F444718

General Info

Members Datasets Scaffolds Average Seq Length
441 227 435 327

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0001452|Ga0466972_0001452_6791_7837
Length 348
Sequence VSGRPQAWNLQSLYIQSKNMEYRRLGRSGLQLSALSFGSWVTFHEQVEDKTADELMGIAYEKGINFFDNAETYANGQSELMMGRVLKKKNWDRTSYIVSSKAYFGSRDKPVPNQTGLSRKHLVEACHEALKRLQLDYLDLYFCHRPDPNVPIEEVVWTMHTLIQQGKALYWGTSQWSAAEIMEAHKVAQQYCLIGPVMEQPQYNMFERFKMEQDYLPVFRSVGLGTTIWSPLAAGFLSGKYLDGIPKGSRFSMPEYGWLVKRWLQEDRIEKTKKLASLASRLGVSLSALAIAWTIRDAETTTTAILGATSREQLLENLKALEVLPLLTSSVLNEIEGILQNKPVLDLQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
138 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
139 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
140 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
192 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
193 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
194 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
197 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
198 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
203 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
210 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
225 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 0.45
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_383773 2162886007 Bacteria 2605
2 JGI24739J22299_10000037 3300001989 Bacteria 36627
3 rootH2_10064125 3300003320 Bacteria 3640
4 rootL2_10021159 3300003322 Bacteria 4372
5 rootL2_10177549 3300003322 Bacteria 5367
6 Ga0055526_1022264 3300003771 Bacteria 2163
7 Ga0065714_10119221 3300005288 Unclassified 1369
8 Ga0065704_10078432 3300005289 Bacteria 4431
9 Ga0065704_10078757 3300005289 Bacteria 4343
10 Ga0065704_10179346 3300005289 Bacteria 1246
11 Ga0065712_10000456 3300005290 Bacteria 12444
12 Ga0065712_10148564 3300005290 Bacteria 1388
13 Ga0065715_10022834 3300005293 Bacteria 2828
14 Ga0065707_10099090 3300005295 Unclassified 3029
15 Ga0070658_10038064 3300005327 Unclassified 3879
16 Ga0070658_10048969 3300005327 Bacteria 3422
17 Ga0070658_10156856 3300005327 Bacteria 1908
18 Ga0070676_10093906 3300005328 Unclassified 1842
19 Ga0070683_100095800 3300005329 Bacteria 2791
20 Ga0070670_100021580 3300005331 Bacteria 5538
21 Ga0070670_100026560 3300005331 Bacteria 4981
22 Ga0070670_100257256 3300005331 Unclassified 1521
23 Ga0070670_100309571 3300005331 Unclassified 1382
24 Ga0070677_10075316 3300005333 Unclassified 1430
25 Ga0068869_100015903 3300005334 Bacteria 5061
26 Ga0070666_10009910 3300005335 Bacteria 5947
27 Ga0070680_100005499 3300005336 Bacteria 9590
28 Ga0070682_100000008 3300005337 Bacteria 322125
29 Ga0070660_100004446 3300005339 Bacteria 9688
30 Ga0070660_100080188 3300005339 Bacteria 2561
31 Ga0070660_100194563 3300005339 Bacteria 1643
32 Ga0070687_100066706 3300005343 Unclassified 1918
33 Ga0070692_10142732 3300005345 Unclassified 1357
34 Ga0070675_100172779 3300005354 Unclassified 1864
35 Ga0070659_100015043 3300005366 Bacteria 5788
36 Ga0070659_100182452 3300005366 Bacteria 1723
37 Ga0070659_100241767 3300005366 Bacteria 1494
38 Ga0070667_100077806 3300005367 Bacteria 2833
39 Ga0070667_100114817 3300005367 Bacteria 2338
40 Ga0070667_100203599 3300005367 Bacteria 1757
41 Ga0070713_100125573 3300005436 Bacteria 2256
42 Ga0070663_100091913 3300005455 Unclassified 2249
43 Ga0070678_100268229 3300005456 Unclassified 1438
44 Ga0070681_10198423 3300005458 Unclassified 1925
45 Ga0068867_100169097 3300005459 Bacteria 1730
46 Ga0068867_100227159 3300005459 Bacteria 1507
47 Ga0070685_10023534 3300005466 Unclassified 3373
48 Ga0070707_100225167 3300005468 Unclassified 1826
49 Ga0070698_100000061 3300005471 Bacteria 78637
50 Ga0070698_100005416 3300005471 Bacteria 13947
51 Ga0070699_100205753 3300005518 Bacteria 1751
52 Ga0070679_100007464 3300005530 Bacteria 10219
53 Ga0070679_100529583 3300005530 Unclassified 1122
54 Ga0070684_100003772 3300005535 Bacteria 11441
55 Ga0070684_100064197 3300005535 Bacteria 3220
56 Ga0068853_100008344 3300005539 Bacteria 8314
57 Ga0068853_100023210 3300005539 Bacteria 5190
58 Ga0068853_100243734 3300005539 Bacteria 1648
59 Ga0070672_100007450 3300005543 Bacteria 7427
60 Ga0070672_100065633 3300005543 Bacteria 2872
61 Ga0070665_100000014 3300005548 Bacteria 484881
62 Ga0070665_100001020 3300005548 Bacteria 35168
63 Ga0068855_100001486 3300005563 Bacteria 29324
64 Ga0068855_100005895 3300005563 Bacteria 14938
65 Ga0068855_100020085 3300005563 Bacteria 8022
66 Ga0068855_100052203 3300005563 Bacteria 4814
67 Ga0070664_100294903 3300005564 Unclassified 1464
68 Ga0068857_100025326 3300005577 Bacteria 5224
69 Ga0068857_100085412 3300005577 Bacteria 2821
70 Ga0068857_100457543 3300005577 Unclassified 1194
71 Ga0068854_100020780 3300005578 Bacteria 4448
72 Ga0068854_100093809 3300005578 Unclassified 2238
73 Ga0068854_100102842 3300005578 Unclassified 2144
74 Ga0068856_100011049 3300005614 Bacteria 8769
75 Ga0068856_100033883 3300005614 Bacteria 5001
76 Ga0068856_100124752 3300005614 Bacteria 2578
77 Ga0068852_100000857 3300005616 Bacteria 20216
78 Ga0068852_100001522 3300005616 Bacteria 15698
79 Ga0068852_100069468 3300005616 Bacteria 3088
80 Ga0068852_100075700 3300005616 Bacteria 2970
81 Ga0068852_100080221 3300005616 Bacteria 2893
82 Ga0068852_100139474 3300005616 Archaea 2242
83 Ga0068852_100351340 3300005616 Unclassified 1440
84 Ga0068852_100539751 3300005616 Bacteria 1165
85 Ga0068859_100000903 3300005617 Bacteria 30294
86 Ga0068859_100033494 3300005617 Bacteria 5159
87 Ga0068864_100017261 3300005618 Bacteria 6018
88 Ga0068864_100081379 3300005618 Bacteria 2839
89 Ga0068864_100223121 3300005618 Unclassified 1740
90 Ga0068864_100269040 3300005618 Unclassified 1587
91 Ga0068864_100294737 3300005618 Unclassified 1517
92 Ga0068861_100002412 3300005719 Bacteria 12173
93 Ga0068861_100030341 3300005719 Bacteria 3961
94 Ga0068861_100401666 3300005719 Bacteria 1216
95 Ga0068851_10019318 3300005834 Bacteria 3292
96 Ga0068870_10011862 3300005840 Unclassified 4055
97 Ga0068863_100091873 3300005841 Unclassified 2879
98 Ga0068860_100000024 3300005843 Bacteria 271902
99 Ga0068860_100001067 3300005843 Bacteria 30243
100 Ga0068860_100004752 3300005843 Bacteria 13841
101 Ga0068860_100165855 3300005843 Bacteria 2132
102 Ga0068862_100029425 3300005844 Bacteria 4629
103 Ga0068862_100050218 3300005844 Unclassified 3564
104 Ga0081455_10071035 3300005937 Bacteria 2887
105 Ga0075366_10057308 3300006195 Bacteria 2315
106 Ga0097621_100000109 3300006237 Bacteria 46477
107 Ga0097621_100368227 3300006237 Bacteria 1281
108 Ga0068871_100001161 3300006358 Bacteria 17698
109 Ga0068871_100096061 3300006358 Bacteria 2475
110 Ga0075428_100024703 3300006844 Bacteria 6650
111 Ga0075428_100034756 3300006844 Bacteria 5559
112 Ga0075428_100188799 3300006844 Bacteria 2229
113 Ga0075429_100001773 3300006880 Bacteria 17869
114 Ga0075429_100190116 3300006880 Bacteria 1799
115 Ga0068865_100143262 3300006881 Bacteria 1804
116 Ga0097620_100000903 3300006931 Bacteria 30294
117 Ga0097620_100033488 3300006931 Bacteria 5159
118 Ga0105240_10000011 3300009093 Bacteria 523646
119 Ga0105240_10000106 3300009093 Bacteria 171825
120 Ga0105240_10000895 3300009093 Bacteria 53295
121 Ga0105240_10002358 3300009093 Bacteria 30449
122 Ga0105240_10002692 3300009093 Bacteria 28281
123 Ga0105240_10004897 3300009093 Bacteria 20156
124 Ga0105240_10027974 3300009093 Bacteria 7373
125 Ga0105240_10115120 3300009093 Bacteria 3247
126 Ga0105240_10188153 3300009093 Bacteria 2430
127 Ga0105240_10271888 3300009093 Bacteria 1950
128 Ga0111539_10373625 3300009094 Bacteria 1660
129 Ga0114129_10015806 3300009147 Bacteria 10731
130 Ga0105241_10000085 3300009174 Bacteria 69963
131 Ga0105241_10062016 3300009174 Bacteria 2881
132 Ga0105242_10050235 3300009176 Unclassified 3395
133 Ga0105248_10024178 3300009177 Bacteria 6752
134 Ga0105237_10000453 3300009545 Bacteria 58200
135 Ga0105237_10002469 3300009545 Bacteria 22938
136 Ga0105237_10007092 3300009545 Bacteria 12318
137 Ga0105237_10013660 3300009545 Bacteria 8504
138 Ga0105237_10014675 3300009545 Bacteria 8181
139 Ga0105237_10048114 3300009545 Bacteria 4286
140 Ga0105237_10050819 3300009545 Bacteria 4165
141 Ga0105237_10096739 3300009545 Bacteria 2943
142 Ga0105237_10154384 3300009545 Bacteria 2292
143 Ga0105238_10001678 3300009551 Bacteria 22261
144 Ga0105238_10249879 3300009551 Bacteria 1751
145 Ga0105249_10005595 3300009553 Bacteria 10867
146 Ga0105249_10042200 3300009553 Unclassified 4148
147 Ga0105249_10076842 3300009553 Bacteria 3096
148 Ga0105249_10414185 3300009553 Bacteria 1380
149 Ga0105239_10000384 3300010375 Bacteria 64479
150 Ga0105239_10001747 3300010375 Bacteria 28630
151 Ga0105239_10003350 3300010375 Bacteria 19690
152 Ga0105239_10003545 3300010375 Bacteria 19087
153 Ga0105239_10040627 3300010375 Bacteria 5097
154 Ga0105246_10329128 3300011119 Unclassified 1244
155 Ga0157371_10007807 3300013102 Bacteria 8596
156 Ga0157371_10053802 3300013102 Bacteria 2859
157 Ga0157371_10160570 3300013102 Bacteria 1605
158 Ga0157371_10224545 3300013102 Unclassified 1349
159 Ga0157370_10001463 3300013104 Bacteria 29196
160 Ga0157370_10001583 3300013104 Bacteria 28157
161 Ga0157370_10002878 3300013104 Bacteria 20507
162 Ga0157370_10062579 3300013104 Bacteria 3528
163 Ga0157369_10005621 3300013105 Bacteria 14565
164 Ga0157369_10048726 3300013105 Bacteria 4596
165 Ga0157369_10075767 3300013105 Bacteria 3606
166 Ga0157369_10131033 3300013105 Bacteria 2657
167 Ga0157369_10551506 3300013105 Bacteria 1191
168 Ga0157374_10193320 3300013296 Bacteria 1990
169 Ga0157378_10243305 3300013297 Bacteria 1720
170 Ga0157378_10457634 3300013297 Bacteria 1267
171 Ga0163162_10000446 3300013306 Bacteria 38191
172 Ga0163162_10000579 3300013306 Bacteria 33893
173 Ga0163162_10000687 3300013306 Bacteria 31377
174 Ga0163162_10006859 3300013306 Bacteria 11048
175 Ga0157372_10006780 3300013307 Bacteria 12180
176 Ga0157372_10009682 3300013307 Bacteria 10242
177 Ga0157372_10013773 3300013307 Bacteria 8641
178 Ga0157372_10033035 3300013307 Bacteria 5680
179 Ga0157372_10043256 3300013307 Unclassified 4986
180 Ga0157372_10087316 3300013307 Bacteria 3539
181 Ga0157372_10088050 3300013307 Bacteria 3525
182 Ga0157372_10177252 3300013307 Bacteria 2467
183 Ga0157372_10243077 3300013307 Bacteria 2089
184 Ga0157372_10269731 3300013307 Bacteria 1977
185 Ga0157372_10468451 3300013307 Unclassified 1468
186 Ga0157375_10000212 3300013308 Bacteria 54441
187 Ga0163163_10000401 3300014325 Bacteria 40925
188 Ga0157380_10002108 3300014326 Bacteria 13337
189 Ga0157380_10030600 3300014326 Bacteria 4125
190 Ga0157380_10198172 3300014326 Bacteria 1779
191 Ga0157380_10214106 3300014326 Unclassified 1719
192 Ga0157380_10312970 3300014326 Bacteria 1452
193 Ga0157379_10005159 3300014968 Bacteria 11216
194 Ga0157379_10263216 3300014968 Bacteria 1567
195 Ga0157379_10478260 3300014968 Unclassified 1152
196 Ga0157376_10005274 3300014969 Bacteria 9028
197 Ga0157376_10375495 3300014969 Bacteria 1368
198 Ga0157376_10396622 3300014969 Bacteria 1333
199 Ga0163161_10012709 3300017792 Bacteria 5848
200 Ga0163161_10021563 3300017792 Bacteria 4527
201 Ga0163161_10062388 3300017792 Bacteria 2715
202 Ga0213876_10006960 3300021384 Bacteria 6164
203 Ga0209564_1002496 3300025295 Bacteria 14342
204 Ga0209564_1027951 3300025295 Bacteria 1816
205 Ga0209758_1006184 3300025297 Bacteria 8753
206 Ga0209758_1009510 3300025297 Bacteria 6020
207 Ga0209050_1010149 3300025298 Bacteria 4686
208 Ga0207656_10096374 3300025321 Bacteria 1350
209 Ga0207656_10132775 3300025321 Bacteria 1168
210 Ga0207682_10005173 3300025893 Bacteria 5342
211 Ga0207682_10009604 3300025893 Bacteria 3814
212 Ga0207647_10000025 3300025904 Bacteria 112150
213 Ga0207647_10056165 3300025904 Bacteria 2416
214 Ga0207643_10004864 3300025908 Bacteria 7197
215 Ga0207705_10018083 3300025909 Bacteria 5040
216 Ga0207654_10000792 3300025911 Bacteria 17419
217 Ga0207707_10069215 3300025912 Bacteria 3076
218 Ga0207695_10000010 3300025913 Bacteria 981919
219 Ga0207695_10000087 3300025913 Bacteria 276412
220 Ga0207695_10000582 3300025913 Bacteria 74405
221 Ga0207695_10000909 3300025913 Bacteria 53303
222 Ga0207695_10004513 3300025913 Bacteria 18946
223 Ga0207695_10021645 3300025913 Bacteria 7330
224 Ga0207695_10026663 3300025913 Bacteria 6448
225 Ga0207695_10046555 3300025913 Bacteria 4597
226 Ga0207695_10096108 3300025913 Bacteria 2965
227 Ga0207671_10000298 3300025914 Bacteria 73044
228 Ga0207671_10000311 3300025914 Bacteria 71753
229 Ga0207671_10001101 3300025914 Bacteria 32578
230 Ga0207671_10005360 3300025914 Bacteria 11858
231 Ga0207671_10006605 3300025914 Bacteria 10294
232 Ga0207671_10165967 3300025914 Bacteria 1712
233 Ga0207662_10091093 3300025918 Unclassified 1875
234 Ga0207657_10030764 3300025919 Bacteria 4868
235 Ga0207657_10116581 3300025919 Bacteria 2200
236 Ga0207657_10273701 3300025919 Bacteria 1342
237 Ga0207652_10000051 3300025921 Bacteria 120327
238 Ga0207652_10000055 3300025921 Bacteria 115420
239 Ga0207652_10124901 3300025921 Bacteria 2292
240 Ga0207694_10007619 3300025924 Bacteria 8209
241 Ga0207650_10014161 3300025925 Bacteria 5539
242 Ga0207650_10016983 3300025925 Bacteria 5091
243 Ga0207650_10057633 3300025925 Bacteria 2890
244 Ga0207659_10043723 3300025926 Unclassified 3148
245 Ga0207690_10012438 3300025932 Bacteria 5090
246 Ga0207690_10022168 3300025932 Bacteria 3947
247 Ga0207686_10005594 3300025934 Bacteria 6737
248 Ga0207670_10032477 3300025936 Unclassified 3357
249 Ga0207691_10008540 3300025940 Bacteria 9836
250 Ga0207691_10016839 3300025940 Bacteria 6935
251 Ga0207691_10085506 3300025940 Bacteria 2830
252 Ga0207689_10019389 3300025942 Bacteria 5733
253 Ga0207689_10027519 3300025942 Bacteria 4758
254 Ga0207661_10024615 3300025944 Bacteria 4564
255 Ga0207661_10253321 3300025944 Bacteria 1566
256 Ga0207667_10000749 3300025949 Bacteria 42187
257 Ga0207667_10001603 3300025949 Bacteria 28431
258 Ga0207667_10031263 3300025949 Bacteria 5748
259 Ga0207667_10042516 3300025949 Bacteria 4829
260 Ga0207667_10113782 3300025949 Bacteria 2790
261 Ga0207651_10022977 3300025960 Bacteria 3827
262 Ga0207712_10008057 3300025961 Bacteria 6667
263 Ga0207668_10065733 3300025972 Bacteria 2568
264 Ga0207658_10048615 3300025986 Bacteria 3111
265 Ga0207658_10289216 3300025986 Bacteria 1408
266 Ga0207639_10020784 3300026041 Bacteria 4705
267 Ga0207639_10036134 3300026041 Unclassified 3659
268 Ga0207639_10087586 3300026041 Bacteria 2482
269 Ga0207678_10014247 3300026067 Bacteria 6990
270 Ga0207702_10023841 3300026078 Bacteria 5076
271 Ga0207702_10026977 3300026078 Bacteria 4770
272 Ga0207702_10133234 3300026078 Bacteria 2239
273 Ga0207641_10124804 3300026088 Bacteria 2303
274 Ga0207641_10279548 3300026088 Unclassified 1569
275 Ga0207648_10031584 3300026089 Unclassified 4682
276 Ga0207648_10181623 3300026089 Bacteria 1862
277 Ga0207676_10006124 3300026095 Bacteria 8493
278 Ga0207676_10075060 3300026095 Unclassified 2726
279 Ga0207674_10022880 3300026116 Bacteria 6706
280 Ga0207674_10034232 3300026116 Bacteria 5314
281 Ga0207674_10096270 3300026116 Bacteria 2945
282 Ga0207674_10137200 3300026116 Bacteria 2407
283 Ga0207675_100002654 3300026118 Bacteria 17641
284 Ga0207683_10163651 3300026121 Unclassified 2012
285 Ga0207683_10310285 3300026121 Unclassified 1444
286 Ga0207698_10006234 3300026142 Bacteria 7426
287 Ga0207698_10055519 3300026142 Bacteria 3053
288 Ga0207698_10089686 3300026142 Bacteria 2512
289 Ga0207698_10201769 3300026142 Bacteria 1781
290 Ga0207698_10321685 3300026142 Bacteria 1449
291 Ga0209995_1004836 3300027471 Bacteria 2163
292 Ga0268266_10000048 3300028379 Bacteria 310336
293 Ga0268266_10014956 3300028379 Bacteria 6662
294 Ga0268265_10006331 3300028380 Bacteria 8023
295 Ga0268265_10302283 3300028380 Bacteria 1441
296 Ga0268264_10000079 3300028381 Bacteria 249516
297 Ga0268264_10002530 3300028381 Bacteria 16066
298 Ga0268264_10002782 3300028381 Bacteria 15265
299 Ga0268264_10004563 3300028381 Bacteria 11794
300 Ga0307517_10064092 3300028786 Bacteria 3422
301 Ga0265338_10148826 3300028800 Unclassified 1822
302 Ga0316177_1157817 3300030731 Bacteria 2980
303 Ga0316176_1084122 3300030732 Bacteria 8376
304 Ga0316183_1025240 3300030742 Bacteria 70534
305 Ga0316181_1025809 3300030744 Bacteria 3599
306 Ga0265327_10000006 3300031251 Bacteria 693716
307 Ga0265327_10001989 3300031251 Bacteria 23209
308 Ga0265327_10016654 3300031251 Bacteria 4655
309 Ga0307513_10082060 3300031456 Unclassified 3320
310 Ga0307513_10124062 3300031456 Bacteria 2543
311 Ga0307413_10218515 3300031824 Bacteria 1390
312 Ga0307410_10015316 3300031852 Bacteria 4545
313 Ga0307407_10033201 3300031903 Bacteria 2814
314 Ga0307416_100159454 3300032002 Bacteria 2083
315 Ga0307414_10222026 3300032004 Bacteria 1552
316 Ga0395899_0004464 3300037312 Bacteria 10912
317 Ga0395899_0011638 3300037312 Bacteria 6732
318 Ga0395900_0002571 3300037418 Bacteria 19876
319 Ga0395900_0011131 3300037418 Bacteria 9194
320 Ga0395900_0476902 3300037418 Bacteria 1200
321 Ga0395900_0627135 3300037418 Bacteria 1013
322 Ga0395898_0001425 3300037466 Bacteria 34011
323 Ga0395898_0004557 3300037466 Bacteria 15127
324 Ga0395898_0058549 3300037466 Bacteria 3750
325 Ga0395905_0001271 3300037471 Bacteria 31130
326 Ga0395901_0000537 3300038443 Bacteria 43652
327 Ga0395901_0003118 3300038443 Bacteria 16656
328 Ga0395901_0022855 3300038443 Bacteria 6411
329 Ga0436365_1871658 3300039437 Bacteria 39500
330 Ga0451807_0458302 3300041486 Bacteria 2268
331 Ga0451845_0760433 3300041501 Bacteria 1264
332 Ga0451853_3655208 3300041512 Bacteria 1537
333 Ga0439431_0002485 3300041997 Bacteria 4083
334 Ga0439441_004106 3300042001 Unclassified 2187
335 Ga0466972_0000049 3300044658 Bacteria 118829
336 Ga0466972_0001452 3300044658 Bacteria 11515
337 Ga0466972_0122543 3300044658 Eukaryota 1226
338 Ga0466972_0147171 3300044658 Unclassified 1108
339 Ga0453683_0024668 3300044673 Bacteria 3823
340 Ga0466966_0000015 3300044684 Bacteria 127402
341 Ga0453684_0025645 3300044712 Bacteria 8553
342 Ga0453684_0210727 3300044712 Bacteria 2259
343 Ga0453684_0464702 3300044712 Unclassified 1406
344 Ga0466968_0020433 3300044735 Bacteria 2673
345 Ga0466957_0001667 3300044842 Bacteria 11661
346 Ga0466960_0165748 3300044901 Bacteria 1189
347 Ga0466959_0000030 3300045049 Bacteria 111343
348 Ga0466959_0015651 3300045049 Bacteria 5530
349 Ga0495638_0000008 3300046460 Bacteria 565643
350 Ga0495638_0049290 3300046460 Unclassified 2633
351 Ga0495594_0038205 3300046499 Bacteria 2621
352 Ga0495606_0023076 3300046507 Unclassified 4518
353 Ga0495632_0090526 3300046519 Bacteria 1451
354 Ga0495648_0013829 3300046524 Bacteria 5945
355 Ga0495668_0000780 3300046616 Bacteria 37096
356 Ga0495611_0000215 3300046648 Bacteria 40810
357 Ga0495672_0149030 3300047320 Bacteria 1215
358 Ga0495687_000429 3300047443 Bacteria 51940
359 Ga0495686_0000005 3300047472 Bacteria 827143
360 Ga0496115_0341330 3300048918 Unclassified 1222
361 Ga0501298_008789 3300049521 Bacteria 1705
362 Ga0501032_0001908 3300049569 Bacteria 16464
363 Ga0501034_0002670 3300049571 Bacteria 21081
364 Ga0501034_0013164 3300049571 Bacteria 8522
365 Ga0501034_0026352 3300049571 Bacteria 5921
366 Ga0501034_0115837 3300049571 Bacteria 2668
367 Ga0501034_0342588 3300049571 Bacteria 1424
368 Ga0501036_0005284 3300049572 Bacteria 10447
369 Ga0501037_0092182 3300049573 Bacteria 2191
370 Ga0501037_0213799 3300049573 Bacteria 1359
371 Ga0501043_0006363 3300049579 Bacteria 9485
372 Ga0501043_0007041 3300049579 Bacteria 8951
373 Ga0501043_0043756 3300049579 Bacteria 3520
374 Ga0501046_0009293 3300049580 Bacteria 8511
375 Ga0501047_0004399 3300049581 Bacteria 13262
376 Ga0501047_0026539 3300049581 Bacteria 5574
377 Ga0501047_0351276 3300049581 Bacteria 1311
378 Ga0501048_0000884 3300049582 Bacteria 22148
379 Ga0501068_0020953 3300049584 Bacteria 3815
380 Ga0501070_0169828 3300049586 Unclassified 1797
381 Ga0501070_0209782 3300049586 Bacteria 1599
382 Ga0501073_0002238 3300049589 Bacteria 14472
383 Ga0501074_0002913 3300049590 Bacteria 12013
384 Ga0501198_000663 3300049649 Bacteria 4277
385 Ga0501201_000578 3300049651 Bacteria 3420
386 Ga0501201_006326 3300049651 Bacteria 1121
387 Ga0501217_002131 3300049661 Bacteria 3844
388 Ga0501217_010918 3300049661 Bacteria 2000
389 Ga0501222_006426 3300049662 Bacteria 1581
390 Ga0501223_001796 3300049663 Bacteria 4845
391 Ga0501243_001183 3300049675 Bacteria 3725
392 Ga0501246_002528 3300049676 Bacteria 1444
393 Ga0501252_004030 3300049682 Bacteria 1547
394 Ga0501259_000337 3300049688 Bacteria 7391
395 Ga0501219_000339 3300049703 Bacteria 8028
396 Ga0501225_0057972 3300049705 Bacteria 1086
397 Ga0501234_001242 3300049707 Bacteria 4007
398 Ga0501245_001852 3300049708 Bacteria 2782
399 Ga0501080_0007927 3300049742 Bacteria 9620
400 Ga0501080_0068699 3300049742 Unclassified 3296
401 Ga0501080_0259478 3300049742 Bacteria 1584
402 Ga0501083_0015806 3300049744 Bacteria 5283
403 Ga0501279_014182 3300049775 Bacteria 1096
404 Ga0501035_0003312 3300049822 Bacteria 15431
405 Ga0501035_0009985 3300049822 Bacteria 8813
406 Ga0501044_0005356 3300049823 Bacteria 14261
407 Ga0501044_0014451 3300049823 Bacteria 8523
408 Ga0501044_0046420 3300049823 Bacteria 4497
409 Ga0501044_0091250 3300049823 Bacteria 3073
410 Ga0501044_0114316 3300049823 Bacteria 2705
411 Ga0501044_0153204 3300049823 Bacteria 2286
412 Ga0501212_003538 3300049851 Bacteria 1966
413 Ga0501284_00002 3300050005 Bacteria 220402
414 nmdc:mga0k408_46549_c1 3300050493 Bacteria 2505
415 nmdc:mga05p37_86474_c1 3300050507 Bacteria 3864
416 nmdc:mga09592_160771_c1 3300050508 Bacteria 1940
417 nmdc:mga09592_50698_c1 3300050508 Bacteria 3501
418 nmdc:mga09592_93117_c1 3300050508 Unclassified 2577
419 nmdc:mga0qj67_169102_c1 3300050509 Unclassified 1775
420 Ga0500578_0000063 3300053086 Bacteria 117869
421 Ga0500646_0002318 3300053090 Bacteria 4954
422 Ga0500646_0007693 3300053090 Bacteria 2752
423 Ga0500583_0000055 3300053092 Bacteria 72367
424 Ga0500583_0003401 3300053092 Bacteria 4998
425 Ga0500583_0003678 3300053092 Unclassified 4878
426 Ga0500641_0058194 3300053096 Bacteria 1605
427 Ga0500642_0003621 3300053130 Unclassified 4702
428 Ga0500568_0026794 3300053139 Bacteria 2416
429 Ga0500588_0004833 3300053146 Bacteria 2945
430 Ga0500616_0000003 3300053153 Bacteria 1220687
431 Ga0500622_0001758 3300053156 Bacteria 16652
432 Ga0500639_064137 3300053163 Unclassified 1888
433 Ga0500636_0056698 3300053177 Bacteria 2294
434 Ga0500636_0108991 3300053177 Bacteria 1567
435 Ga0466962_0148825 3300061719 Bacteria 1135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0213799 Ga0501037_0213799_523_1347 274
2 3300005937 Ga0081455_10071035 Ga0081455_100710353 288
3 3300013102 Ga0157371_10224545 Ga0157371_102245451 293
4 3300031824 Ga0307413_10218515 Ga0307413_102185152 293
5 3300041512 Ga0451853_3655208 Ga0451853_3655208_117_998 293
6 3300049571 Ga0501034_0342588 Ga0501034_0342588_497_1378 293
7 3300049651 Ga0501201_006326 Ga0501201_006326_31_912 293
8 3300003322 rootL2_10021159 rootL2_100211595 295
9 3300005843 Ga0068860_100001067 Ga0068860_10000106717 305
10 3300010375 Ga0105239_10003350 Ga0105239_100033501 305
11 3300025913 Ga0207695_10096108 Ga0207695_100961083 305
12 3300025914 Ga0207671_10005360 Ga0207671_1000536011 305
13 3300028381 Ga0268264_10004563 Ga0268264_100045636 305
14 3300025904 Ga0207647_10056165 Ga0207647_100561652 311
15 3300025913 Ga0207695_10046555 Ga0207695_100465554 311
16 3300025949 Ga0207667_10113782 Ga0207667_101137823 311
17 3300026078 Ga0207702_10026977 Ga0207702_100269773 311
18 3300005539 Ga0068853_100008344 Ga0068853_1000083445 314
19 3300061719 Ga0466962_0148825 Ga0466962_0148825_39_986 315
20 3300031456 Ga0307513_10124062 Ga0307513_101240621 317
21 3300005535 Ga0070684_100003772 Ga0070684_1000037727 318
22 3300005539 Ga0068853_100243734 Ga0068853_1002437342 318
23 3300013307 Ga0157372_10269731 Ga0157372_102697312 318
24 3300025913 Ga0207695_10000087 Ga0207695_10000087109 318
25 3300025944 Ga0207661_10024615 Ga0207661_100246155 318
26 3300026041 Ga0207639_10087586 Ga0207639_100875863 318
27 3300032004 Ga0307414_10222026 Ga0307414_102220263 319
28 3300001989 JGI24739J22299_10000037 JGI24739J22299_1000003710 322
29 3300003771 Ga0055526_1022264 Ga0055526_10222642 322
30 3300009093 Ga0105240_10000011 Ga0105240_10000011437 322
31 3300009093 Ga0105240_10027974 Ga0105240_100279741 322
32 3300009093 Ga0105240_10271888 Ga0105240_102718881 322
33 3300009545 Ga0105237_10154384 Ga0105237_101543843 322
34 3300009551 Ga0105238_10249879 Ga0105238_102498792 322
35 3300010375 Ga0105239_10040627 Ga0105239_100406272 322
36 3300025295 Ga0209564_1002496 Ga0209564_100249612 322
37 3300025295 Ga0209564_1027951 Ga0209564_10279511 322
38 3300025297 Ga0209758_1009510 Ga0209758_10095103 322
39 3300048918 Ga0496115_0341330 Ga0496115_0341330_148_1116 322
40 3300005548 Ga0070665_100000014 Ga0070665_100000014153 323
41 3300005843 Ga0068860_100000024 Ga0068860_100000024194 323
42 3300005288 Ga0065714_10119221 Ga0065714_101192212 324
43 3300005289 Ga0065704_10179346 Ga0065704_101793462 324
44 3300005293 Ga0065715_10022834 Ga0065715_100228344 324
45 3300005327 Ga0070658_10038064 Ga0070658_100380644 324
46 3300005327 Ga0070658_10048969 Ga0070658_100489692 324
47 3300005327 Ga0070658_10156856 Ga0070658_101568562 324
48 3300005328 Ga0070676_10093906 Ga0070676_100939062 324
49 3300005331 Ga0070670_100309571 Ga0070670_1003095712 324
50 3300005334 Ga0068869_100015903 Ga0068869_1000159033 324
51 3300005336 Ga0070680_100005499 Ga0070680_1000054994 324
52 3300005339 Ga0070660_100194563 Ga0070660_1001945631 324
53 3300005345 Ga0070692_10142732 Ga0070692_101427321 324
54 3300005366 Ga0070659_100015043 Ga0070659_1000150433 324
55 3300005366 Ga0070659_100241767 Ga0070659_1002417672 324
56 3300005455 Ga0070663_100091913 Ga0070663_1000919131 324
57 3300005456 Ga0070678_100268229 Ga0070678_1002682291 324
58 3300005458 Ga0070681_10198423 Ga0070681_101984231 324
59 3300005530 Ga0070679_100007464 Ga0070679_1000074643 324
60 3300005543 Ga0070672_100007450 Ga0070672_1000074502 324
61 3300005563 Ga0068855_100020085 Ga0068855_1000200854 324
62 3300005578 Ga0068854_100102842 Ga0068854_1001028423 324
63 3300005616 Ga0068852_100075700 Ga0068852_1000757002 324
64 3300005617 Ga0068859_100033494 Ga0068859_1000334945 324
65 3300005618 Ga0068864_100223121 Ga0068864_1002231213 324
66 3300005841 Ga0068863_100091873 Ga0068863_1000918732 324
67 3300006931 Ga0097620_100033488 Ga0097620_1000334885 324
68 3300009093 Ga0105240_10188153 Ga0105240_101881533 324
69 3300009094 Ga0111539_10373625 Ga0111539_103736251 324
70 3300009176 Ga0105242_10050235 Ga0105242_100502352 324
71 3300009553 Ga0105249_10005595 Ga0105249_100055953 324
72 3300009553 Ga0105249_10042200 Ga0105249_100422004 324
73 3300011119 Ga0105246_10329128 Ga0105246_103291282 324
74 3300013104 Ga0157370_10001463 Ga0157370_1000146314 324
75 3300013105 Ga0157369_10131033 Ga0157369_101310334 324
76 3300013105 Ga0157369_10551506 Ga0157369_105515061 324
77 3300013307 Ga0157372_10013773 Ga0157372_100137736 324
78 3300013307 Ga0157372_10088050 Ga0157372_100880503 324
79 3300013307 Ga0157372_10177252 Ga0157372_101772523 324
80 3300013307 Ga0157372_10468451 Ga0157372_104684512 324
81 3300014326 Ga0157380_10198172 Ga0157380_101981722 324
82 3300014326 Ga0157380_10214106 Ga0157380_102141062 324
83 3300014326 Ga0157380_10312970 Ga0157380_103129701 324
84 3300014969 Ga0157376_10396622 Ga0157376_103966221 324
85 3300021384 Ga0213876_10006960 Ga0213876_100069604 324
86 3300025893 Ga0207682_10005173 Ga0207682_100051735 324
87 3300025909 Ga0207705_10018083 Ga0207705_100180834 324
88 3300025912 Ga0207707_10069215 Ga0207707_100692154 324
89 3300025919 Ga0207657_10273701 Ga0207657_102737012 324
90 3300025921 Ga0207652_10000051 Ga0207652_1000005114 324
91 3300025921 Ga0207652_10000055 Ga0207652_1000005558 324
92 3300025932 Ga0207690_10012438 Ga0207690_100124385 324
93 3300025934 Ga0207686_10005594 Ga0207686_100055945 324
94 3300025942 Ga0207689_10027519 Ga0207689_100275193 324
95 3300025944 Ga0207661_10253321 Ga0207661_102533211 324
96 3300025960 Ga0207651_10022977 Ga0207651_100229772 324
97 3300025961 Ga0207712_10008057 Ga0207712_100080571 324
98 3300026067 Ga0207678_10014247 Ga0207678_100142477 324
99 3300026089 Ga0207648_10181623 Ga0207648_101816232 324
100 3300026095 Ga0207676_10075060 Ga0207676_100750602 324
101 3300026116 Ga0207674_10096270 Ga0207674_100962701 324
102 3300030731 Ga0316177_1157817 Ga0316177_11578172 324
103 3300030744 Ga0316181_1025809 Ga0316181_10258092 324
104 3300037312 Ga0395899_0011638 Ga0395899_0011638_1927_2901 324
105 3300037418 Ga0395900_0002571 Ga0395900_0002571_1603_2577 324
106 3300037418 Ga0395900_0011131 Ga0395900_0011131_6095_7069 324
107 3300037418 Ga0395900_0476902 Ga0395900_0476902_13_987 324
108 3300037418 Ga0395900_0627135 Ga0395900_0627135_12_986 324
109 3300037466 Ga0395898_0001425 Ga0395898_0001425_14271_15245 324
110 3300037466 Ga0395898_0058549 Ga0395898_0058549_1746_2720 324
111 3300038443 Ga0395901_0022855 Ga0395901_0022855_84_1058 324
112 3300039437 Ga0436365_1871658 Ga0436365_1871658_22434_23408 324
113 3300042001 Ga0439441_004106 Ga0439441_004106_931_1905 324
114 3300045049 Ga0466959_0015651 Ga0466959_0015651_125_1099 324
115 3300046499 Ga0495594_0038205 Ga0495594_0038205_534_1508 324
116 3300049521 Ga0501298_008789 Ga0501298_008789_628_1602 324
117 3300049649 Ga0501198_000663 Ga0501198_000663_2558_3532 324
118 3300049651 Ga0501201_000578 Ga0501201_000578_1769_2743 324
119 3300049661 Ga0501217_002131 Ga0501217_002131_2819_3793 324
120 3300049661 Ga0501217_010918 Ga0501217_010918_350_1324 324
121 3300049662 Ga0501222_006426 Ga0501222_006426_58_1032 324
122 3300049675 Ga0501243_001183 Ga0501243_001183_2260_3234 324
123 3300049676 Ga0501246_002528 Ga0501246_002528_257_1231 324
124 3300049682 Ga0501252_004030 Ga0501252_004030_280_1254 324
125 3300049688 Ga0501259_000337 Ga0501259_000337_813_1787 324
126 3300049707 Ga0501234_001242 Ga0501234_001242_13_987 324
127 3300049708 Ga0501245_001852 Ga0501245_001852_1501_2475 324
128 3300049775 Ga0501279_014182 Ga0501279_014182_13_987 324
129 3300049851 Ga0501212_003538 Ga0501212_003538_332_1306 324
130 3300050508 nmdc:mga09592_93117_c1 nmdc:mga09592_93117_c1_1199_2173 324
131 iso_pu_bacteria 2738541278 2738725558 324
132 iso_pu_bacteria 2840677318 2840678547 325
133 iso_pu_bacteria 2842903701 2842904735 325
134 iso_pu_bacteria 2881955468 2881955631 325
135 iso_pu_bacteria 2896085136 2896086365 325
136 iso_pu_bacteria 8055588893 8055590375 325
137 3300005563 Ga0068855_100005895 Ga0068855_1000058954 326
138 3300005577 Ga0068857_100025326 Ga0068857_1000253263 326
139 3300005578 Ga0068854_100020780 Ga0068854_1000207804 326
140 3300005616 Ga0068852_100001522 Ga0068852_1000015225 326
141 3300009093 Ga0105240_10002692 Ga0105240_1000269217 326
142 3300009093 Ga0105240_10115120 Ga0105240_101151204 326
143 3300009545 Ga0105237_10002469 Ga0105237_100024697 326
144 3300009545 Ga0105237_10050819 Ga0105237_100508195 326
145 3300009545 Ga0105237_10096739 Ga0105237_100967393 326
146 3300013104 Ga0157370_10002878 Ga0157370_1000287812 326
147 3300013105 Ga0157369_10048726 Ga0157369_100487263 326
148 3300013307 Ga0157372_10006780 Ga0157372_1000678011 326
149 3300025914 Ga0207671_10006605 Ga0207671_1000660512 326
150 3300025949 Ga0207667_10000749 Ga0207667_1000074932 326
151 3300026116 Ga0207674_10034232 Ga0207674_100342323 326
152 3300026142 Ga0207698_10055519 Ga0207698_100555192 326
153 3300049742 Ga0501080_0259478 Ga0501080_0259478_512_1495 326
154 3300005436 Ga0070713_100125573 Ga0070713_1001255732 327
155 3300005548 Ga0070665_100001020 Ga0070665_10000102020 327
156 3300005614 Ga0068856_100033883 Ga0068856_1000338832 327
157 3300009545 Ga0105237_10007092 Ga0105237_100070927 327
158 3300025913 Ga0207695_10000010 Ga0207695_10000010827 327
159 3300025913 Ga0207695_10026663 Ga0207695_100266633 327
160 3300025914 Ga0207671_10000298 Ga0207671_1000029830 327
161 3300025914 Ga0207671_10165967 Ga0207671_101659671 327
162 3300026078 Ga0207702_10023841 Ga0207702_100238412 327
163 3300028379 Ga0268266_10014956 Ga0268266_100149563 327
164 3300031251 Ga0265327_10000006 Ga0265327_10000006269 327
165 3300031251 Ga0265327_10001989 Ga0265327_100019892 327
166 3300037471 Ga0395905_0001271 Ga0395905_0001271_13801_14787 327
167 3300038443 Ga0395901_0000537 Ga0395901_0000537_27878_28864 327
168 3300005614 Ga0068856_100124752 Ga0068856_1001247524 328
169 3300005616 Ga0068852_100069468 Ga0068852_1000694682 328
170 3300005616 Ga0068852_100080221 Ga0068852_1000802213 328
171 3300005616 Ga0068852_100139474 Ga0068852_1001394743 328
172 3300009093 Ga0105240_10000106 Ga0105240_10000106146 328
173 3300009093 Ga0105240_10000895 Ga0105240_1000089539 328
174 3300009093 Ga0105240_10002358 Ga0105240_1000235827 328
175 3300009093 Ga0105240_10004897 Ga0105240_100048972 328
176 3300009174 Ga0105241_10000085 Ga0105241_1000008554 328
177 3300009545 Ga0105237_10000453 Ga0105237_1000045312 328
178 3300009545 Ga0105237_10013660 Ga0105237_100136605 328
179 3300009551 Ga0105238_10001678 Ga0105238_100016789 328
180 3300010375 Ga0105239_10000384 Ga0105239_1000038432 328
181 3300010375 Ga0105239_10003545 Ga0105239_100035455 328
182 3300013104 Ga0157370_10062579 Ga0157370_100625792 328
183 3300013105 Ga0157369_10005621 Ga0157369_100056214 328
184 3300013306 Ga0163162_10000687 Ga0163162_1000068725 328
185 3300013307 Ga0157372_10043256 Ga0157372_100432565 328
186 3300025911 Ga0207654_10000792 Ga0207654_100007923 328
187 3300025913 Ga0207695_10000582 Ga0207695_1000058226 328
188 3300025913 Ga0207695_10000909 Ga0207695_100009095 328
189 3300025913 Ga0207695_10004513 Ga0207695_100045136 328
190 3300025913 Ga0207695_10021645 Ga0207695_100216451 328
191 3300025914 Ga0207671_10000311 Ga0207671_1000031165 328
192 3300025914 Ga0207671_10001101 Ga0207671_1000110113 328
193 3300025924 Ga0207694_10007619 Ga0207694_100076196 328
194 3300025949 Ga0207667_10001603 Ga0207667_1000160326 328
195 3300026041 Ga0207639_10036134 Ga0207639_100361341 328
196 3300026142 Ga0207698_10089686 Ga0207698_100896861 328
197 3300026142 Ga0207698_10201769 Ga0207698_102017691 328
198 3300026142 Ga0207698_10321685 Ga0207698_103216853 328
199 3300028379 Ga0268266_10000048 Ga0268266_10000048231 328
200 3300028381 Ga0268264_10000079 Ga0268264_10000079228 328
201 3300028786 Ga0307517_10064092 Ga0307517_100640923 328
202 3300044658 Ga0466972_0001452 Ga0466972_0001452_6791_7837 328
203 3300044735 Ga0466968_0020433 Ga0466968_0020433_1387_2433 328
204 3300046460 Ga0495638_0049290 Ga0495638_0049290_311_1300 328
205 3300046507 Ga0495606_0023076 Ga0495606_0023076_2635_3621 328
206 3300046524 Ga0495648_0013829 Ga0495648_0013829_2128_3117 328
207 3300046648 Ga0495611_0000215 Ga0495611_0000215_4811_5797 328
208 3300047443 Ga0495687_000429 Ga0495687_000429_49783_50772 328
209 3300047472 Ga0495686_0000005 Ga0495686_0000005_572404_573390 328
210 3300053092 Ga0500583_0003678 Ga0500583_0003678_644_1633 328
211 3300053130 Ga0500642_0003621 Ga0500642_0003621_2516_3505 328
212 3300053139 Ga0500568_0026794 Ga0500568_0026794_426_1415 328
213 3300053156 Ga0500622_0001758 Ga0500622_0001758_9202_10191 328
214 2162886007 SwRhRL2b_contig_383773 SwRhRL2b_0393.00005990 329
215 3300003320 rootH2_10064125 rootH2_100641251 329
216 3300003322 rootL2_10177549 rootL2_101775495 329
217 3300005289 Ga0065704_10078432 Ga0065704_100784324 329
218 3300005289 Ga0065704_10078757 Ga0065704_100787575 329
219 3300005290 Ga0065712_10000456 Ga0065712_100004562 329
220 3300005290 Ga0065712_10148564 Ga0065712_101485641 329
221 3300005295 Ga0065707_10099090 Ga0065707_100990903 329
222 3300005329 Ga0070683_100095800 Ga0070683_1000958003 329
223 3300005331 Ga0070670_100021580 Ga0070670_1000215806 329
224 3300005331 Ga0070670_100026560 Ga0070670_1000265603 329
225 3300005331 Ga0070670_100257256 Ga0070670_1002572561 329
226 3300005333 Ga0070677_10075316 Ga0070677_100753161 329
227 3300005335 Ga0070666_10009910 Ga0070666_100099104 329
228 3300005337 Ga0070682_100000008 Ga0070682_10000000860 329
229 3300005339 Ga0070660_100004446 Ga0070660_1000044468 329
230 3300005339 Ga0070660_100080188 Ga0070660_1000801882 329
231 3300005343 Ga0070687_100066706 Ga0070687_1000667061 329
232 3300005354 Ga0070675_100172779 Ga0070675_1001727791 329
233 3300005366 Ga0070659_100182452 Ga0070659_1001824521 329
234 3300005367 Ga0070667_100077806 Ga0070667_1000778062 329
235 3300005367 Ga0070667_100114817 Ga0070667_1001148172 329
236 3300005367 Ga0070667_100203599 Ga0070667_1002035991 329
237 3300005459 Ga0068867_100169097 Ga0068867_1001690971 329
238 3300005459 Ga0068867_100227159 Ga0068867_1002271591 329
239 3300005466 Ga0070685_10023534 Ga0070685_100235343 329
240 3300005468 Ga0070707_100225167 Ga0070707_1002251672 329
241 3300005471 Ga0070698_100000061 Ga0070698_10000006137 329
242 3300005471 Ga0070698_100005416 Ga0070698_1000054163 329
243 3300005518 Ga0070699_100205753 Ga0070699_1002057532 329
244 3300005530 Ga0070679_100529583 Ga0070679_1005295831 329
245 3300005535 Ga0070684_100064197 Ga0070684_1000641974 329
246 3300005539 Ga0068853_100023210 Ga0068853_1000232104 329
247 3300005543 Ga0070672_100065633 Ga0070672_1000656331 329
248 3300005563 Ga0068855_100001486 Ga0068855_1000014867 329
249 3300005563 Ga0068855_100052203 Ga0068855_1000522033 329
250 3300005564 Ga0070664_100294903 Ga0070664_1002949032 329
251 3300005577 Ga0068857_100085412 Ga0068857_1000854122 329
252 3300005577 Ga0068857_100457543 Ga0068857_1004575432 329
253 3300005578 Ga0068854_100093809 Ga0068854_1000938093 329
254 3300005614 Ga0068856_100011049 Ga0068856_1000110499 329
255 3300005616 Ga0068852_100000857 Ga0068852_1000008578 329
256 3300005616 Ga0068852_100351340 Ga0068852_1003513401 329
257 3300005616 Ga0068852_100539751 Ga0068852_1005397512 329
258 3300005617 Ga0068859_100000903 Ga0068859_10000090329 329
259 3300005618 Ga0068864_100017261 Ga0068864_1000172616 329
260 3300005618 Ga0068864_100081379 Ga0068864_1000813793 329
261 3300005618 Ga0068864_100269040 Ga0068864_1002690402 329
262 3300005618 Ga0068864_100294737 Ga0068864_1002947371 329
263 3300005719 Ga0068861_100002412 Ga0068861_10000241210 329
264 3300005719 Ga0068861_100030341 Ga0068861_1000303414 329
265 3300005719 Ga0068861_100401666 Ga0068861_1004016661 329
266 3300005834 Ga0068851_10019318 Ga0068851_100193183 329
267 3300005840 Ga0068870_10011862 Ga0068870_100118624 329
268 3300005843 Ga0068860_100004752 Ga0068860_10000475210 329
269 3300005843 Ga0068860_100165855 Ga0068860_1001658551 329
270 3300005844 Ga0068862_100029425 Ga0068862_1000294254 329
271 3300005844 Ga0068862_100050218 Ga0068862_1000502182 329
272 3300006195 Ga0075366_10057308 Ga0075366_100573083 329
273 3300006237 Ga0097621_100000109 Ga0097621_10000010928 329
274 3300006237 Ga0097621_100368227 Ga0097621_1003682272 329
275 3300006358 Ga0068871_100001161 Ga0068871_1000011612 329
276 3300006358 Ga0068871_100096061 Ga0068871_1000960613 329
277 3300006844 Ga0075428_100024703 Ga0075428_1000247034 329
278 3300006844 Ga0075428_100034756 Ga0075428_1000347562 329
279 3300006844 Ga0075428_100188799 Ga0075428_1001887992 329
280 3300006880 Ga0075429_100001773 Ga0075429_10000177317 329
281 3300006880 Ga0075429_100190116 Ga0075429_1001901161 329
282 3300006881 Ga0068865_100143262 Ga0068865_1001432622 329
283 3300006931 Ga0097620_100000903 Ga0097620_1000009032 329
284 3300009147 Ga0114129_10015806 Ga0114129_100158063 329
285 3300009174 Ga0105241_10062016 Ga0105241_100620161 329
286 3300009177 Ga0105248_10024178 Ga0105248_100241784 329
287 3300009545 Ga0105237_10014675 Ga0105237_100146755 329
288 3300009545 Ga0105237_10048114 Ga0105237_100481142 329
289 3300009553 Ga0105249_10076842 Ga0105249_100768423 329
290 3300009553 Ga0105249_10414185 Ga0105249_104141851 329
291 3300010375 Ga0105239_10001747 Ga0105239_1000174725 329
292 3300013102 Ga0157371_10007807 Ga0157371_100078078 329
293 3300013102 Ga0157371_10053802 Ga0157371_100538023 329
294 3300013102 Ga0157371_10160570 Ga0157371_101605702 329
295 3300013104 Ga0157370_10001583 Ga0157370_1000158313 329
296 3300013105 Ga0157369_10075767 Ga0157369_100757674 329
297 3300013296 Ga0157374_10193320 Ga0157374_101933201 329
298 3300013297 Ga0157378_10243305 Ga0157378_102433052 329
299 3300013297 Ga0157378_10457634 Ga0157378_104576341 329
300 3300013306 Ga0163162_10000446 Ga0163162_1000044614 329
301 3300013306 Ga0163162_10000579 Ga0163162_1000057929 329
302 3300013306 Ga0163162_10006859 Ga0163162_100068594 329
303 3300013307 Ga0157372_10009682 Ga0157372_100096827 329
304 3300013307 Ga0157372_10033035 Ga0157372_100330354 329
305 3300013307 Ga0157372_10087316 Ga0157372_100873163 329
306 3300013307 Ga0157372_10243077 Ga0157372_102430771 329
307 3300013308 Ga0157375_10000212 Ga0157375_100002121 329
308 3300014325 Ga0163163_10000401 Ga0163163_1000040112 329
309 3300014326 Ga0157380_10002108 Ga0157380_1000210812 329
310 3300014326 Ga0157380_10030600 Ga0157380_100306004 329
311 3300014968 Ga0157379_10005159 Ga0157379_1000515910 329
312 3300014968 Ga0157379_10263216 Ga0157379_102632161 329
313 3300014968 Ga0157379_10478260 Ga0157379_104782601 329
314 3300014969 Ga0157376_10005274 Ga0157376_100052744 329
315 3300014969 Ga0157376_10375495 Ga0157376_103754952 329
316 3300017792 Ga0163161_10012709 Ga0163161_100127092 329
317 3300017792 Ga0163161_10021563 Ga0163161_100215631 329
318 3300017792 Ga0163161_10062388 Ga0163161_100623884 329
319 3300025297 Ga0209758_1006184 Ga0209758_10061842 329
320 3300025298 Ga0209050_1010149 Ga0209050_10101495 329
321 3300025321 Ga0207656_10096374 Ga0207656_100963741 329
322 3300025321 Ga0207656_10132775 Ga0207656_101327751 329
323 3300025893 Ga0207682_10009604 Ga0207682_100096043 329
324 3300025904 Ga0207647_10000025 Ga0207647_1000002527 329
325 3300025908 Ga0207643_10004864 Ga0207643_100048644 329
326 3300025918 Ga0207662_10091093 Ga0207662_100910932 329
327 3300025919 Ga0207657_10030764 Ga0207657_100307644 329
328 3300025919 Ga0207657_10116581 Ga0207657_101165812 329
329 3300025921 Ga0207652_10124901 Ga0207652_101249013 329
330 3300025925 Ga0207650_10014161 Ga0207650_100141612 329
331 3300025925 Ga0207650_10016983 Ga0207650_100169834 329
332 3300025925 Ga0207650_10057633 Ga0207650_100576333 329
333 3300025926 Ga0207659_10043723 Ga0207659_100437232 329
334 3300025932 Ga0207690_10022168 Ga0207690_100221683 329
335 3300025936 Ga0207670_10032477 Ga0207670_100324773 329
336 3300025940 Ga0207691_10008540 Ga0207691_100085402 329
337 3300025940 Ga0207691_10016839 Ga0207691_100168397 329
338 3300025940 Ga0207691_10085506 Ga0207691_100855063 329
339 3300025942 Ga0207689_10019389 Ga0207689_100193892 329
340 3300025949 Ga0207667_10031263 Ga0207667_100312633 329
341 3300025949 Ga0207667_10042516 Ga0207667_100425163 329
342 3300025972 Ga0207668_10065733 Ga0207668_100657333 329
343 3300025986 Ga0207658_10048615 Ga0207658_100486152 329
344 3300025986 Ga0207658_10289216 Ga0207658_102892162 329
345 3300026041 Ga0207639_10020784 Ga0207639_100207843 329
346 3300026078 Ga0207702_10133234 Ga0207702_101332342 329
347 3300026088 Ga0207641_10124804 Ga0207641_101248042 329
348 3300026088 Ga0207641_10279548 Ga0207641_102795482 329
349 3300026089 Ga0207648_10031584 Ga0207648_100315844 329
350 3300026095 Ga0207676_10006124 Ga0207676_100061243 329
351 3300026116 Ga0207674_10022880 Ga0207674_100228807 329
352 3300026116 Ga0207674_10137200 Ga0207674_101372002 329
353 3300026118 Ga0207675_100002654 Ga0207675_1000026548 329
354 3300026121 Ga0207683_10163651 Ga0207683_101636513 329
355 3300026121 Ga0207683_10310285 Ga0207683_103102852 329
356 3300026142 Ga0207698_10006234 Ga0207698_100062342 329
357 3300027471 Ga0209995_1004836 Ga0209995_10048361 329
358 3300028380 Ga0268265_10006331 Ga0268265_100063313 329
359 3300028380 Ga0268265_10302283 Ga0268265_103022831 329
360 3300028381 Ga0268264_10002530 Ga0268264_100025305 329
361 3300028381 Ga0268264_10002782 Ga0268264_1000278210 329
362 3300028800 Ga0265338_10148826 Ga0265338_101488262 329
363 3300030732 Ga0316176_1084122 Ga0316176_10841223 329
364 3300030742 Ga0316183_1025240 Ga0316183_102524037 329
365 3300031251 Ga0265327_10016654 Ga0265327_100166543 329
366 3300031456 Ga0307513_10082060 Ga0307513_100820602 329
367 3300031852 Ga0307410_10015316 Ga0307410_100153164 329
368 3300031903 Ga0307407_10033201 Ga0307407_100332011 329
369 3300032002 Ga0307416_100159454 Ga0307416_1001594541 329
370 3300037312 Ga0395899_0004464 Ga0395899_0004464_563_1552 329
371 3300037466 Ga0395898_0004557 Ga0395898_0004557_5737_6726 329
372 3300038443 Ga0395901_0003118 Ga0395901_0003118_4362_5351 329
373 3300041486 Ga0451807_0458302 Ga0451807_0458302_389_1378 329
374 3300041501 Ga0451845_0760433 Ga0451845_0760433_140_1129 329
375 3300041997 Ga0439431_0002485 Ga0439431_0002485_777_1772 329
376 3300044658 Ga0466972_0000049 Ga0466972_0000049_47493_48482 329
377 3300044658 Ga0466972_0122543 Ga0466972_0122543_59_1048 329
378 3300044658 Ga0466972_0147171 Ga0466972_0147171_61_1050 329
379 3300044673 Ga0453683_0024668 Ga0453683_0024668_2634_3623 329
380 3300044684 Ga0466966_0000015 Ga0466966_0000015_30398_31387 329
381 3300044712 Ga0453684_0025645 Ga0453684_0025645_5088_6077 329
382 3300044712 Ga0453684_0210727 Ga0453684_0210727_476_1465 329
383 3300044712 Ga0453684_0464702 Ga0453684_0464702_92_1081 329
384 3300044842 Ga0466957_0001667 Ga0466957_0001667_3040_4029 329
385 3300044901 Ga0466960_0165748 Ga0466960_0165748_48_1043 329
386 3300045049 Ga0466959_0000030 Ga0466959_0000030_107312_108301 329
387 3300046460 Ga0495638_0000008 Ga0495638_0000008_334470_335459 329
388 3300046519 Ga0495632_0090526 Ga0495632_0090526_134_1123 329
389 3300046616 Ga0495668_0000780 Ga0495668_0000780_34027_35016 329
390 3300047320 Ga0495672_0149030 Ga0495672_0149030_11_1000 329
391 3300049569 Ga0501032_0001908 Ga0501032_0001908_9240_10229 329
392 3300049571 Ga0501034_0002670 Ga0501034_0002670_14454_15443 329
393 3300049571 Ga0501034_0013164 Ga0501034_0013164_1349_2338 329
394 3300049571 Ga0501034_0026352 Ga0501034_0026352_1424_2413 329
395 3300049571 Ga0501034_0115837 Ga0501034_0115837_565_1554 329
396 3300049572 Ga0501036_0005284 Ga0501036_0005284_5392_6381 329
397 3300049573 Ga0501037_0092182 Ga0501037_0092182_496_1485 329
398 3300049579 Ga0501043_0006363 Ga0501043_0006363_6242_7231 329
399 3300049579 Ga0501043_0007041 Ga0501043_0007041_4862_5851 329
400 3300049579 Ga0501043_0043756 Ga0501043_0043756_1433_2422 329
401 3300049580 Ga0501046_0009293 Ga0501046_0009293_2646_3635 329
402 3300049581 Ga0501047_0004399 Ga0501047_0004399_1845_2834 329
403 3300049581 Ga0501047_0026539 Ga0501047_0026539_1435_2424 329
404 3300049581 Ga0501047_0351276 Ga0501047_0351276_71_1060 329
405 3300049582 Ga0501048_0000884 Ga0501048_0000884_8196_9185 329
406 3300049584 Ga0501068_0020953 Ga0501068_0020953_156_1145 329
407 3300049586 Ga0501070_0169828 Ga0501070_0169828_214_1203 329
408 3300049586 Ga0501070_0209782 Ga0501070_0209782_222_1211 329
409 3300049589 Ga0501073_0002238 Ga0501073_0002238_6478_7467 329
410 3300049590 Ga0501074_0002913 Ga0501074_0002913_7951_8940 329
411 3300049663 Ga0501223_001796 Ga0501223_001796_2473_3462 329
412 3300049703 Ga0501219_000339 Ga0501219_000339_382_1377 329
413 3300049705 Ga0501225_0057972 Ga0501225_0057972_53_1042 329
414 3300049742 Ga0501080_0007927 Ga0501080_0007927_2503_3492 329
415 3300049742 Ga0501080_0068699 Ga0501080_0068699_256_1245 329
416 3300049744 Ga0501083_0015806 Ga0501083_0015806_3033_4022 329
417 3300049822 Ga0501035_0003312 Ga0501035_0003312_8010_8999 329
418 3300049822 Ga0501035_0009985 Ga0501035_0009985_4439_5428 329
419 3300049823 Ga0501044_0005356 Ga0501044_0005356_2768_3757 329
420 3300049823 Ga0501044_0014451 Ga0501044_0014451_3334_4323 329
421 3300049823 Ga0501044_0046420 Ga0501044_0046420_2731_3720 329
422 3300049823 Ga0501044_0091250 Ga0501044_0091250_1410_2399 329
423 3300049823 Ga0501044_0114316 Ga0501044_0114316_1339_2328 329
424 3300049823 Ga0501044_0153204 Ga0501044_0153204_361_1350 329
425 3300050005 Ga0501284_00002 Ga0501284_00002_97611_98606 329
426 3300050493 nmdc:mga0k408_46549_c1 nmdc:mga0k408_46549_c1_165_1154 329
427 3300050507 nmdc:mga05p37_86474_c1 nmdc:mga05p37_86474_c1_677_1666 329
428 3300050508 nmdc:mga09592_160771_c1 nmdc:mga09592_160771_c1_753_1742 329
429 3300050508 nmdc:mga09592_50698_c1 nmdc:mga09592_50698_c1_196_1185 329
430 3300050509 nmdc:mga0qj67_169102_c1 nmdc:mga0qj67_169102_c1_122_1111 329
431 3300053086 Ga0500578_0000063 Ga0500578_0000063_15377_16366 329
432 3300053090 Ga0500646_0002318 Ga0500646_0002318_2245_3273 329
433 3300053090 Ga0500646_0007693 Ga0500646_0007693_1743_2732 329
434 3300053092 Ga0500583_0000055 Ga0500583_0000055_63960_65042 329
435 3300053092 Ga0500583_0003401 Ga0500583_0003401_3752_4741 329
436 3300053096 Ga0500641_0058194 Ga0500641_0058194_423_1412 329
437 3300053146 Ga0500588_0004833 Ga0500588_0004833_754_1743 329
438 3300053153 Ga0500616_0000003 Ga0500616_0000003_204236_205225 329
439 3300053163 Ga0500639_064137 Ga0500639_064137_392_1381 329
440 3300053177 Ga0500636_0056698 Ga0500636_0056698_1240_2229 329
441 3300053177 Ga0500636_0108991 Ga0500636_0108991_473_1462 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

34

340

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9337 1 325
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9328 1 325
7wf3-assembly1.cif.gz_C composite map of human kv1.3 channel in apo state with beta subunits 0.9317 3 326
3eb3-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone 0.9311 3 324
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9282 1 325
ID Description Score Start End Superfamily
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9458 1 326 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9429 1 326 3.20.20.100
af_P97382_23_247_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9421 108 326 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9362 1 326 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9307 1 326 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A4Q5Z1J2-F1-model_v4 Aldo/keto reductase 0.9628 1 226 GO:0016491
AF-A0A4Q5Z1J2-F1-model_v4 Aldo/keto reductase 0.9587 1 226 GO:0016491
AF-A0A5N5MHI4-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9584 109 329 GO:0016491
AF-A0A0P5GJ03-F1-model_v4 deleted 0.9577 3 210
AF-A0A7V5DBC9-F1-model_v4 Aldo/keto reductase 0.9566 59 329 GO:0016491

Feature Viewer

pLDDT pTM Quality
87.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map