F444725

General Info

Members Datasets Scaffolds Average Seq Length
441 243 882 131

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_001677|Ga0495591_001677_6842_7225
Length 127
Sequence MVEYTELDRLFEKSRADMELVRPVLNKIADKWTIMILTVICPQPARFNEIKKRLNITHKALADALKRLEKNGLVTRTVLPTTPIGVEYAITPLGHSLRGPFEALCQWAMEHGDSIEEANLSYDSRAI

Samples

Sample ID Description Type Environment
1 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
112 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
177 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
180 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
190 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
191 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
192 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
193 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
194 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
195 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
196 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
197 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
198 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
199 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
200 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
201 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
202 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
203 2643221568 Rhizobium sp. Root564 Isolate Unclassified
204 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
205 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
206 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
207 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
208 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
209 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
210 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
211 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
212 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
213 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
214 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
215 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
216 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
217 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
218 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
219 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
220 2909042592 Labrys sp. LIt4 Isolate Nodule
221 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
222 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
223 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
224 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
225 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
226 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
227 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
228 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
229 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
230 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
231 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
232 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
233 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
234 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
235 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
236 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
237 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
238 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
239 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
240 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
241 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
242 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
243 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.3
Metatranscriptomes 0
Isolates 12.7

Biome Distribution

Category Percentage (%)
Aerial Root 1.36
Bulb 0
Endosphere 19.5
Nodule 3.63
Rhizoplane 7.03
Rhizosphere 44.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495591_001677 3300046458 Bacteria 13310
2 RicEn_C977 2010549000 Bacteria 1433
3 SwRhRL2b_contig_2193616 2162886007 Bacteria 2830
4 JGI25152J39213_1001389 3300002773 Bacteria 10482
5 JGI25150J39212_1001570 3300002774 Bacteria 6248
6 JGI25151J46595_10000221 3300003187 Bacteria 67231
7 JGI25151J46595_10000625 3300003187 Bacteria 30742
8 JGI25151J46595_10029620 3300003187 Bacteria 2164
9 JGI25153J46596_10041620 3300003215 Bacteria 1411
10 rootH1_10108472 3300003316 Bacteria 1544
11 rootL2_10092313 3300003322 Bacteria 2018
12 Ga0055526_1014593 3300003771 Bacteria 3219
13 Ga0055536_1000224 3300003781 Bacteria 45927
14 Ga0055536_1004451 3300003781 Bacteria 7158
15 Ga0055530_10000341 3300003791 Bacteria 42186
16 Ga0055530_10013196 3300003791 Bacteria 2830
17 Ga0055540_1005128 3300003792 Bacteria 5634
18 Ga0055531_10000442 3300003794 Bacteria 38998
19 Ga0055531_10008650 3300003794 Bacteria 5328
20 Ga0055531_10011338 3300003794 Bacteria 4314
21 Ga0055531_10028434 3300003794 Bacteria 1928
22 Ga0058692_1000038 3300003856 Bacteria 140136
23 Ga0058692_1002560 3300003856 Bacteria 6016
24 Ga0058692_1044335 3300003856 Bacteria 763
25 Ga0058692_1049888 3300003856 Bacteria 697
26 Ga0055543_1028057 3300004625 Bacteria 993
27 Ga0065165_1003388 3300005262 Bacteria 11262
28 Ga0065165_1007581 3300005262 Bacteria 5289
29 Ga0065165_1045082 3300005262 Bacteria 1286
30 Ga0065165_1103145 3300005262 Bacteria 711
31 Ga0065704_10070504 3300005289 Bacteria 22276
32 Ga0065704_10100287 3300005289 Bacteria 2280
33 Ga0070690_100231154 3300005330 Bacteria 1300
34 Ga0070670_100000186 3300005331 Bacteria 56675
35 Ga0070670_100000287 3300005331 Bacteria 44454
36 Ga0070670_100030311 3300005331 Bacteria 4658
37 Ga0070666_10080849 3300005335 Bacteria 2221
38 Ga0070660_100067857 3300005339 Bacteria 2779
39 Ga0070668_100004048 3300005347 Bacteria 10852
40 Ga0070668_100017255 3300005347 Bacteria 5404
41 Ga0070668_100033848 3300005347 Bacteria 3893
42 Ga0070669_100000082 3300005353 Bacteria 91465
43 Ga0070669_100004366 3300005353 Bacteria 10207
44 Ga0070669_100137571 3300005353 Bacteria 1880
45 Ga0070669_100593620 3300005353 Bacteria 927
46 Ga0070669_101293382 3300005353 Bacteria 631
47 Ga0070671_100000968 3300005355 Bacteria 21046
48 Ga0070671_100001230 3300005355 Bacteria 19191
49 Ga0070671_100023904 3300005355 Bacteria 5001
50 Ga0070671_100744174 3300005355 Bacteria 852
51 Ga0070667_100005604 3300005367 Bacteria 10486
52 Ga0070667_100142470 3300005367 Bacteria 2100
53 Ga0070710_10444953 3300005437 Bacteria 877
54 Ga0070665_100000498 3300005548 Bacteria 56205
55 Ga0070665_100154343 3300005548 Bacteria 2298
56 Ga0070665_100227891 3300005548 Bacteria 1863
57 Ga0070665_100238256 3300005548 Bacteria 1820
58 Ga0068857_100183893 3300005577 Bacteria 1902
59 Ga0068854_100117507 3300005578 Bacteria 2014
60 Ga0068852_100964144 3300005616 Bacteria 871
61 Ga0068863_100002690 3300005841 Bacteria 17568
62 Ga0068860_100043227 3300005843 Bacteria 4300
63 Ga0068862_100008200 3300005844 Bacteria 8637
64 Ga0068862_100056855 3300005844 Bacteria 3353
65 Ga0068862_100273630 3300005844 Bacteria 1545
66 Ga0075365_10178320 3300006038 Bacteria 1485
67 Ga0075365_10723136 3300006038 Bacteria 703
68 Ga0075364_10193098 3300006051 Bacteria 1379
69 Ga0075364_10718592 3300006051 Bacteria 682
70 Ga0075367_10728069 3300006178 Bacteria 631
71 Ga0075370_10103989 3300006353 Bacteria 1645
72 Ga0075370_10413729 3300006353 Bacteria 810
73 Ga0099826_10000081 3300006948 Bacteria 48659
74 Ga0105251_10000354 3300009011 Bacteria 45386
75 Ga0105244_10000835 3300009036 Bacteria 26067
76 Ga0105250_10024775 3300009092 Bacteria 2417
77 Ga0105240_10771720 3300009093 Bacteria 1043
78 Ga0105247_10540042 3300009101 Bacteria 855
79 Ga0105241_10157111 3300009174 Bacteria 1866
80 Ga0105248_10007007 3300009177 Bacteria 12343
81 Ga0105248_10061413 3300009177 Bacteria 4219
82 Ga0105237_10001763 3300009545 Bacteria 27979
83 Ga0105237_10009200 3300009545 Bacteria 10603
84 Ga0105238_10215878 3300009551 Bacteria 1894
85 Ga0105238_12739982 3300009551 Bacteria 529
86 Ga0105249_10038171 3300009553 Bacteria 4357
87 Ga0105239_11367481 3300010375 Bacteria 817
88 Ga0157373_10023939 3300013100 Bacteria 4425
89 Ga0157373_10025014 3300013100 Bacteria 4322
90 Ga0157373_10087932 3300013100 Bacteria 2189
91 Ga0157373_10400359 3300013100 Bacteria 984
92 Ga0157371_10003468 3300013102 Bacteria 14287
93 Ga0157371_10003988 3300013102 Bacteria 13085
94 Ga0157370_10044036 3300013104 Bacteria 4293
95 Ga0157369_10033197 3300013105 Bacteria 5674
96 Ga0157369_10078158 3300013105 Bacteria 3546
97 Ga0157369_10152659 3300013105 Bacteria 2441
98 Ga0163162_10005028 3300013306 Bacteria 12739
99 Ga0163162_10055212 3300013306 Bacteria 3998
100 Ga0163162_10687899 3300013306 Bacteria 1145
101 Ga0157372_10056716 3300013307 Bacteria 4377
102 Ga0157372_10708395 3300013307 Bacteria 1171
103 Ga0182006_1000524 3300015261 Bacteria 29141
104 Ga0213876_10000114 3300021384 Bacteria 88897
105 Ga0213876_10476225 3300021384 Bacteria 664
106 Ga0209672_111341 3300025228 Bacteria 1158
107 Ga0209437_128829 3300025233 Bacteria 581
108 Ga0207425_1001146 3300025245 Bacteria 11926
109 Ga0207425_1011455 3300025245 Bacteria 2113
110 Ga0207425_1051236 3300025245 Bacteria 753
111 Ga0209148_1006267 3300025254 Bacteria 2595
112 Ga0209129_1000182 3300025258 Bacteria 87739
113 Ga0209129_1001654 3300025258 Bacteria 12069
114 Ga0209130_1010173 3300025284 Bacteria 2609
115 Ga0209130_1020015 3300025284 Bacteria 1539
116 Ga0209676_1000136 3300025292 Bacteria 181860
117 Ga0209676_1000230 3300025292 Bacteria 121783
118 Ga0209676_1003367 3300025292 Bacteria 9954
119 Ga0209025_1000225 3300025294 Bacteria 133040
120 Ga0209025_1000374 3300025294 Bacteria 93607
121 Ga0209025_1000461 3300025294 Bacteria 79418
122 Ga0209025_1031609 3300025294 Bacteria 2499
123 Ga0209758_1007624 3300025297 Bacteria 7300
124 Ga0209758_1038249 3300025297 Bacteria 1842
125 Ga0209050_1000233 3300025298 Bacteria 121806
126 Ga0209050_1000238 3300025298 Bacteria 119729
127 Ga0209050_1004387 3300025298 Bacteria 9572
128 Ga0209050_1009252 3300025298 Bacteria 5077
129 Ga0207426_1005756 3300025302 Bacteria 5573
130 Ga0209051_1004695 3300025303 Bacteria 8310
131 Ga0209051_1008674 3300025303 Bacteria 5350
132 Ga0209051_1089596 3300025303 Bacteria 860
133 Ga0209257_1000142 3300025304 Bacteria 200756
134 Ga0209257_1000291 3300025304 Bacteria 110720
135 Ga0209257_1000477 3300025304 Bacteria 72873
136 Ga0209257_1004069 3300025304 Bacteria 11735
137 Ga0209257_1022615 3300025304 Bacteria 2235
138 Ga0209257_1078399 3300025304 Bacteria 853
139 Ga0207696_1004091 3300025711 Bacteria 6389
140 Ga0207655_1007098 3300025728 Bacteria 7318
141 Ga0207655_1226894 3300025728 Bacteria 541
142 Ga0207713_1002249 3300025735 Bacteria 14269
143 Ga0207680_10048697 3300025903 Bacteria 2519
144 Ga0207705_10657946 3300025909 Bacteria 815
145 Ga0207654_10115310 3300025911 Bacteria 1678
146 Ga0207695_10549587 3300025913 Bacteria 1036
147 Ga0207671_10000812 3300025914 Bacteria 39489
148 Ga0207671_10004853 3300025914 Bacteria 12655
149 Ga0207657_10308780 3300025919 Bacteria 1252
150 Ga0207681_10000109 3300025923 Bacteria 71373
151 Ga0207681_10000302 3300025923 Bacteria 36350
152 Ga0207681_10504030 3300025923 Bacteria 991
153 Ga0207681_10531051 3300025923 Bacteria 966
154 Ga0207681_11223322 3300025923 Bacteria 631
155 Ga0207694_10445826 3300025924 Bacteria 1080
156 Ga0207694_10472327 3300025924 Bacteria 1048
157 Ga0207650_10000437 3300025925 Bacteria 36104
158 Ga0207650_10004065 3300025925 Bacteria 10001
159 Ga0207650_10365572 3300025925 Bacteria 1189
160 Ga0207644_10000203 3300025931 Bacteria 41625
161 Ga0207644_10000626 3300025931 Bacteria 22511
162 Ga0207644_10025594 3300025931 Bacteria 4058
163 Ga0207644_10667992 3300025931 Bacteria 865
164 Ga0207711_10005308 3300025941 Bacteria 10928
165 Ga0207711_10411897 3300025941 Bacteria 1256
166 Ga0207712_10515466 3300025961 Bacteria 1024
167 Ga0207668_10016370 3300025972 Bacteria 4626
168 Ga0207668_10125418 3300025972 Bacteria 1951
169 Ga0207640_10105224 3300025981 Bacteria 1988
170 Ga0207640_10120917 3300025981 Bacteria 1876
171 Ga0207658_10001763 3300025986 Bacteria 16250
172 Ga0207658_10006690 3300025986 Bacteria 7857
173 Ga0207641_10005866 3300026088 Bacteria 10422
174 Ga0207674_10132142 3300026116 Bacteria 2459
175 Ga0207698_10782949 3300026142 Bacteria 955
176 Ga0209371_1000003 3300027312 Bacteria 1122971
177 Ga0209371_1000093 3300027312 Bacteria 171050
178 Ga0209371_1000101 3300027312 Bacteria 153288
179 Ga0209371_1001365 3300027312 Bacteria 16869
180 Ga0209371_1004369 3300027312 Bacteria 6204
181 Ga0209371_1004940 3300027312 Bacteria 5540
182 Ga0209371_1006679 3300027312 Bacteria 4208
183 Ga0209371_1009577 3300027312 Bacteria 3063
184 Ga0209371_1038101 3300027312 Bacteria 994
185 Ga0209282_1002674 3300027666 Bacteria 10380
186 Ga0268266_10000229 3300028379 Bacteria 96547
187 Ga0268266_10006189 3300028379 Bacteria 10993
188 Ga0268266_10021013 3300028379 Bacteria 5564
189 Ga0268265_10007842 3300028380 Bacteria 7205
190 Ga0268265_10170492 3300028380 Bacteria 1859
191 Ga0268265_10813619 3300028380 Bacteria 911
192 Ga0268264_10012726 3300028381 Bacteria 6923
193 Ga0307515_10006781 3300028794 Bacteria 22788
194 Ga0268256_1000004 3300030500 Bacteria 1122967
195 Ga0268256_1000029 3300030500 Bacteria 430123
196 Ga0268256_1000081 3300030500 Bacteria 171742
197 Ga0268256_1003380 3300030500 Bacteria 7224
198 Ga0268256_1004735 3300030500 Bacteria 5540
199 Ga0268256_1006761 3300030500 Bacteria 4208
200 Ga0268256_1010176 3300030500 Bacteria 3063
201 Ga0268256_1043339 3300030500 Bacteria 994
202 Ga0307413_10940914 3300031824 Bacteria 737
203 Ga0307410_10935878 3300031852 Bacteria 744
204 Ga0307412_10002041 3300031911 Bacteria 11210
205 Ga0307412_10803377 3300031911 Bacteria 817
206 Ga0307411_12038358 3300032005 Bacteria 536
207 Ga0395905_1074137 3300037471 Bacteria 708
208 Ga0436365_0454988 3300039437 Bacteria 170585
209 Ga0436365_1249181 3300039437 Bacteria 1673
210 Ga0436365_1794050 3300039437 Bacteria 1253
211 Ga0439438_000005 3300041405 Bacteria 408610
212 Ga0439438_006175 3300041405 Bacteria 4267
213 Ga0439438_008868 3300041405 Bacteria 3295
214 Ga0439447_000772 3300041407 Bacteria 11785
215 Ga0439447_110622 3300041407 Bacteria 630
216 Ga0451807_0911804 3300041486 Bacteria 586
217 Ga0451839_0749399 3300041496 Bacteria 615
218 Ga0451849_0563160 3300041505 Bacteria 1949
219 Ga0451843_0160846 3300041509 Bacteria 8144
220 Ga0451855_0022283 3300041511 Bacteria 12337
221 Ga0439432_017140 3300042006 Bacteria 2433
222 Ga0439452_000002 3300042010 Bacteria 1377577
223 Ga0439463_000199 3300042016 Bacteria 16136
224 Ga0466968_0001795 3300044735 Bacteria 7744
225 Ga0466960_0075767 3300044901 Bacteria 1684
226 Ga0495627_000132 3300046453 Bacteria 90039
227 Ga0495638_0000131 3300046460 Bacteria 120792
228 Ga0495638_0011604 3300046460 Bacteria 6067
229 Ga0495638_0046386 3300046460 Bacteria 2730
230 Ga0495650_0000026 3300046471 Bacteria 476029
231 Ga0495605_0028665 3300046474 Bacteria 2872
232 Ga0495584_0548148 3300046491 Bacteria 589
233 Ga0495596_0010166 3300046500 Bacteria 4110
234 Ga0495607_0130349 3300046501 Bacteria 1309
235 Ga0495607_0469319 3300046501 Bacteria 562
236 Ga0495583_0000005 3300046506 Bacteria 636894
237 Ga0495606_0000816 3300046507 Bacteria 47367
238 Ga0495610_0136849 3300046512 Bacteria 1058
239 Ga0495616_0421549 3300046513 Bacteria 545
240 Ga0495643_0001560 3300046522 Bacteria 20425
241 Ga0495643_0175497 3300046522 Bacteria 1045
242 Ga0495644_0013000 3300046523 Bacteria 3199
243 Ga0495648_0002689 3300046524 Bacteria 16053
244 Ga0495648_0013092 3300046524 Bacteria 6150
245 Ga0495648_0033949 3300046524 Bacteria 3327
246 Ga0495648_0069880 3300046524 Bacteria 2042
247 Ga0495663_0374834 3300046525 Bacteria 521
248 Ga0495654_0000659 3300046530 Bacteria 27210
249 Ga0495609_0016154 3300046538 Bacteria 3480
250 Ga0495609_0429899 3300046538 Bacteria 526
251 Ga0495668_0050638 3300046616 Bacteria 2301
252 Ga0495588_0120164 3300046674 Bacteria 1385
253 Ga0495671_0016810 3300046692 Bacteria 3901
254 Ga0495660_0000029 3300046810 Bacteria 228905
255 Ga0495672_0000001 3300047320 Bacteria 1458820
256 Ga0495672_0316315 3300047320 Bacteria 734
257 Ga0495676_0368395 3300047321 Bacteria 958
258 Ga0495683_0013924 3300047323 Bacteria 4193
259 Ga0495673_0000648 3300047469 Bacteria 34166
260 Ga0495673_0106476 3300047469 Bacteria 1126
261 Ga0495686_0001612 3300047472 Bacteria 23707
262 Ga0496100_0047319 3300048903 Bacteria 2770
263 Ga0496101_0033881 3300048904 Bacteria 3605
264 Ga0496101_0097129 3300048904 Bacteria 2199
265 Ga0496102_0000615 3300048905 Bacteria 36925
266 Ga0496102_0093089 3300048905 Bacteria 2792
267 Ga0496103_0000081 3300048906 Bacteria 109734
268 Ga0496103_0085184 3300048906 Bacteria 1992
269 Ga0496104_0000081 3300048907 Bacteria 94514
270 Ga0496104_0007642 3300048907 Bacteria 9571
271 Ga0496105_0000034 3300048908 Bacteria 127505
272 Ga0496105_0006265 3300048908 Bacteria 9138
273 Ga0496106_0018573 3300048909 Bacteria 5145
274 Ga0496107_0015014 3300048910 Bacteria 5425
275 Ga0496110_0398766 3300048913 Bacteria 1254
276 Ga0496110_1298001 3300048913 Bacteria 637
277 Ga0496111_0365994 3300048914 Bacteria 1067
278 Ga0496112_0105737 3300048915 Bacteria 2784
279 Ga0496113_0000101 3300048916 Bacteria 36217
280 Ga0496113_0038975 3300048916 Bacteria 3496
281 Ga0496115_0269842 3300048918 Bacteria 1398
282 Ga0496116_0000097 3300048919 Bacteria 200658
283 Ga0496116_0018103 3300048919 Bacteria 5441
284 Ga0496116_0044141 3300048919 Bacteria 3031
285 Ga0496116_0055110 3300048919 Bacteria 2613
286 Ga0496116_0081383 3300048919 Bacteria 2008
287 Ga0496117_0000146 3300048920 Bacteria 152244
288 Ga0496117_0000411 3300048920 Bacteria 72032
289 Ga0496117_0050657 3300048920 Bacteria 2943
290 Ga0496117_0050751 3300048920 Bacteria 2939
291 Ga0496117_0143936 3300048920 Bacteria 1423
292 Ga0496117_0177170 3300048920 Bacteria 1230
293 Ga0496118_0002700 3300048921 Bacteria 23383
294 Ga0496118_0010867 3300048921 Bacteria 8958
295 Ga0496118_0059147 3300048921 Bacteria 2856
296 Ga0496118_0083771 3300048921 Bacteria 2228
297 Ga0496118_0319003 3300048921 Bacteria 844
298 Ga0496119_0000057 3300048922 Bacteria 173746
299 Ga0496119_0004885 3300048922 Bacteria 13122
300 Ga0496119_0069714 3300048922 Bacteria 2065
301 Ga0496119_0071073 3300048922 Bacteria 2039
302 Ga0496119_0118272 3300048922 Bacteria 1460
303 Ga0496119_0308736 3300048922 Bacteria 777
304 Ga0496120_0001494 3300048923 Bacteria 27686
305 Ga0496120_0001989 3300048923 Bacteria 22251
306 Ga0496120_0084705 3300048923 Bacteria 1708
307 Ga0496120_0298371 3300048923 Bacteria 739
308 Ga0496121_0009809 3300048924 Bacteria 10937
309 Ga0496121_0056676 3300048924 Bacteria 3252
310 Ga0496121_0066374 3300048924 Bacteria 2930
311 Ga0496121_0082778 3300048924 Bacteria 2535
312 Ga0496121_0240424 3300048924 Bacteria 1262
313 Ga0496122_0000547 3300048925 Bacteria 77855
314 Ga0496122_0000723 3300048925 Bacteria 64694
315 Ga0496122_0000961 3300048925 Bacteria 51914
316 Ga0496122_0003240 3300048925 Bacteria 21620
317 Ga0496122_0004286 3300048925 Bacteria 17872
318 Ga0496122_0023981 3300048925 Bacteria 5355
319 Ga0496122_0041241 3300048925 Bacteria 3653
320 Ga0496122_0056950 3300048925 Bacteria 2908
321 Ga0496122_0137285 3300048925 Bacteria 1538
322 Ga0496123_0000315 3300048926 Bacteria 92845
323 Ga0496123_0000415 3300048926 Bacteria 77849
324 Ga0496123_0002654 3300048926 Bacteria 21620
325 Ga0496123_0002968 3300048926 Bacteria 19751
326 Ga0496123_0003000 3300048926 Bacteria 19520
327 Ga0496123_0005088 3300048926 Bacteria 13430
328 Ga0496123_0012249 3300048926 Bacteria 7332
329 Ga0496123_0018675 3300048926 Bacteria 5498
330 Ga0496123_0036360 3300048926 Bacteria 3494
331 Ga0496123_0055492 3300048926 Bacteria 2599
332 Ga0496124_0000593 3300048927 Bacteria 61027
333 Ga0496124_0002572 3300048927 Bacteria 23517
334 Ga0496124_0007300 3300048927 Bacteria 11788
335 Ga0496124_0008466 3300048927 Bacteria 10751
336 Ga0496124_0019020 3300048927 Bacteria 6410
337 Ga0496124_0143546 3300048927 Bacteria 1881
338 Ga0496124_0169551 3300048927 Bacteria 1692
339 Ga0496124_0327212 3300048927 Bacteria 1094
340 Ga0496124_0435980 3300048927 Bacteria 898
341 Ga0496124_0442815 3300048927 Bacteria 888
342 Ga0496124_0752490 3300048927 Bacteria 610
343 Ga0496125_0002465 3300048928 Bacteria 24034
344 Ga0496125_0002985 3300048928 Bacteria 21235
345 Ga0496125_0003995 3300048928 Bacteria 17343
346 Ga0496125_0006409 3300048928 Bacteria 12730
347 Ga0496125_0018047 3300048928 Bacteria 6707
348 Ga0496125_0149043 3300048928 Bacteria 1611
349 Ga0496125_0392056 3300048928 Bacteria 815
350 Ga0496125_0720369 3300048928 Bacteria 527
351 Ga0496126_0000028 3300048929 Bacteria 394082
352 Ga0496126_0000119 3300048929 Bacteria 184211
353 Ga0496126_0005810 3300048929 Bacteria 13947
354 Ga0496126_0009698 3300048929 Bacteria 10198
355 Ga0496126_0010107 3300048929 Bacteria 9953
356 Ga0496126_0012144 3300048929 Bacteria 8840
357 Ga0496126_0156996 3300048929 Bacteria 1946
358 Ga0496126_0670414 3300048929 Bacteria 809
359 Ga0495678_009431 3300049459 Bacteria 4830
360 Ga0495682_0000001 3300049460 Bacteria 1559116
361 Ga0495682_0013165 3300049460 Bacteria 3154
362 nmdc:mga00v17_209079_c1 3300050491 Bacteria 1262
363 nmdc:mga00v17_639274_c1 3300050491 Bacteria 685
364 nmdc:mga0yw44_460185_c1 3300050492 Bacteria 862
365 nmdc:mga06z11_200269_c1 3300050494 Bacteria 1159
366 nmdc:mga07m45_548335_c1 3300050496 Bacteria 669
367 nmdc:mga0sz30_402065_c1 3300050516 Bacteria 613
368 Ga0500641_0027896 3300053096 Bacteria 2201
369 Ga0500562_033795 3300053108 Bacteria 1352
370 Ga0500572_125558 3300053111 Bacteria 832
371 Ga0500618_000723 3300053125 Bacteria 18898
372 Ga0500621_000003 3300053126 Bacteria 596975
373 Ga0500655_028555 3300053133 Bacteria 1068
374 Ga0500658_0125907 3300053134 Bacteria 1139
375 Ga0500559_0000663 3300053136 Bacteria 23050
376 Ga0500559_0050188 3300053136 Bacteria 1840
377 Ga0500568_0054424 3300053139 Bacteria 1565
378 Ga0500573_0245942 3300053140 Bacteria 924
379 Ga0500604_0007493 3300053151 Bacteria 2891
380 Ga0500616_0010295 3300053153 Bacteria 5604
381 Ga0500616_0011912 3300053153 Bacteria 5111
382 Ga0500622_0194635 3300053156 Bacteria 926
383 Ga0500622_0394948 3300053156 Bacteria 563
384 Ga0500627_0162102 3300053158 Bacteria 1009
385 Ga0500661_000482 3300055283 Bacteria 7373
386 2510131741 2510065019 Bacteria 6903379
387 2513571319 2513237084 Bacteria 7231967
388 2515110685 2515075009 Bacteria 7288508
389 2599724068 2599185236 Bacteria 6875203
390 2600225226 2599185359 Bacteria 4772316
391 2601534330 2600255256 Bacteria 5597742
392 2601538891 2600255257 Bacteria 5597196
393 2601612336 2600255279 Bacteria 5605316
394 2601749248 2600255308 Bacteria 5611129
395 2601757240 2600255310 Bacteria 5600903
396 2601762159 2600255311 Bacteria 5598766
397 2603639589 2602042046 Bacteria 5483348
398 2609913655 2609459761 Bacteria 5513740
399 2643858078 2643221568 Bacteria 5187270
400 2644238331 2643221643 Bacteria 5749658
401 2793280900 2791355253 Bacteria 5171699
402 2793405627 2791355275 Bacteria 4429597
403 2808989989 2808606387 Bacteria 5697198
404 2813726878 2811995292 Bacteria 5303342
405 2814694248 2814123068 Bacteria 5687681
406 2819556986 2818991439 Bacteria 6907412
407 2819612412 2818991448 Bacteria 6772224
408 2838740201 2838736955 Bacteria 5760694
409 2841843674 2841840854 Bacteria 5761912
410 2842143394 2842140634 Bacteria 5759631
411 2844536421 2844533157 Bacteria 7517899
412 2854916991 2854916844 Bacteria 5725939
413 2861694533 2861691609 Bacteria 5628931
414 2894819230 2894817345 Bacteria 4892941
415 2902407490 2902405164 Bacteria 6784948
416 2909046993 2909042592 Bacteria 6499737
417 2919169950 2919166419 Bacteria 4952238
418 2919454868 2919450847 Bacteria 5631160
419 2919455704 2919450847 Bacteria 5631160
420 2928529468 2928526807 Bacteria 4760224
421 2933598574 2933594066 Bacteria 5594265
422 2936368677 2936367885 Bacteria 7324495
423 2936379415 2936375103 Bacteria 6652732
424 2945878084 2945874760 Bacteria 5527237
425 2954012549 2954011201 Bacteria 4762601
426 2978972397 2978969890 Bacteria 5400756
427 2979101969 2979100975 Bacteria 5423623
428 2984510094 2984509177 Bacteria 5274802
429 2984519205 2984518228 Bacteria 5277463
430 2984538435 2984537506 Bacteria 5277481
431 2984568597 2984564862 Bacteria 4339992
432 2984590644 2984587000 Bacteria 5263363
433 2984605156 2984601300 Bacteria 5455244
434 8005377184 8005376324 Bacteria 6590079
435 8005461328 8005460587 Bacteria 7157962
436 8005651104 8005645114 Bacteria 6950293
437 8005689628 8005688590 Bacteria 6610080
438 8024482408 8024479707 Bacteria 6954785
439 8045865686 8045864390 Bacteria 5043873
440 8045867117 8045864390 Bacteria 5043873
441 8054008690 8054002106 Bacteria 7987183
442 Ga0495591_001677
443 RicEn_C977
444 SwRhRL2b_contig_2193616
445 JGI25152J39213_1001389
446 JGI25150J39212_1001570
447 JGI25151J46595_10000221
448 JGI25151J46595_10000625
449 JGI25151J46595_10029620
450 JGI25153J46596_10041620
451 rootH1_10108472
452 rootL2_10092313
453 Ga0055526_1014593
454 Ga0055536_1000224
455 Ga0055536_1004451
456 Ga0055530_10000341
457 Ga0055530_10013196
458 Ga0055540_1005128
459 Ga0055531_10000442
460 Ga0055531_10008650
461 Ga0055531_10011338
462 Ga0055531_10028434
463 Ga0058692_1000038
464 Ga0058692_1002560
465 Ga0058692_1044335
466 Ga0058692_1049888
467 Ga0055543_1028057
468 Ga0065165_1003388
469 Ga0065165_1007581
470 Ga0065165_1045082
471 Ga0065165_1103145
472 Ga0065704_10070504
473 Ga0065704_10100287
474 Ga0070690_100231154
475 Ga0070670_100000186
476 Ga0070670_100000287
477 Ga0070670_100030311
478 Ga0070666_10080849
479 Ga0070660_100067857
480 Ga0070668_100004048
481 Ga0070668_100017255
482 Ga0070668_100033848
483 Ga0070669_100000082
484 Ga0070669_100004366
485 Ga0070669_100137571
486 Ga0070669_100593620
487 Ga0070669_101293382
488 Ga0070671_100000968
489 Ga0070671_100001230
490 Ga0070671_100023904
491 Ga0070671_100744174
492 Ga0070667_100005604
493 Ga0070667_100142470
494 Ga0070710_10444953
495 Ga0070665_100000498
496 Ga0070665_100154343
497 Ga0070665_100227891
498 Ga0070665_100238256
499 Ga0068857_100183893
500 Ga0068854_100117507
501 Ga0068852_100964144
502 Ga0068863_100002690
503 Ga0068860_100043227
504 Ga0068862_100008200
505 Ga0068862_100056855
506 Ga0068862_100273630
507 Ga0075365_10178320
508 Ga0075365_10723136
509 Ga0075364_10193098
510 Ga0075364_10718592
511 Ga0075367_10728069
512 Ga0075370_10103989
513 Ga0075370_10413729
514 Ga0099826_10000081
515 Ga0105251_10000354
516 Ga0105244_10000835
517 Ga0105250_10024775
518 Ga0105240_10771720
519 Ga0105247_10540042
520 Ga0105241_10157111
521 Ga0105248_10007007
522 Ga0105248_10061413
523 Ga0105237_10001763
524 Ga0105237_10009200
525 Ga0105238_10215878
526 Ga0105238_12739982
527 Ga0105249_10038171
528 Ga0105239_11367481
529 Ga0157373_10023939
530 Ga0157373_10025014
531 Ga0157373_10087932
532 Ga0157373_10400359
533 Ga0157371_10003468
534 Ga0157371_10003988
535 Ga0157370_10044036
536 Ga0157369_10033197
537 Ga0157369_10078158
538 Ga0157369_10152659
539 Ga0163162_10005028
540 Ga0163162_10055212
541 Ga0163162_10687899
542 Ga0157372_10056716
543 Ga0157372_10708395
544 Ga0182006_1000524
545 Ga0213876_10000114
546 Ga0213876_10476225
547 Ga0209672_111341
548 Ga0209437_128829
549 Ga0207425_1001146
550 Ga0207425_1011455
551 Ga0207425_1051236
552 Ga0209148_1006267
553 Ga0209129_1000182
554 Ga0209129_1001654
555 Ga0209130_1010173
556 Ga0209130_1020015
557 Ga0209676_1000136
558 Ga0209676_1000230
559 Ga0209676_1003367
560 Ga0209025_1000225
561 Ga0209025_1000374
562 Ga0209025_1000461
563 Ga0209025_1031609
564 Ga0209758_1007624
565 Ga0209758_1038249
566 Ga0209050_1000233
567 Ga0209050_1000238
568 Ga0209050_1004387
569 Ga0209050_1009252
570 Ga0207426_1005756
571 Ga0209051_1004695
572 Ga0209051_1008674
573 Ga0209051_1089596
574 Ga0209257_1000142
575 Ga0209257_1000291
576 Ga0209257_1000477
577 Ga0209257_1004069
578 Ga0209257_1022615
579 Ga0209257_1078399
580 Ga0207696_1004091
581 Ga0207655_1007098
582 Ga0207655_1226894
583 Ga0207713_1002249
584 Ga0207680_10048697
585 Ga0207705_10657946
586 Ga0207654_10115310
587 Ga0207695_10549587
588 Ga0207671_10000812
589 Ga0207671_10004853
590 Ga0207657_10308780
591 Ga0207681_10000109
592 Ga0207681_10000302
593 Ga0207681_10504030
594 Ga0207681_10531051
595 Ga0207681_11223322
596 Ga0207694_10445826
597 Ga0207694_10472327
598 Ga0207650_10000437
599 Ga0207650_10004065
600 Ga0207650_10365572
601 Ga0207644_10000203
602 Ga0207644_10000626
603 Ga0207644_10025594
604 Ga0207644_10667992
605 Ga0207711_10005308
606 Ga0207711_10411897
607 Ga0207712_10515466
608 Ga0207668_10016370
609 Ga0207668_10125418
610 Ga0207640_10105224
611 Ga0207640_10120917
612 Ga0207658_10001763
613 Ga0207658_10006690
614 Ga0207641_10005866
615 Ga0207674_10132142
616 Ga0207698_10782949
617 Ga0209371_1000003
618 Ga0209371_1000093
619 Ga0209371_1000101
620 Ga0209371_1001365
621 Ga0209371_1004369
622 Ga0209371_1004940
623 Ga0209371_1006679
624 Ga0209371_1009577
625 Ga0209371_1038101
626 Ga0209282_1002674
627 Ga0268266_10000229
628 Ga0268266_10006189
629 Ga0268266_10021013
630 Ga0268265_10007842
631 Ga0268265_10170492
632 Ga0268265_10813619
633 Ga0268264_10012726
634 Ga0307515_10006781
635 Ga0268256_1000004
636 Ga0268256_1000029
637 Ga0268256_1000081
638 Ga0268256_1003380
639 Ga0268256_1004735
640 Ga0268256_1006761
641 Ga0268256_1010176
642 Ga0268256_1043339
643 Ga0307413_10940914
644 Ga0307410_10935878
645 Ga0307412_10002041
646 Ga0307412_10803377
647 Ga0307411_12038358
648 Ga0395905_1074137
649 Ga0436365_0454988
650 Ga0436365_1249181
651 Ga0436365_1794050
652 Ga0439438_000005
653 Ga0439438_006175
654 Ga0439438_008868
655 Ga0439447_000772
656 Ga0439447_110622
657 Ga0451807_0911804
658 Ga0451839_0749399
659 Ga0451849_0563160
660 Ga0451843_0160846
661 Ga0451855_0022283
662 Ga0439432_017140
663 Ga0439452_000002
664 Ga0439463_000199
665 Ga0466968_0001795
666 Ga0466960_0075767
667 Ga0495627_000132
668 Ga0495638_0000131
669 Ga0495638_0011604
670 Ga0495638_0046386
671 Ga0495650_0000026
672 Ga0495605_0028665
673 Ga0495584_0548148
674 Ga0495596_0010166
675 Ga0495607_0130349
676 Ga0495607_0469319
677 Ga0495583_0000005
678 Ga0495606_0000816
679 Ga0495610_0136849
680 Ga0495616_0421549
681 Ga0495643_0001560
682 Ga0495643_0175497
683 Ga0495644_0013000
684 Ga0495648_0002689
685 Ga0495648_0013092
686 Ga0495648_0033949
687 Ga0495648_0069880
688 Ga0495663_0374834
689 Ga0495654_0000659
690 Ga0495609_0016154
691 Ga0495609_0429899
692 Ga0495668_0050638
693 Ga0495588_0120164
694 Ga0495671_0016810
695 Ga0495660_0000029
696 Ga0495672_0000001
697 Ga0495672_0316315
698 Ga0495676_0368395
699 Ga0495683_0013924
700 Ga0495673_0000648
701 Ga0495673_0106476
702 Ga0495686_0001612
703 Ga0496100_0047319
704 Ga0496101_0033881
705 Ga0496101_0097129
706 Ga0496102_0000615
707 Ga0496102_0093089
708 Ga0496103_0000081
709 Ga0496103_0085184
710 Ga0496104_0000081
711 Ga0496104_0007642
712 Ga0496105_0000034
713 Ga0496105_0006265
714 Ga0496106_0018573
715 Ga0496107_0015014
716 Ga0496110_0398766
717 Ga0496110_1298001
718 Ga0496111_0365994
719 Ga0496112_0105737
720 Ga0496113_0000101
721 Ga0496113_0038975
722 Ga0496115_0269842
723 Ga0496116_0000097
724 Ga0496116_0018103
725 Ga0496116_0044141
726 Ga0496116_0055110
727 Ga0496116_0081383
728 Ga0496117_0000146
729 Ga0496117_0000411
730 Ga0496117_0050657
731 Ga0496117_0050751
732 Ga0496117_0143936
733 Ga0496117_0177170
734 Ga0496118_0002700
735 Ga0496118_0010867
736 Ga0496118_0059147
737 Ga0496118_0083771
738 Ga0496118_0319003
739 Ga0496119_0000057
740 Ga0496119_0004885
741 Ga0496119_0069714
742 Ga0496119_0071073
743 Ga0496119_0118272
744 Ga0496119_0308736
745 Ga0496120_0001494
746 Ga0496120_0001989
747 Ga0496120_0084705
748 Ga0496120_0298371
749 Ga0496121_0009809
750 Ga0496121_0056676
751 Ga0496121_0066374
752 Ga0496121_0082778
753 Ga0496121_0240424
754 Ga0496122_0000547
755 Ga0496122_0000723
756 Ga0496122_0000961
757 Ga0496122_0003240
758 Ga0496122_0004286
759 Ga0496122_0023981
760 Ga0496122_0041241
761 Ga0496122_0056950
762 Ga0496122_0137285
763 Ga0496123_0000315
764 Ga0496123_0000415
765 Ga0496123_0002654
766 Ga0496123_0002968
767 Ga0496123_0003000
768 Ga0496123_0005088
769 Ga0496123_0012249
770 Ga0496123_0018675
771 Ga0496123_0036360
772 Ga0496123_0055492
773 Ga0496124_0000593
774 Ga0496124_0002572
775 Ga0496124_0007300
776 Ga0496124_0008466
777 Ga0496124_0019020
778 Ga0496124_0143546
779 Ga0496124_0169551
780 Ga0496124_0327212
781 Ga0496124_0435980
782 Ga0496124_0442815
783 Ga0496124_0752490
784 Ga0496125_0002465
785 Ga0496125_0002985
786 Ga0496125_0003995
787 Ga0496125_0006409
788 Ga0496125_0018047
789 Ga0496125_0149043
790 Ga0496125_0392056
791 Ga0496125_0720369
792 Ga0496126_0000028
793 Ga0496126_0000119
794 Ga0496126_0005810
795 Ga0496126_0009698
796 Ga0496126_0010107
797 Ga0496126_0012144
798 Ga0496126_0156996
799 Ga0496126_0670414
800 Ga0495678_009431
801 Ga0495682_0000001
802 Ga0495682_0013165
803 nmdc:mga00v17_209079_c1
804 nmdc:mga00v17_639274_c1
805 nmdc:mga0yw44_460185_c1
806 nmdc:mga06z11_200269_c1
807 nmdc:mga07m45_548335_c1
808 nmdc:mga0sz30_402065_c1
809 Ga0500641_0027896
810 Ga0500562_033795
811 Ga0500572_125558
812 Ga0500618_000723
813 Ga0500621_000003
814 Ga0500655_028555
815 Ga0500658_0125907
816 Ga0500559_0000663
817 Ga0500559_0050188
818 Ga0500568_0054424
819 Ga0500573_0245942
820 Ga0500604_0007493
821 Ga0500616_0010295
822 Ga0500616_0011912
823 Ga0500622_0194635
824 Ga0500622_0394948
825 Ga0500627_0162102
826 Ga0500661_000482
827 2510131741
828 2513571319
829 2515110685
830 2599724068
831 2600225226
832 2601534330
833 2601538891
834 2601612336
835 2601749248
836 2601757240
837 2601762159
838 2603639589
839 2609913655
840 2643858078
841 2644238331
842 2793280900
843 2793405627
844 2808989989
845 2813726878
846 2814694248
847 2819556986
848 2819612412
849 2838740201
850 2841843674
851 2842143394
852 2844536421
853 2854916991
854 2861694533
855 2894819230
856 2902407490
857 2909046993
858 2919169950
859 2919454868
860 2919455704
861 2928529468
862 2933598574
863 2936368677
864 2936379415
865 2945878084
866 2954012549
867 2978972397
868 2979101969
869 2984510094
870 2984519205
871 2984538435
872 2984568597
873 2984590644
874 2984605156
875 8005377184
876 8005461328
877 8005651104
878 8005689628
879 8024482408
880 8045865686
881 8045867117
882 8054008690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

27

116

0.97

PF01047

MarR

MarR family

35

81

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9221 14 105
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9034 16 106
5x11-assembly4.cif.gz_G crystal structure of bacillus subtilis padr in complex with operator dna 0.897 24 96
5x11-assembly4.cif.gz_H crystal structure of bacillus subtilis padr in complex with operator dna 0.8904 28 96
3df8-assembly1.cif.gz_A-2 the crystal structure of a possible hxlr family transcriptional factor from thermoplasma volcanium gss1 0.8806 18 108
ID Description Score Start End Superfamily
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8952 20 87 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.895 24 85 1.10.10.10
af_P0ACN2_1_125_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8859 15 116 1.10.10.10
af_Q9VD25_2_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8826 29 86 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8826 29 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2S4LJ82-F1-model_v4 HxlR family transcriptional regulator 0.9701 7 129 GO:0003677
AF-A0A2E7F638-F1-model_v4 Transcriptional regulator 0.9691 14 120 GO:0003677
AF-A0A0X8JDR8-F1-model_v4 Cinnamoyl ester hydrolase 0.9688 16 112 GO:0003677
GO:0016787
AF-G8S0R7-F1-model_v4 YybR-like uncharacterized HTH-type transcriptional regulator 0.9677 16 109 GO:0003677
AF-A0A1G5UHB7-F1-model_v4 Transcriptional regulator, HxlR family 0.9663 6 123 GO:0003677

Map