 16253
101 Ga0105243_10021679 3300009148 Bacteria 4877
102 Ga0105238_10130815 3300009551 Bacteria 2488
103 Ga0105239_10763569 3300010375 Bacteria 1107
104 Ga0105239_11275587 3300010375 Bacteria 847
105 Ga0105246_10115174 3300011119 Bacteria 1982
106 Ga0157347_1012146 3300012502 Bacteria 925
107 Ga0157373_10001556 3300013100 Bacteria 17499
108 Ga0157373_10125411 3300013100 Bacteria 1806
109 Ga0157372_10106126 3300013307 Bacteria 3213
110 Ga0157375_10170915 3300013308 Bacteria 2321
111 Ga0182008_10003206 3300014497 Bacteria 9994
112 Ga0182008_10004736 3300014497 Bacteria 7885
113 Ga0182008_10010782 3300014497 Bacteria 4884
114 Ga0157379_10024111 3300014968 Bacteria 5400
115 Ga0157376_10137949 3300014969 Bacteria 2185
116 Ga0182006_1001535 3300015261 Bacteria 13801
117 Ga0182006_1004401 3300015261 Bacteria 6958
118 Ga0182006_1105221 3300015261 Bacteria 996
119 Ga0182007_10001565 3300015262 Bacteria 12204
120 Ga0182007_10106193 3300015262 Bacteria 932
121 Ga0163161_10002513 3300017792 Bacteria 13087
122 Ga0163161_10098137 3300017792 Bacteria 2177
123 Ga0213872_10000043 3300021361 Bacteria 117678
124 Ga0213872_10000194 3300021361 Bacteria 54029
125 Ga0213872_10021315 3300021361 Bacteria 2984
126 Ga0209436_105643 3300025208 Bacteria 2842
127 Ga0209784_100463 3300025224 Bacteria 16904
128 Ga0209566_100238 3300025225 Bacteria 52918
129 Ga0209674_100118 3300025226 Bacteria 135635
130 Ga0209672_100500 3300025228 Bacteria 21746
131 Ga0209147_101992 3300025229 Bacteria 5935
132 Ga0209563_100007 3300025230 Bacteria 1579402
133 Ga0209563_104864 3300025230 Bacteria 2512
134 Ga0209437_103462 3300025233 Bacteria 2857
135 Ga0209258_100089 3300025242 Bacteria 234040
136 Ga0207425_1000355 3300025245 Bacteria 31804
137 Ga0207425_1004767 3300025245 Bacteria 3992
138 Ga0209646_1000106 3300025246 Bacteria 163422
139 Ga0209646_1000203 3300025246 Bacteria 70126
140 Ga0209026_1010157 3300025250 Bacteria 1779
141 Ga0209677_103775 3300025253 Bacteria 4713
142 Ga0209677_104467 3300025253 Bacteria 4020
143 Ga0209148_1000021 3300025254 Bacteria 714645
144 Ga0209148_1000097 3300025254 Bacteria 234049
145 Ga0209759_1003451 3300025256 Bacteria 6286
146 Ga0209759_1025689 3300025256 Bacteria 1248
147 Ga0209129_1000033 3300025258 Bacteria 336894
148 Ga0209129_1002441 3300025258 Bacteria 9126
149 Ga0209129_1007636 3300025258 Bacteria 3170
150 Ga0209565_1000120 3300025263 Bacteria 111458
151 Ga0209565_1000586 3300025263 Bacteria 24589
152 Ga0209673_1000099 3300025273 Bacteria 193248
153 Ga0209673_1000185 3300025273 Bacteria 125742
154 Ga0209673_1001345 3300025273 Bacteria 24589
155 Ga0209673_1002340 3300025273 Bacteria 13407
156 Ga0209673_1009259 3300025273 Bacteria 4291
157 Ga0209130_1000736 3300025284 Bacteria 28751
158 Ga0209130_1001586 3300025284 Bacteria 14275
159 Ga0209675_1000054 3300025291 Bacteria 193248
160 Ga0209675_1000296 3300025291 Bacteria 46253
161 Ga0209675_1000539 3300025291 Bacteria 27695
162 Ga0209675_1005972 3300025291 Bacteria 4984
163 Ga0209675_1030979 3300025291 Bacteria 1269
164 Ga0209676_1000179 3300025292 Bacteria 150096
165 Ga0209676_1000896 3300025292 Bacteria 37733
166 Ga0209676_1001185 3300025292 Bacteria 28045
167 Ga0209676_1014410 3300025292 Bacteria 2974
168 Ga0209025_1000743 3300025294 Bacteria 54915
169 Ga0209025_1001001 3300025294 Bacteria 41900
170 Ga0209025_1004122 3300025294 Bacteria 12910
171 Ga0209025_1016063 3300025294 Bacteria 4455
172 Ga0209025_1024708 3300025294 Bacteria 3091
173 Ga0209025_1058521 3300025294 Bacteria 1463
174 Ga0209564_1000151 3300025295 Bacteria 168783
175 Ga0209564_1000246 3300025295 Bacteria 117096
176 Ga0209564_1029920 3300025295 Bacteria 1700
177 Ga0209758_1000027 3300025297 Bacteria 549650
178 Ga0209758_1033408 3300025297 Bacteria 2066
179 Ga0209050_1000172 3300025298 Bacteria 150096
180 Ga0209050_1001732 3300025298 Bacteria 21715
181 Ga0209256_1000069 3300025299 Bacteria 245640
182 Ga0209256_1000161 3300025299 Bacteria 138270
183 Ga0207426_1000027 3300025302 Bacteria 513176
184 Ga0207426_1000115 3300025302 Bacteria 227423
185 Ga0209051_1000046 3300025303 Bacteria 296424
186 Ga0209051_1000483 3300025303 Bacteria 51423
187 Ga0209051_1000762 3300025303 Bacteria 34275
188 Ga0209051_1000841 3300025303 Bacteria 31619
189 Ga0209051_1006592 3300025303 Bacteria 6512
190 Ga0209257_1000281 3300025304 Bacteria 114413
191 Ga0209257_1001061 3300025304 Bacteria 36348
192 Ga0209257_1004586 3300025304 Bacteria 10543
193 Ga0209257_1005042 3300025304 Bacteria 9604
194 Ga0207656_10032448 3300025321 Bacteria 2169
195 Ga0207655_1005421 3300025728 Bacteria 8674
196 Ga0207655_1013155 3300025728 Bacteria 4770
197 Ga0207690_10001075 3300025932 Bacteria 17471
198 Ga0207706_10032091 3300025933 Bacteria 4677
199 Ga0207709_10000255 3300025935 Bacteria 63944
200 Ga0207709_10000868 3300025935 Bacteria 23068
201 Ga0207709_10247269 3300025935 Bacteria 1301
202 Ga0207665_10222720 3300025939 Bacteria 1383
203 Ga0207679_10046851 3300025945 Bacteria 3137
204 Ga0207679_10075136 3300025945 Bacteria 2563
205 Ga0207679_10108804 3300025945 Bacteria 2183
206 Ga0207640_10068018 3300025981 Bacteria 2386
207 Ga0207640_10429065 3300025981 Bacteria 1084
208 Ga0207639_10119670 3300026041 Bacteria 2161
209 Ga0207639_11007900 3300026041 Bacteria 780
210 Ga0207678_10054214 3300026067 Bacteria 3453
211 Ga0207648_10167212 3300026089 Bacteria 1944
212 Ga0207674_10078613 3300026116 Bacteria 3304
213 Ga0209281_1000005 3300027111 Bacteria 1242284
214 Ga0207428_10058738 3300027907 Bacteria 3051
215 Ga0207428_10216843 3300027907 Bacteria 1436
216 Ga0268266_10647263 3300028379 Bacteria 1017
217 Ga0268265_10005022 3300028380 Bacteria 9079
218 Ga0307517_10101084 3300028786 Bacteria 2273
219 Ga0307515_10000047 3300028794 Bacteria 291475
220 Ga0307515_10014117 3300028794 Bacteria 14850
221 Ga0307515_10137216 3300028794 Bacteria 2650
222 Ga0316176_1059814 3300030732 Bacteria 1975
223 Ga0316178_1056355 3300030735 Bacteria 3852
224 Ga0316181_1076491 3300030744 Bacteria 2894
225 Ga0265331_10006389 3300031250 Bacteria 6977
226 Ga0265327_10000776 3300031251 Bacteria 49288
227 Ga0307408_100012560 3300031548 Bacteria 5613
228 Ga0307408_100407891 3300031548 Bacteria 1168
229 Ga0307508_10000081 3300031616 Bacteria 112337
230 Ga0307514_10000348 3300031649 Bacteria 107998
231 Ga0307514_10014552 3300031649 Bacteria 6509
232 Ga0307516_10003774 3300031730 Bacteria 19253
233 Ga0307405_10000862 3300031731 Bacteria 11976
234 Ga0307405_10025240 3300031731 Bacteria 3408
235 Ga0307406_10001703 3300031901 Bacteria 12091
236 Ga0307416_100034644 3300032002 Bacteria 3845
237 Ga0307414_10221648 3300032004 Bacteria 1553
238 Ga0307411_10169753 3300032005 Bacteria 1643
239 Ga0307415_100516257 3300032126 Bacteria 1048
240 Ga0307510_10004199 3300033180 Bacteria 16928
241 Ga0373948_0011364 3300034817 Bacteria 1572
242 Ga0373950_0064565 3300034818 Bacteria 740
243 Ga0373958_0006875 3300034819 Bacteria 1790
244 Ga0373959_0012794 3300034820 Bacteria 1504
245 Ga0373940_0007442 3300035088 Bacteria 2472
246 Ga0373951_0004132 3300035091 Bacteria 3471
247 Ga0373939_0000013 3300035114 Bacteria 66615
248 Ga0373960_0002051 3300035121 Bacteria 4530
249 Ga0373962_0003793 3300035242 Bacteria 3633
250 Ga0373931_0000279 3300035691 Bacteria 21420
251 Ga0395899_0020729 3300037312 Bacteria 4984
252 Ga0395900_0026296 3300037418 Bacteria 5959
253 Ga0395900_0044046 3300037418 Bacteria 4599
254 Ga0395898_0018126 3300037466 Bacteria 7185
255 Ga0395905_0004622 3300037471 Bacteria 14243
256 Ga0395905_0051356 3300037471 Bacteria 3862
257 Ga0395905_0342714 3300037471 Bacteria 1386
258 Ga0395905_0763529 3300037471 Bacteria 869
259 Ga0395901_0004962 3300038443 Bacteria 13426
260 Ga0395901_0056394 3300038443 Bacteria 4086
261 Ga0436361_0597072 3300039447 Bacteria 40141
262 Ga0436361_1061066 3300039447 Bacteria 20863
263 Ga0436361_1133215 3300039447 Bacteria 77136
264 Ga0439436_0035227 3300041404 Bacteria 1446
265 Ga0451793_1149665 3300041452 Bacteria 4047
266 Ga0451800_1489983 3300041459 Bacteria 2994
267 Ga0451853_2292000 3300041512 Bacteria 3450
268 Ga0439448_0001162 3300042005 Bacteria 6683
269 Ga0439455_0001219 3300042012 Bacteria 4202
270 Ga0439455_0065350 3300042012 Bacteria 970
271 Ga0450889_004808 3300042144 Bacteria 1337
272 Ga0450906_003335 3300042145 Bacteria 3463
273 Ga0439446_0032685 3300042156 Bacteria 1510
274 Ga0439458_0007037 3300042157 Bacteria 2505
275 Ga0450908_004050 3300042184 Bacteria 2832
276 Ga0439434_0001812 3300042435 Bacteria 6209
277 Ga0450918_003697 3300042531 Bacteria 2832
278 Ga0451577_0002043 3300042876 Bacteria 24994
279 Ga0466986_0029172 3300044650 Bacteria 3730
280 Ga0466986_0155467 3300044650 Bacteria 1540
281 Ga0466966_0315104 3300044684 Bacteria 940
282 Ga0451576_0038964 3300045051 Bacteria 5030
283 Ga0466967_0299022 3300045976 Bacteria 1548
284 Ga0495617_011701 3300046452 Bacteria 2992
285 Ga0495617_087172 3300046452 Bacteria 1020
286 Ga0495627_008845 3300046453 Bacteria 3736
287 Ga0495627_077409 3300046453 Bacteria 966
288 Ga0495590_0038659 3300046457 Bacteria 1664
289 Ga0495591_047695 3300046458 Bacteria 1184
290 Ga0495638_0060614 3300046460 Bacteria 2339
291 Ga0495638_0115467 3300046460 Bacteria 1591
292 Ga0495650_0091869 3300046471 Bacteria 1153
293 Ga0495584_0039547 3300046491 Bacteria 2382
294 Ga0495596_0041069 3300046500 Bacteria 1824
295 Ga0495607_0053430 3300046501 Bacteria 2335
296 Ga0495583_0032470 3300046506 Bacteria 2519
297 Ga0495606_0284124 3300046507 Bacteria 903
298 Ga0495610_0022807 3300046512 Bacteria 3414
299 Ga0495616_0057198 3300046513 Bacteria 1923
300 Ga0495620_0117469 3300046515 Bacteria 1050
301 Ga0495632_0001328 3300046519 Bacteria 20818
302 Ga0495632_0009721 3300046519 Bacteria 5766
303 Ga0495637_0004180 3300046520 Bacteria 7497
304 Ga0495637_0009371 3300046520 Bacteria 4776
305 Ga0495643_0075557 3300046522 Bacteria 1762
306 Ga0495644_0032338 3300046523 Bacteria 1976
307 Ga0495648_0062648 3300046524 Bacteria 2200
308 Ga0495654_0171400 3300046530 Bacteria 945
309 Ga0495609_0058445 3300046538 Bacteria 1705
310 Ga0495633_0140550 3300046558 Bacteria 1116
311 Ga0495656_0100312 3300046615 Bacteria 1338
312 Ga0495668_0127408 3300046616 Bacteria 1393
313 Ga0495611_0003752 3300046648 Bacteria 6631
314 Ga0495625_0004404 3300046660 Bacteria 13347
315 Ga0495625_0009966 3300046660 Bacteria 7903
316 Ga0495661_0171346 3300046665 Bacteria 1157
317 Ga0495588_0026189 3300046674 Bacteria 2910
318 Ga0495588_0029314 3300046674 Bacteria 2760
319 Ga0495670_0007858 3300046691 Bacteria 5246
320 Ga0495671_0007407 3300046692 Bacteria 6259
321 Ga0495671_0071394 3300046692 Bacteria 1705
322 Ga0495589_0151179 3300046794 Bacteria 1108
323 Ga0495660_0042585 3300046810 Bacteria 2508
324 Ga0495660_0131352 3300046810 Bacteria 1256
325 Ga0495672_0136021 3300047320 Bacteria 1288
326 Ga0495683_0110513 3300047323 Bacteria 1312
327 Ga0495683_0167926 3300047323 Bacteria 1010
328 Ga0495673_0061779 3300047469 Bacteria 1602
329 Ga0495681_0001333 3300047470 Bacteria 18655
330 Ga0495686_0022391 3300047472 Bacteria 4182
331 Ga0496100_0220935 3300048903 Bacteria 1390
332 Ga0496101_0080109 3300048904 Bacteria 2412
333 Ga0496102_0029462 3300048905 Bacteria 4911
334 Ga0496102_0619714 3300048905 Bacteria 1005
335 Ga0496103_0320433 3300048906 Bacteria 997
336 Ga0496108_0098902 3300048911 Bacteria 2486
337 Ga0496109_0597783 3300048912 Bacteria 1039
338 Ga0496110_0152545 3300048913 Bacteria 2092
339 Ga0496113_0115085 3300048916 Bacteria 2098
340 Ga0496116_0055450 3300048919 Bacteria 2603
341 Ga0496116_0132850 3300048919 Bacteria 1415
342 Ga0496117_0000656 3300048920 Bacteria 55325
343 Ga0496117_0060105 3300048920 Bacteria 2622
344 Ga0496117_0118774 3300048920 Bacteria 1629
345 Ga0496118_0017583 3300048921 Bacteria 6498
346 Ga0496118_0081239 3300048921 Bacteria 2277
347 Ga0496118_0092559 3300048921 Bacteria 2074
348 Ga0496118_0107601 3300048921 Bacteria 1861
349 Ga0496121_0245640 3300048924 Bacteria 1244
350 Ga0496122_0008855 3300048925 Bacteria 10738
351 Ga0496122_0144326 3300048925 Bacteria 1482
352 Ga0496122_0171190 3300048925 Bacteria 1309
353 Ga0496122_0183338 3300048925 Bacteria 1245
354 Ga0496123_0015495 3300048926 Bacteria 6249
355 Ga0496123_0080157 3300048926 Bacteria 1991
356 Ga0496123_0093006 3300048926 Bacteria 1782
357 Ga0496124_0004167 3300048927 Bacteria 17050
358 Ga0496124_0163976 3300048927 Bacteria 1729
359 Ga0496124_0170075 3300048927 Bacteria 1689
360 Ga0496125_0000710 3300048928 Bacteria 55020
361 Ga0496125_0060502 3300048928 Bacteria 3043
362 Ga0496125_0175962 3300048928 Bacteria 1432
363 Ga0496126_0018678 3300048929 Bacteria 6861
364 Ga0501225_0019001 3300049705 Bacteria 1902
365 Ga0501262_000915 3300049759 Bacteria 3338
366 nmdc:mga03683_118508_c1 3300050489 Bacteria 1175
367 nmdc:mga03683_2061_c2 3300050489 Bacteria 5731
368 nmdc:mga03n38_140513_c1 3300050490 Bacteria 1206
369 nmdc:mga00v17_195975_c1 3300050491 Bacteria 1305
370 nmdc:mga00v17_3531_c1 3300050491 Bacteria 8079
371 nmdc:mga00v17_82142_c1 3300050491 Bacteria 2013
372 nmdc:mga0yw44_13387_c1 3300050492 Bacteria 4319
373 nmdc:mga0k408_10023_c1 3300050493 Bacteria 5117
374 nmdc:mga0k408_9177_c1 3300050493 Bacteria 5331
375 nmdc:mga06z11_88915_c1 3300050494 Bacteria 1673
376 nmdc:mga07m45_24537_c1 3300050496 Bacteria 3305
377 nmdc:mga07m45_357_c1 3300050496 Bacteria 18685
378 nmdc:mga07m45_54_c1 3300050496 Bacteria 49018
379 nmdc:mga07m45_55234_c1 3300050496 Bacteria 2245
380 nmdc:mga07m45_7554_c1 3300050496 Bacteria 5558
381 Ga0500610_0005068 3300053079 Bacteria 5349
382 Ga0500610_0017684 3300053079 Bacteria 3429
383 Ga0500610_0041461 3300053079 Bacteria 2380
384 Ga0500643_009683 3300053087 Bacteria 3659
385 Ga0500651_0000165 3300053093 Bacteria 42850
386 Ga0500650_0150313 3300053098 Bacteria 1077
387 Ga0500569_028407 3300053109 Bacteria 1550
388 Ga0500571_002345 3300053110 Bacteria 9366
389 Ga0500593_000485 3300053117 Bacteria 15690
390 Ga0500594_0060328 3300053118 Bacteria 1092
391 Ga0500607_001058 3300053121 Bacteria 25908
392 Ga0500608_007853 3300053122 Bacteria 4440
393 Ga0500628_001635 3300053129 Bacteria 3795
394 Ga0500642_0003068 3300053130 Bacteria 4993
395 Ga0500652_000213 3300053131 Bacteria 22158
396 Ga0500655_005773 3300053133 Bacteria 2227
397 Ga0500658_0000856 3300053134 Bacteria 12495
398 Ga0500577_0019572 3300053142 Bacteria 2198
399 Ga0500604_0001943 3300053151 Bacteria 5744
400 Ga0500622_0000087 3300053156 Bacteria 98385
401 Ga0500627_0003065 3300053158 Bacteria 5094
402 Ga0500634_0024668 3300053161 Bacteria 3271
403 Ga0500634_0031442 3300053161 Bacteria 2894
404 Ga0500634_0044395 3300053161 Bacteria 2406
405 Ga0500636_0140494 3300053177 Bacteria 1337
406 Ga0500570_089814 3300053724 Bacteria 1343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046615 Ga0495656_0100312 Ga0495656_0100312_763_1323 186
2 iso_pu_bacteria 2839138175 2839138952 191
3 3300026041 Ga0207639_11007900 Ga0207639_110079002 192
4 3300037471 Ga0395905_0342714 Ga0395905_0342714_767_1351 193
5 3300003322 rootL2_10089550 rootL2_100895504 196
6 3300009148 Ga0105243_10000314 Ga0105243_100003146 204
7 3300025935 Ga0207709_10000255 Ga0207709_1000025519 204
8 3300045051 Ga0451576_0038964 Ga0451576_0038964_3991_4626 207
9 3300031616 Ga0307508_10000081 Ga0307508_1000008154 209
10 3300003322 rootL2_10063325 rootL2_100633253 210
11 3300003781 Ga0055536_1008104 Ga0055536_10081044 210
12 3300003791 Ga0055530_10005477 Ga0055530_100054776 210
13 3300003792 Ga0055540_1002247 Ga0055540_10022474 210
14 3300003794 Ga0055531_10003251 Ga0055531_100032519 210
15 3300005334 Ga0068869_100409435 Ga0068869_1004094352 210
16 3300005457 Ga0070662_100014013 Ga0070662_1000140134 210
17 3300005564 Ga0070664_100014166 Ga0070664_1000141663 210
18 3300005577 Ga0068857_100128106 Ga0068857_1001281062 210
19 3300005578 Ga0068854_100074464 Ga0068854_1000744642 210
20 3300006353 Ga0075370_10002513 Ga0075370_100025138 210
21 3300009011 Ga0105251_10071289 Ga0105251_100712892 210
22 3300009036 Ga0105244_10001156 Ga0105244_100011569 210
23 3300009148 Ga0105243_10002240 Ga0105243_100022409 210
24 3300009551 Ga0105238_10130815 Ga0105238_101308152 210
25 3300010375 Ga0105239_10763569 Ga0105239_107635692 210
26 3300011119 Ga0105246_10115174 Ga0105246_101151742 210
27 3300013100 Ga0157373_10125411 Ga0157373_101254112 210
28 3300014497 Ga0182008_10003206 Ga0182008_100032064 210
29 3300014969 Ga0157376_10137949 Ga0157376_101379492 210
30 3300015261 Ga0182006_1001535 Ga0182006_10015358 210
31 3300015262 Ga0182007_10001565 Ga0182007_100015656 210
32 3300025292 Ga0209676_1001185 Ga0209676_100118519 210
33 3300025298 Ga0209050_1001732 Ga0209050_10017324 210
34 3300025303 Ga0209051_1000841 Ga0209051_100084122 210
35 3300025304 Ga0209257_1001061 Ga0209257_100106127 210
36 3300025728 Ga0207655_1005421 Ga0207655_10054219 210
37 3300025933 Ga0207706_10032091 Ga0207706_100320913 210
38 3300025935 Ga0207709_10000868 Ga0207709_100008689 210
39 3300025945 Ga0207679_10046851 Ga0207679_100468514 210
40 3300025981 Ga0207640_10068018 Ga0207640_100680183 210
41 3300026041 Ga0207639_10119670 Ga0207639_101196703 210
42 3300026116 Ga0207674_10078613 Ga0207674_100786132 210
43 3300042012 Ga0439455_0065350 Ga0439455_0065350_73_714 210
44 3300048905 Ga0496102_0619714 Ga0496102_0619714_113_769 210
45 3300048906 Ga0496103_0320433 Ga0496103_0320433_241_897 210
46 3300048919 Ga0496116_0055450 Ga0496116_0055450_813_1469 210
47 3300048920 Ga0496117_0118774 Ga0496117_0118774_589_1245 210
48 3300048921 Ga0496118_0017583 Ga0496118_0017583_3846_4502 210
49 3300048924 Ga0496121_0245640 Ga0496121_0245640_161_817 210
50 3300048927 Ga0496124_0163976 Ga0496124_0163976_609_1265 210
51 3300050496 nmdc:mga07m45_55234_c1 nmdc:mga07m45_55234_c1_396_1052 210
52 iso_pu_bacteria 2513020051 2513227898 210
53 iso_pu_bacteria 2643221672 2644397737 210
54 3300003784 Ga0055534_1016796 Ga0055534_10167962 211
55 3300005564 Ga0070664_100063871 Ga0070664_1000638713 211
56 3300025291 Ga0209675_1005972 Ga0209675_10059725 211
57 3300025294 Ga0209025_1024708 Ga0209025_10247084 211
58 3300025945 Ga0207679_10075136 Ga0207679_100751362 211
59 3300042005 Ga0439448_0001162 Ga0439448_0001162_1521_2168 211
60 3300042012 Ga0439455_0001219 Ga0439455_0001219_1204_1851 211
61 3300042157 Ga0439458_0007037 Ga0439458_0007037_757_1404 211
62 3300046674 Ga0495588_0026189 Ga0495588_0026189_1172_1840 211
63 3300048919 Ga0496116_0132850 Ga0496116_0132850_107_793 211
64 3300053087 Ga0500643_009683 Ga0500643_009683_906_1574 211
65 3300053093 Ga0500651_0000165 Ga0500651_0000165_9381_10049 211
66 3300053110 Ga0500571_002345 Ga0500571_002345_5250_5918 211
67 3300053134 Ga0500658_0000856 Ga0500658_0000856_4088_4756 211
68 3300053161 Ga0500634_0044395 Ga0500634_0044395_117_785 211
69 3300053177 Ga0500636_0140494 Ga0500636_0140494_418_1086 211
70 iso_pu_bacteria 2643221658 2644328897 211
71 3300025945 Ga0207679_10108804 Ga0207679_101088043 212
72 3300037312 Ga0395899_0020729 Ga0395899_0020729_1725_2375 212
73 3300037418 Ga0395900_0026296 Ga0395900_0026296_1047_1697 212
74 3300037466 Ga0395898_0018126 Ga0395898_0018126_2273_2923 212
75 3300037471 Ga0395905_0051356 Ga0395905_0051356_2171_2821 212
76 3300038443 Ga0395901_0004962 Ga0395901_0004962_243_893 212
77 3300048904 Ga0496101_0080109 Ga0496101_0080109_198_848 212
78 3300003322 rootL2_10077671 rootL2_100776716 213
79 3300046453 Ga0495627_077409 Ga0495627_077409_166_846 214
80 3300046507 Ga0495606_0284124 Ga0495606_0284124_115_804 214
81 3300048925 Ga0496122_0183338 Ga0496122_0183338_399_1079 214
82 iso_pu_bacteria 2738541307 2738879761 214
83 3300006178 Ga0075367_10115978 Ga0075367_101159782 215
84 3300006195 Ga0075366_10010210 Ga0075366_100102102 215
85 3300006353 Ga0075370_10001132 Ga0075370_1000113210 215
86 3300050493 nmdc:mga0k408_10023_c1 nmdc:mga0k408_10023_c1_1231_1896 215
87 3300050494 nmdc:mga06z11_88915_c1 nmdc:mga06z11_88915_c1_748_1413 215
88 3300050496 nmdc:mga07m45_54_c1 nmdc:mga07m45_54_c1_41996_42661 215
89 3300003316 rootH1_10023862 rootH1_100238622 216
90 3300046660 Ga0495625_0004404 Ga0495625_0004404_5387_6127 216
91 3300005289 Ga0065704_10080737 Ga0065704_100807375 217
92 3300030735 Ga0316178_1056355 Ga0316178_10563554 217
93 3300048925 Ga0496122_0008855 Ga0496122_0008855_9231_9938 217
94 3300048926 Ga0496123_0015495 Ga0496123_0015495_1153_1860 217
95 3300048926 Ga0496123_0080157 Ga0496123_0080157_127_834 217
96 3300048927 Ga0496124_0170075 Ga0496124_0170075_28_735 217
97 3300048928 Ga0496125_0000710 Ga0496125_0000710_22948_23655 217
98 3300048929 Ga0496126_0018678 Ga0496126_0018678_2517_3224 217
99 3300003323 rootH1_10006562 rootH1_100065622 218
100 3300046520 Ga0495637_0004180 Ga0495637_0004180_3574_4266 218
101 3300046674 Ga0495588_0029314 Ga0495588_0029314_1457_2149 218
102 3300046692 Ga0495671_0007407 Ga0495671_0007407_3930_4622 218
103 3300053079 Ga0500610_0005068 Ga0500610_0005068_1231_1923 218
104 3300053079 Ga0500610_0017684 Ga0500610_0017684_1517_2209 218
105 3300053109 Ga0500569_028407 Ga0500569_028407_750_1442 218
106 3300053117 Ga0500593_000485 Ga0500593_000485_13529_14221 218
107 3300053121 Ga0500607_001058 Ga0500607_001058_1793_2485 218
108 3300053158 Ga0500627_0003065 Ga0500627_0003065_3447_4139 218
109 3300053161 Ga0500634_0024668 Ga0500634_0024668_820_1512 218
110 iso_pu_bacteria 2511231031 2511411162 218
111 3300003322 rootL2_10118035 rootL2_101180352 219
112 3300003761 Ga0055535_1000084 Ga0055535_100008427 219
113 3300003762 Ga0055542_1000033 Ga0055542_1000033162 219
114 3300005834 Ga0068851_10009449 Ga0068851_100094492 219
115 3300013307 Ga0157372_10106126 Ga0157372_101061263 219
116 3300015261 Ga0182006_1105221 Ga0182006_11052211 219
117 3300025228 Ga0209672_100500 Ga0209672_1005004 219
118 3300025229 Ga0209147_101992 Ga0209147_1019924 219
119 3300025242 Ga0209258_100089 Ga0209258_100089161 219
120 3300025254 Ga0209148_1000097 Ga0209148_1000097161 219
121 3300025321 Ga0207656_10032448 Ga0207656_100324483 219
122 3300025981 Ga0207640_10429065 Ga0207640_104290652 219
123 3300048921 Ga0496118_0092559 Ga0496118_0092559_476_1225 219
124 3300048925 Ga0496122_0171190 Ga0496122_0171190_160_909 219
125 3300048928 Ga0496125_0060502 Ga0496125_0060502_584_1333 219
126 3300012502 Ga0157347_1012146 Ga0157347_10121462 220
127 3300030744 Ga0316181_1076491 Ga0316181_10764912 220
128 3300031548 Ga0307408_100407891 Ga0307408_1004078912 220
129 3300049705 Ga0501225_0019001 Ga0501225_0019001_1096_1827 220
130 3300006177 Ga0075362_10026555 Ga0075362_100265552 221
131 3300006178 Ga0075367_10106416 Ga0075367_101064162 221
132 3300032004 Ga0307414_10221648 Ga0307414_102216482 221
133 3300048911 Ga0496108_0098902 Ga0496108_0098902_1592_2284 221
134 3300048912 Ga0496109_0597783 Ga0496109_0597783_122_823 221
135 3300048913 Ga0496110_0152545 Ga0496110_0152545_1006_1707 221
136 3300050489 nmdc:mga03683_118508_c1 nmdc:mga03683_118508_c1_51_863 221
137 3300005548 Ga0070665_100592387 Ga0070665_1005923873 222
138 3300006048 Ga0075363_100025734 Ga0075363_1000257341 222
139 3300009036 Ga0105244_10054961 Ga0105244_100549611 222
140 3300013308 Ga0157375_10170915 Ga0157375_101709152 222
141 3300017792 Ga0163161_10002513 Ga0163161_100025132 222
142 3300025728 Ga0207655_1013155 Ga0207655_10131552 222
143 3300028379 Ga0268266_10647263 Ga0268266_106472631 222
144 3300030732 Ga0316176_1059814 Ga0316176_10598142 222
145 3300032005 Ga0307411_10169753 Ga0307411_101697532 222
146 3300033180 Ga0307510_10004199 Ga0307510_1000419912 222
147 3300046452 Ga0495617_011701 Ga0495617_011701_1768_2436 222
148 3300046453 Ga0495627_008845 Ga0495627_008845_299_967 222
149 3300046457 Ga0495590_0038659 Ga0495590_0038659_648_1316 222
150 3300046458 Ga0495591_047695 Ga0495591_047695_346_1014 222
151 3300046460 Ga0495638_0060614 Ga0495638_0060614_1016_1684 222
152 3300046491 Ga0495584_0039547 Ga0495584_0039547_963_1631 222
153 3300046500 Ga0495596_0041069 Ga0495596_0041069_467_1135 222
154 3300046501 Ga0495607_0053430 Ga0495607_0053430_779_1447 222
155 3300046506 Ga0495583_0032470 Ga0495583_0032470_1030_1698 222
156 3300046512 Ga0495610_0022807 Ga0495610_0022807_299_967 222
157 3300046513 Ga0495616_0057198 Ga0495616_0057198_957_1625 222
158 3300046515 Ga0495620_0117469 Ga0495620_0117469_131_799 222
159 3300046519 Ga0495632_0009721 Ga0495632_0009721_2414_3082 222
160 3300046520 Ga0495637_0009371 Ga0495637_0009371_3458_4126 222
161 3300046522 Ga0495643_0075557 Ga0495643_0075557_770_1438 222
162 3300046523 Ga0495644_0032338 Ga0495644_0032338_772_1440 222
163 3300046524 Ga0495648_0062648 Ga0495648_0062648_1362_2030 222
164 3300046530 Ga0495654_0171400 Ga0495654_0171400_107_775 222
165 3300046538 Ga0495609_0058445 Ga0495609_0058445_302_970 222
166 3300046558 Ga0495633_0140550 Ga0495633_0140550_157_825 222
167 3300046616 Ga0495668_0127408 Ga0495668_0127408_576_1244 222
168 3300046648 Ga0495611_0003752 Ga0495611_0003752_3543_4211 222
169 3300046660 Ga0495625_0009966 Ga0495625_0009966_3336_4004 222
170 3300046665 Ga0495661_0171346 Ga0495661_0171346_290_958 222
171 3300046691 Ga0495670_0007858 Ga0495670_0007858_3452_4120 222
172 3300046692 Ga0495671_0071394 Ga0495671_0071394_713_1381 222
173 3300046794 Ga0495589_0151179 Ga0495589_0151179_321_989 222
174 3300046810 Ga0495660_0042585 Ga0495660_0042585_1689_2357 222
175 3300047320 Ga0495672_0136021 Ga0495672_0136021_415_1083 222
176 3300047323 Ga0495683_0110513 Ga0495683_0110513_152_820 222
177 3300047469 Ga0495673_0061779 Ga0495673_0061779_691_1359 222
178 3300047470 Ga0495681_0001333 Ga0495681_0001333_3518_4186 222
179 3300047472 Ga0495686_0022391 Ga0495686_0022391_321_989 222
180 3300031548 Ga0307408_100012560 Ga0307408_1000125606 223
181 3300031731 Ga0307405_10025240 Ga0307405_100252403 223
182 3300031901 Ga0307406_10001703 Ga0307406_100017033 223
183 3300046452 Ga0495617_087172 Ga0495617_087172_232_960 223
184 3300046471 Ga0495650_0091869 Ga0495650_0091869_196_915 223
185 3300047323 Ga0495683_0167926 Ga0495683_0167926_125_889 223
186 3300014497 Ga0182008_10004736 Ga0182008_100047365 224
187 3300015262 Ga0182007_10106193 Ga0182007_101061932 224
188 3300037471 Ga0395905_0004622 Ga0395905_0004622_10917_11603 224
189 3300037471 Ga0395905_0763529 Ga0395905_0763529_82_768 224
190 3300048916 Ga0496113_0115085 Ga0496113_0115085_265_975 224
191 3300025256 Ga0209759_1025689 Ga0209759_10256892 225
192 3300048903 Ga0496100_0220935 Ga0496100_0220935_186_899 225
193 3300006038 Ga0075365_10001357 Ga0075365_100013574 226
194 3300006051 Ga0075364_10009520 Ga0075364_100095204 226
195 3300006058 Ga0075432_10012826 Ga0075432_100128263 226
196 3300006195 Ga0075366_10014967 Ga0075366_100149672 226
197 3300021361 Ga0213872_10000043 Ga0213872_1000004313 226
198 3300031250 Ga0265331_10006389 Ga0265331_100063893 226
199 3300031251 Ga0265327_10000776 Ga0265327_100007763 226
200 3300031649 Ga0307514_10000348 Ga0307514_1000034815 226
201 3300039447 Ga0436361_1133215 Ga0436361_1133215_66179_66868 226
202 3300005455 Ga0070663_100003407 Ga0070663_1000034074 227
203 3300026067 Ga0207678_10054214 Ga0207678_100542145 227
204 3300027907 Ga0207428_10058738 Ga0207428_100587382 227
205 3300028794 Ga0307515_10137216 Ga0307515_101372162 227
206 3300044684 Ga0466966_0315104 Ga0466966_0315104_235_930 227
207 3300048920 Ga0496117_0000656 Ga0496117_0000656_25778_26485 227
208 3300048921 Ga0496118_0107601 Ga0496118_0107601_253_960 227
209 3300048925 Ga0496122_0144326 Ga0496122_0144326_272_979 227
210 3300048926 Ga0496123_0093006 Ga0496123_0093006_672_1379 227
211 3300050489 nmdc:mga03683_2061_c2 nmdc:mga03683_2061_c2_2770_3522 227
212 3300050490 nmdc:mga03n38_140513_c1 nmdc:mga03n38_140513_c1_141_893 227
213 3300050491 nmdc:mga00v17_3531_c1 nmdc:mga00v17_3531_c1_2494_3246 227
214 3300050492 nmdc:mga0yw44_13387_c1 nmdc:mga0yw44_13387_c1_2370_3122 227
215 3300050493 nmdc:mga0k408_9177_c1 nmdc:mga0k408_9177_c1_2774_3526 227
216 iso_pu_bacteria 2643221592 2643970841 227
217 iso_pu_bacteria 2643221625 2644138886 227
218 iso_pu_bacteria 2643221648 2644273883 227
219 iso_pu_bacteria 2928058823 2928063043 227
220 3300005617 Ga0068859_100292493 Ga0068859_1002924931 228
221 3300005842 Ga0068858_100346603 Ga0068858_1003466032 228
222 3300005843 Ga0068860_100382663 Ga0068860_1003826632 228
223 3300006058 Ga0075432_10021241 Ga0075432_100212412 228
224 3300006353 Ga0075370_10065901 Ga0075370_100659012 228
225 3300006931 Ga0097620_100292495 Ga0097620_1002924953 228
226 3300010375 Ga0105239_11275587 Ga0105239_112755872 228
227 3300014968 Ga0157379_10024111 Ga0157379_100241112 228
228 3300017792 Ga0163161_10098137 Ga0163161_100981372 228
229 3300027907 Ga0207428_10216843 Ga0207428_102168432 228
230 3300028794 Ga0307515_10000047 Ga0307515_1000004797 228
231 3300034817 Ga0373948_0011364 Ga0373948_0011364_272_967 228
232 3300034818 Ga0373950_0064565 Ga0373950_0064565_23_718 228
233 3300034819 Ga0373958_0006875 Ga0373958_0006875_371_1066 228
234 3300034820 Ga0373959_0012794 Ga0373959_0012794_467_1162 228
235 3300035088 Ga0373940_0007442 Ga0373940_0007442_535_1230 228
236 3300035091 Ga0373951_0004132 Ga0373951_0004132_2172_2867 228
237 3300035114 Ga0373939_0000013 Ga0373939_0000013_12468_13163 228
238 3300035121 Ga0373960_0002051 Ga0373960_0002051_1335_2030 228
239 3300035242 Ga0373962_0003793 Ga0373962_0003793_2442_3137 228
240 3300035691 Ga0373931_0000279 Ga0373931_0000279_10385_11080 228
241 3300041452 Ga0451793_1149665 Ga0451793_1149665_2439_3137 228
242 3300041459 Ga0451800_1489983 Ga0451800_1489983_573_1271 228
243 3300041512 Ga0451853_2292000 Ga0451853_2292000_934_1632 228
244 3300042876 Ga0451577_0002043 Ga0451577_0002043_1590_2288 228
245 3300046460 Ga0495638_0115467 Ga0495638_0115467_378_1076 228
246 3300046519 Ga0495632_0001328 Ga0495632_0001328_16175_16873 228
247 3300053098 Ga0500650_0150313 Ga0500650_0150313_63_761 228
248 3300053118 Ga0500594_0060328 Ga0500594_0060328_278_976 228
249 3300053129 Ga0500628_001635 Ga0500628_001635_2524_3222 228
250 3300053130 Ga0500642_0003068 Ga0500642_0003068_541_1239 228
251 3300053131 Ga0500652_000213 Ga0500652_000213_7447_8145 228
252 3300053133 Ga0500655_005773 Ga0500655_005773_496_1194 228
253 3300053142 Ga0500577_0019572 Ga0500577_0019572_1371_2069 228
254 3300053151 Ga0500604_0001943 Ga0500604_0001943_2640_3338 228
255 3300053156 Ga0500622_0000087 Ga0500622_0000087_29124_29822 228
256 3300053724 Ga0500570_089814 Ga0500570_089814_442_1140 228
257 3300003187 JGI25151J46595_10005576 JGI25151J46595_100055765 229
258 3300003759 Ga0055525_1000001 Ga0055525_1000001896 229
259 3300003781 Ga0055536_1002635 Ga0055536_10026353 229
260 3300003792 Ga0055540_1001631 Ga0055540_10016318 229
261 3300005327 Ga0070658_10067074 Ga0070658_100670744 229
262 3300021361 Ga0213872_10000194 Ga0213872_100001943 229
263 3300025230 Ga0209563_100007 Ga0209563_100007203 229
264 3300025253 Ga0209677_104467 Ga0209677_1044674 229
265 3300025292 Ga0209676_1000896 Ga0209676_100089625 229
266 3300025294 Ga0209025_1001001 Ga0209025_10010019 229
267 3300025303 Ga0209051_1000483 Ga0209051_100048339 229
268 3300025304 Ga0209257_1005042 Ga0209257_10050427 229
269 3300028786 Ga0307517_10101084 Ga0307517_101010842 229
270 3300028794 Ga0307515_10014117 Ga0307515_100141171 229
271 3300031730 Ga0307516_10003774 Ga0307516_100037744 229
272 3300031731 Ga0307405_10000862 Ga0307405_100008629 229
273 3300037418 Ga0395900_0044046 Ga0395900_0044046_3518_4219 229
274 3300038443 Ga0395901_0056394 Ga0395901_0056394_2449_3150 229
275 3300039447 Ga0436361_0597072 Ga0436361_0597072_33617_34318 229
276 3300048905 Ga0496102_0029462 Ga0496102_0029462_3474_4175 229
277 3300048927 Ga0496124_0004167 Ga0496124_0004167_11283_11984 229
278 3300048928 Ga0496125_0175962 Ga0496125_0175962_417_1118 229
279 iso_pu_bacteria 2643221683 2644469049 229
280 iso_pu_bacteria 2904541872 2904544029 229
281 iso_pu_bacteria 2929160207 2929162412 229
282 3300002738 JGI25154J39366_1000728 JGI25154J39366_100072813 230
283 3300002773 JGI25152J39213_1004260 JGI25152J39213_10042603 230
284 3300002774 JGI25150J39212_1002064 JGI25150J39212_10020642 230
285 3300002987 JGI25159J45721_1003932 JGI25159J45721_10039323 230
286 3300003187 JGI25151J46595_10009579 JGI25151J46595_100095793 230
287 3300003215 JGI25153J46596_10009355 JGI25153J46596_100093553 230
288 3300003354 JGI25160J50197_1005823 JGI25160J50197_10058233 230
289 3300003374 JGI25161J50226_1002265 JGI25161J50226_10022653 230
290 3300003771 Ga0055526_1008564 Ga0055526_10085643 230
291 3300003773 Ga0055537_1001934 Ga0055537_10019344 230
292 3300003775 Ga0055524_1006474 Ga0055524_10064743 230
293 3300003784 Ga0055534_1002126 Ga0055534_10021264 230
294 3300003790 Ga0055528_1003827 Ga0055528_10038274 230
295 3300003794 Ga0055531_10023811 Ga0055531_100238112 230
296 3300004625 Ga0055543_1004070 Ga0055543_10040702 230
297 3300005262 Ga0065165_1005230 Ga0065165_10052304 230
298 3300006186 Ga0075369_10034228 Ga0075369_100342282 230
299 3300021361 Ga0213872_10021315 Ga0213872_100213152 230
300 3300025208 Ga0209436_105643 Ga0209436_1056433 230
301 3300025233 Ga0209437_103462 Ga0209437_1034622 230
302 3300025245 Ga0207425_1000355 Ga0207425_10003558 230
303 3300025246 Ga0209646_1000106 Ga0209646_100010657 230
304 3300025258 Ga0209129_1000033 Ga0209129_1000033174 230
305 3300025263 Ga0209565_1000586 Ga0209565_10005865 230
306 3300025273 Ga0209673_1001345 Ga0209673_10013455 230
307 3300025284 Ga0209130_1000736 Ga0209130_100073618 230
308 3300025291 Ga0209675_1000539 Ga0209675_10005398 230
309 3300025292 Ga0209676_1014410 Ga0209676_10144102 230
310 3300025294 Ga0209025_1004122 Ga0209025_10041226 230
311 3300025295 Ga0209564_1000151 Ga0209564_100015122 230
312 3300025297 Ga0209758_1000027 Ga0209758_1000027174 230
313 3300025299 Ga0209256_1000161 Ga0209256_100016160 230
314 3300025302 Ga0207426_1000027 Ga0207426_1000027134 230
315 3300025303 Ga0209051_1006592 Ga0209051_10065925 230
316 3300025304 Ga0209257_1004586 Ga0209257_10045865 230
317 3300039447 Ga0436361_1061066 Ga0436361_1061066_15900_16619 230
318 iso_pu_bacteria 2599185214 2599624228 230
319 iso_pu_bacteria 2599185226 2599672240 230
320 iso_pu_bacteria 2599185227 2599681676 230
321 iso_pu_bacteria 2599185229 2599693690 230
322 iso_pu_bacteria 2945909444 2945913267 230
323 iso_pu_bacteria 2945984333 2945984508 230
324 3300005366 Ga0070659_100001403 Ga0070659_1000014036 231
325 3300015261 Ga0182006_1004401 Ga0182006_10044013 231
326 3300025230 Ga0209563_104864 Ga0209563_1048642 231
327 3300025932 Ga0207690_10001075 Ga0207690_1000107516 231
328 3300025939 Ga0207665_10222720 Ga0207665_102227201 231
329 3300032002 Ga0307416_100034644 Ga0307416_1000346442 231
330 3300044650 Ga0466986_0029172 Ga0466986_0029172_1088_1783 231
331 3300044650 Ga0466986_0155467 Ga0466986_0155467_397_1092 231
332 3300045976 Ga0466967_0299022 Ga0466967_0299022_715_1410 231
333 3300048920 Ga0496117_0060105 Ga0496117_0060105_777_1490 231
334 3300048921 Ga0496118_0081239 Ga0496118_0081239_1524_2237 231
335 3300050491 nmdc:mga00v17_195975_c1 nmdc:mga00v17_195975_c1_543_1265 231
336 3300053161 Ga0500634_0031442 Ga0500634_0031442_839_1537 231
337 iso_pu_bacteria 2842677519 2842677898 231
338 3300006353 Ga0075370_10010790 Ga0075370_100107902 232
339 3300013100 Ga0157373_10001556 Ga0157373_1000155610 232
340 3300014497 Ga0182008_10010782 Ga0182008_100107823 232
341 3300028380 Ga0268265_10005022 Ga0268265_100050226 232
342 3300031649 Ga0307514_10014552 Ga0307514_100145522 232
343 3300046810 Ga0495660_0131352 Ga0495660_0131352_354_1094 232
344 3300050496 nmdc:mga07m45_24537_c1 nmdc:mga07m45_24537_c1_2024_2752 232
345 3300053079 Ga0500610_0041461 Ga0500610_0041461_1292_2029 232
346 iso_pu_bacteria 2929520902 2929525508 232
347 iso_pu_bacteria 2945972063 2945972953 232
348 3300003773 Ga0055537_1000304 Ga0055537_100030423 233
349 3300003784 Ga0055534_1000289 Ga0055534_100028923 233
350 3300003790 Ga0055528_1001591 Ga0055528_10015916 233
351 3300003792 Ga0055540_1003189 Ga0055540_10031895 233
352 3300006353 Ga0075370_10002672 Ga0075370_100026723 233
353 3300006948 Ga0099826_10006070 Ga0099826_100060702 233
354 3300025263 Ga0209565_1000120 Ga0209565_100012024 233
355 3300025273 Ga0209673_1000099 Ga0209673_1000099175 233
356 3300025273 Ga0209673_1002340 Ga0209673_100234013 233
357 3300025291 Ga0209675_1000054 Ga0209675_1000054175 233
358 3300025295 Ga0209564_1029920 Ga0209564_10299202 233
359 3300025303 Ga0209051_1000762 Ga0209051_100076223 233
360 3300026089 Ga0207648_10167212 Ga0207648_101672122 233
361 3300032126 Ga0307415_100516257 Ga0307415_1005162571 233
362 3300041404 Ga0439436_0035227 Ga0439436_0035227_555_1355 233
363 3300042144 Ga0450889_004808 Ga0450889_004808_487_1287 233
364 3300042145 Ga0450906_003335 Ga0450906_003335_2246_3046 233
365 3300042156 Ga0439446_0032685 Ga0439446_0032685_323_1123 233
366 3300042184 Ga0450908_004050 Ga0450908_004050_1234_2034 233
367 3300042435 Ga0439434_0001812 Ga0439434_0001812_3408_4208 233
368 3300042531 Ga0450918_003697 Ga0450918_003697_744_1544 233
369 3300049759 Ga0501262_000915 Ga0501262_000915_424_1167 233
370 3300050491 nmdc:mga00v17_82142_c1 nmdc:mga00v17_82142_c1_1033_1767 233
371 3300050496 nmdc:mga07m45_357_c1 nmdc:mga07m45_357_c1_7492_8226 233
372 iso_pu_bacteria 2643221628 2644162701 233
373 iso_pu_bacteria 2721755523 2722883796 233
374 iso_pu_bacteria 2904449895 2904450173 233
375 iso_pu_bacteria 2904456579 2904457004 233
376 iso_pu_bacteria 2945945610 2945948833 233
377 3300001979 JGI24740J21852_10002176 JGI24740J21852_100021767 234
378 3300003187 JGI25151J46595_10002505 JGI25151J46595_100025059 234
379 3300003187 JGI25151J46595_10032976 JGI25151J46595_100329762 234
380 3300003215 JGI25153J46596_10027324 JGI25153J46596_100273242 234
381 3300003354 JGI25160J50197_1047861 JGI25160J50197_10478612 234
382 3300003374 JGI25161J50226_1008394 JGI25161J50226_10083942 234
383 3300003578 Ga0006562J51391_1041496 Ga0006562J51391_10414961 234
384 3300003578 Ga0006562J51391_1041498 Ga0006562J51391_10414982 234
385 3300003752 Ga0055539_1005505 Ga0055539_10055052 234
386 3300003756 Ga0055533_1001092 Ga0055533_10010922 234
387 3300003762 Ga0055542_1000998 Ga0055542_100099818 234
388 3300003771 Ga0055526_1014019 Ga0055526_10140193 234
389 3300003775 Ga0055524_1016802 Ga0055524_10168023 234
390 3300003781 Ga0055536_1015572 Ga0055536_10155724 234
391 3300003784 Ga0055534_1009187 Ga0055534_10091872 234
392 3300003790 Ga0055528_1008354 Ga0055528_10083545 234
393 3300003791 Ga0055530_10002739 Ga0055530_100027394 234
394 3300003792 Ga0055540_1016460 Ga0055540_10164603 234
395 3300003794 Ga0055531_10022613 Ga0055531_100226133 234
396 3300003841 Ga0055541_1001160 Ga0055541_10011604 234
397 3300004625 Ga0055543_1004536 Ga0055543_10045363 234
398 3300006195 Ga0075366_10134041 Ga0075366_101340412 234
399 3300006353 Ga0075370_10005589 Ga0075370_100055894 234
400 3300006353 Ga0075370_10095699 Ga0075370_100956992 234
401 3300006946 Ga0079104_1000051 Ga0079104_1000051107 234
402 3300009148 Ga0105243_10021679 Ga0105243_100216795 234
403 3300025224 Ga0209784_100463 Ga0209784_10046314 234
404 3300025225 Ga0209566_100238 Ga0209566_10023821 234
405 3300025226 Ga0209674_100118 Ga0209674_10011878 234
406 3300025245 Ga0207425_1004767 Ga0207425_10047673 234
407 3300025246 Ga0209646_1000203 Ga0209646_100020366 234
408 3300025250 Ga0209026_1010157 Ga0209026_10101572 234
409 3300025253 Ga0209677_103775 Ga0209677_1037754 234
410 3300025254 Ga0209148_1000021 Ga0209148_100002156 234
411 3300025256 Ga0209759_1003451 Ga0209759_10034514 234
412 3300025258 Ga0209129_1002441 Ga0209129_10024419 234
413 3300025258 Ga0209129_1007636 Ga0209129_10076364 234
414 3300025273 Ga0209673_1000185 Ga0209673_1000185116 234
415 3300025273 Ga0209673_1009259 Ga0209673_10092593 234
416 3300025284 Ga0209130_1001586 Ga0209130_100158610 234
417 3300025291 Ga0209675_1000296 Ga0209675_100029641 234
418 3300025291 Ga0209675_1030979 Ga0209675_10309792 234
419 3300025292 Ga0209676_1000179 Ga0209676_1000179101 234
420 3300025294 Ga0209025_1000743 Ga0209025_10007439 234
421 3300025294 Ga0209025_1016063 Ga0209025_10160632 234
422 3300025294 Ga0209025_1058521 Ga0209025_10585212 234
423 3300025295 Ga0209564_1000246 Ga0209564_100024683 234
424 3300025297 Ga0209758_1033408 Ga0209758_10334081 234
425 3300025298 Ga0209050_1000172 Ga0209050_100017250 234
426 3300025299 Ga0209256_1000069 Ga0209256_1000069138 234
427 3300025302 Ga0207426_1000115 Ga0207426_100011548 234
428 3300025303 Ga0209051_1000046 Ga0209051_100004650 234
429 3300025304 Ga0209257_1000281 Ga0209257_100028157 234
430 3300025935 Ga0207709_10247269 Ga0207709_102472692 234
431 3300027111 Ga0209281_1000005 Ga0209281_10000051006 234
432 3300050496 nmdc:mga07m45_7554_c1 nmdc:mga07m45_7554_c1_4193_4927 234
433 3300053122 Ga0500608_007853 Ga0500608_007853_1875_2615 234
434 iso_pu_bacteria 2818991446 2819596596 234
435 iso_pu_bacteria 2831265667 2831267934 234
436 iso_pu_bacteria 2838054893 2838060124 234
437 iso_pu_bacteria 2899924645 2899931314 234
438 iso_pu_bacteria 2928037797 2928037913 234
439 iso_pu_bacteria 2928044640 2928046481 234
440 iso_pu_bacteria 2928051484 2928054176 234
441 iso_pu_bacteria 2928064002 2928065929 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

34

225

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfg-assembly1.cif.gz_A cytosolic disulfide reductase dsbm from pseudomonas aeruginosa 0.9828 3 212
5hfi-assembly1.cif.gz_A cytosolic disulfide reductase dsbm from pseudomonas aeruginosa with gsh 0.9764 3 213
5hfi-assembly1.cif.gz_A cytosolic disulfide reductase dsbm from pseudomonas aeruginosa with gsh 0.9669 3 213
5hfg-assembly1.cif.gz_A cytosolic disulfide reductase dsbm from pseudomonas aeruginosa 0.9639 3 212
7aoo-assembly1.cif.gz_C plasmoredoxin, a redox-active protein unique for malaria parasites 0.8471 2 35
ID Description Score Start End Superfamily
5hfiA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9764 3 213 3.40.30.10
5hfiA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9669 3 213 3.40.30.10
af_Q22312_99_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8615 90 188 3.40.30.10
2in3A02 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;putative protein disulfide isomerase domain 0.8517 47 172 1.10.472.60
af_Q96J42_187_311_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8449 2 35 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4V6KQW1-F1-model_v4 DSBA-like thioredoxin domain 0.997 3 113
AF-A0A329AVM2-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9967 2 212 GO:0016491
AF-A0A290WRT9-F1-model_v4 Protein-disulfide isomerase 0.9964 1 208 GO:0016491
GO:0016853
AF-A0A2X4XY41-F1-model_v4 DSBA-like thioredoxin domain 0.9956 3 112
AF-A0A127PFL1-F1-model_v4 DSBA-like thioredoxin domain protein 0.9955 4 179

Feature Viewer

pLDDT pTM Quality
92.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map