F444751

General Info

Members Datasets Scaffolds Average Seq Length
441 233 882 268

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0385786|Ga0496108_0385786_210_1031
Length 273
Sequence MGDKSIRDVERIGEGEATKWDPGFTEQVKNLIGPLIKRYFRAEVKGLDAIPSAGGALLVSNHSGGMFTPDVLVFAPAFYHKFGFDRPVYTLAHYALFAGPLGDWLRRVGVIEANRENAAKALRSGALVLVFPGGDYDSYRPTFENKIDFAGRTGYVRTAIESEVPIVPMVSIGAQESQLFLTRGNWLAKRLGLQRLRAEILPVTFGFPFGLSVFFPPNVPLPTKIVTQVLDPIDVVKEFGEDPDVDAVDEHVREVMQTALDDLAKKRRFPILG

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
228 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
229 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
230 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
231 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
232 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
233 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0.23
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 0.23
Rhizoplane 10.66
Rhizosphere 69.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0385786 3300048911 Bacteria 1223
2 JGI24737J22298_10086576 3300001990 Bacteria 931
3 JGI24748J21848_1007397 3300002074 Bacteria 1287
4 JGI24744J21845_10000056 3300002077 Bacteria 13378
5 JGI24742J22300_10000298 3300002244 Bacteria 7368
6 Ga0070676_10009360 3300005328 Bacteria 5295
7 Ga0070683_100573764 3300005329 Bacteria 1079
8 Ga0070690_100138849 3300005330 Bacteria 1648
9 Ga0068869_100026751 3300005334 Bacteria 4017
10 Ga0068869_100031639 3300005334 Bacteria 3722
11 Ga0070680_100189390 3300005336 Bacteria 1733
12 Ga0070682_100002572 3300005337 Bacteria 10014
13 Ga0070682_100060269 3300005337 Bacteria 2400
14 Ga0068868_100003487 3300005338 Bacteria 10945
15 Ga0068868_100060928 3300005338 Bacteria 2989
16 Ga0070660_100667576 3300005339 Bacteria 871
17 Ga0070689_100092810 3300005340 Bacteria 2382
18 Ga0070692_10206782 3300005345 Bacteria 1153
19 Ga0070668_100001188 3300005347 Bacteria 18456
20 Ga0070668_100060067 3300005347 Bacteria 2943
21 Ga0070669_100000597 3300005353 Bacteria 26784
22 Ga0070669_100008771 3300005353 Bacteria 7214
23 Ga0070669_100208492 3300005353 Bacteria 1540
24 Ga0070671_100035331 3300005355 Bacteria 4140
25 Ga0070674_100043807 3300005356 Bacteria 3046
26 Ga0070688_100094295 3300005365 Bacteria 1962
27 Ga0070659_100010064 3300005366 Bacteria 6962
28 Ga0070667_100000388 3300005367 Bacteria 47627
29 Ga0070667_100009690 3300005367 Bacteria 7982
30 Ga0070667_100460440 3300005367 Bacteria 1163
31 Ga0070714_100056402 3300005435 Bacteria 3360
32 Ga0070710_10002861 3300005437 Bacteria 8222
33 Ga0070711_100015566 3300005439 Bacteria 4814
34 Ga0070711_100050470 3300005439 Bacteria 2853
35 Ga0070711_100455780 3300005439 Bacteria 1048
36 Ga0070705_100003517 3300005440 Bacteria 7666
37 Ga0070700_100001498 3300005441 Bacteria 11628
38 Ga0070694_100294658 3300005444 Bacteria 1241
39 Ga0070678_100001466 3300005456 Bacteria 12574
40 Ga0070678_100085628 3300005456 Bacteria 2402
41 Ga0070678_100124376 3300005456 Bacteria 2039
42 Ga0070678_100521211 3300005456 Bacteria 1051
43 Ga0068867_100007367 3300005459 Bacteria 7784
44 Ga0070685_10040055 3300005466 Bacteria 2665
45 Ga0070684_100095799 3300005535 Bacteria 2645
46 Ga0070684_100403302 3300005535 Bacteria 1261
47 Ga0068853_100003962 3300005539 Bacteria 11376
48 Ga0070672_100310512 3300005543 Bacteria 1338
49 Ga0070695_100003335 3300005545 Bacteria 9388
50 Ga0070696_100294219 3300005546 Bacteria 1241
51 Ga0070696_100458033 3300005546 Bacteria 1008
52 Ga0070693_100043486 3300005547 Bacteria 2537
53 Ga0070693_100256341 3300005547 Bacteria 1162
54 Ga0070665_100004946 3300005548 Bacteria 13817
55 Ga0070665_100006513 3300005548 Bacteria 11871
56 Ga0070665_100084282 3300005548 Bacteria 3183
57 Ga0070704_100002412 3300005549 Bacteria 10497
58 Ga0070704_100342416 3300005549 Bacteria 1259
59 Ga0068854_100002546 3300005578 Bacteria 11288
60 Ga0068856_100134700 3300005614 Bacteria 2476
61 Ga0070702_100013152 3300005615 Bacteria 4171
62 Ga0070702_100034359 3300005615 Bacteria 2794
63 Ga0070702_100174269 3300005615 Bacteria 1402
64 Ga0070702_100266012 3300005615 Bacteria 1170
65 Ga0068859_100000276 3300005617 Bacteria 51118
66 Ga0068859_100008624 3300005617 Bacteria 10300
67 Ga0068864_100039998 3300005618 Bacteria 4010
68 Ga0068866_10001276 3300005718 Bacteria 10909
69 Ga0068866_10207910 3300005718 Bacteria 1173
70 Ga0068861_100000307 3300005719 Bacteria 27379
71 Ga0068861_100080787 3300005719 Bacteria 2544
72 Ga0068861_100608388 3300005719 Bacteria 1004
73 Ga0068863_100000431 3300005841 Bacteria 42342
74 Ga0068863_100090030 3300005841 Bacteria 2910
75 Ga0068863_100119240 3300005841 Bacteria 2515
76 Ga0068858_100000440 3300005842 Bacteria 43437
77 Ga0068858_100058958 3300005842 Bacteria 3548
78 Ga0068860_100000232 3300005843 Bacteria 85501
79 Ga0068860_100007260 3300005843 Bacteria 11082
80 Ga0068860_100274904 3300005843 Bacteria 1645
81 Ga0068862_100000055 3300005844 Bacteria 142386
82 Ga0068862_100002080 3300005844 Bacteria 18047
83 Ga0081455_10096905 3300005937 Bacteria 2378
84 Ga0081455_10139110 3300005937 Bacteria 1888
85 Ga0075365_10002978 3300006038 Bacteria 8569
86 Ga0075365_10003735 3300006038 Bacteria 7920
87 Ga0075365_10034408 3300006038 Bacteria 3271
88 Ga0075365_10162682 3300006038 Bacteria 1556
89 Ga0075363_100000301 3300006048 Bacteria 14480
90 Ga0075363_100002272 3300006048 Bacteria 7789
91 Ga0075363_100003512 3300006048 Bacteria 6682
92 Ga0075363_100005175 3300006048 Bacteria 5772
93 Ga0075363_100005377 3300006048 Bacteria 5690
94 Ga0075363_100010832 3300006048 Bacteria 4348
95 Ga0075363_100094913 3300006048 Bacteria 1645
96 Ga0075363_100104820 3300006048 Bacteria 1568
97 Ga0075363_100264509 3300006048 Bacteria 993
98 Ga0075364_10003925 3300006051 Bacteria 8530
99 Ga0075364_10009589 3300006051 Bacteria 5814
100 Ga0075364_10141109 3300006051 Bacteria 1621
101 Ga0070715_10028473 3300006163 Bacteria 2241
102 Ga0070715_10048157 3300006163 Bacteria 1821
103 Ga0070716_100003667 3300006173 Bacteria 7269
104 Ga0070716_100004132 3300006173 Bacteria 6889
105 Ga0070712_100003774 3300006175 Bacteria 9331
106 Ga0075367_10004632 3300006178 Bacteria 6736
107 Ga0075367_10084765 3300006178 Bacteria 1922
108 Ga0075369_10006868 3300006186 Bacteria 4321
109 Ga0075369_10016492 3300006186 Bacteria 2982
110 Ga0075369_10081999 3300006186 Bacteria 1431
111 Ga0075370_10000890 3300006353 Bacteria 12225
112 Ga0075370_10004551 3300006353 Bacteria 6754
113 Ga0075370_10014001 3300006353 Bacteria 4271
114 Ga0075370_10083473 3300006353 Bacteria 1838
115 Ga0075428_100006189 3300006844 Bacteria 13315
116 Ga0075430_100117388 3300006846 Bacteria 2218
117 Ga0068865_100001579 3300006881 Bacteria 13317
118 Ga0068865_100155609 3300006881 Bacteria 1738
119 Ga0097620_100000276 3300006931 Bacteria 51118
120 Ga0097620_100008624 3300006931 Bacteria 10300
121 Ga0105250_10058617 3300009092 Bacteria 1545
122 Ga0105245_10002313 3300009098 Bacteria 17248
123 Ga0105245_10022670 3300009098 Bacteria 5511
124 Ga0105245_10062155 3300009098 Bacteria 3369
125 Ga0105247_10000029 3300009101 Bacteria 198763
126 Ga0105247_10000584 3300009101 Bacteria 29668
127 Ga0105247_10014653 3300009101 Bacteria 4700
128 Ga0105243_10001688 3300009148 Bacteria 19021
129 Ga0105243_10135388 3300009148 Bacteria 2095
130 Ga0105241_10014332 3300009174 Bacteria 5804
131 Ga0105241_10195166 3300009174 Bacteria 1687
132 Ga0105242_10000923 3300009176 Bacteria 22835
133 Ga0105242_10070058 3300009176 Bacteria 2906
134 Ga0105242_10146632 3300009176 Bacteria 2054
135 Ga0105248_10000136 3300009177 Bacteria 85507
136 Ga0105248_10002643 3300009177 Bacteria 19910
137 Ga0105248_10089746 3300009177 Bacteria 3460
138 Ga0105248_10182458 3300009177 Bacteria 2365
139 Ga0105237_10024507 3300009545 Bacteria 6172
140 Ga0105238_10407264 3300009551 Bacteria 1354
141 Ga0105249_10000077 3300009553 Bacteria 141905
142 Ga0105249_10003484 3300009553 Bacteria 13633
143 Ga0105249_10057305 3300009553 Bacteria 3569
144 Ga0105249_10060875 3300009553 Bacteria 3464
145 Ga0105239_10082222 3300010375 Bacteria 3546
146 Ga0105239_10131889 3300010375 Bacteria 2780
147 Ga0105239_10502591 3300010375 Bacteria 1378
148 Ga0105246_10114130 3300011119 Bacteria 1990
149 Ga0105246_10117230 3300011119 Bacteria 1967
150 Ga0105246_10628877 3300011119 Bacteria 931
151 Ga0157374_10007254 3300013296 Bacteria 9442
152 Ga0157378_10002579 3300013297 Bacteria 16129
153 Ga0157378_10060973 3300013297 Bacteria 3365
154 Ga0157378_10218295 3300013297 Bacteria 1812
155 Ga0163162_10002796 3300013306 Bacteria 16590
156 Ga0163162_10007824 3300013306 Bacteria 10420
157 Ga0157372_10000875 3300013307 Bacteria 32716
158 Ga0157375_10002649 3300013308 Bacteria 15501
159 Ga0157375_10200845 3300013308 Bacteria 2150
160 Ga0157375_10323995 3300013308 Bacteria 1706
161 Ga0163163_10108311 3300014325 Bacteria 2806
162 Ga0163163_10121163 3300014325 Bacteria 2650
163 Ga0163163_11066633 3300014325 Bacteria 871
164 Ga0157380_10000844 3300014326 Bacteria 19168
165 Ga0182008_10122575 3300014497 Bacteria 1292
166 Ga0157379_10003466 3300014968 Bacteria 13353
167 Ga0157379_10256439 3300014968 Bacteria 1588
168 Ga0163161_10001223 3300017792 Bacteria 19270
169 Ga0213876_10002900 3300021384 Bacteria 9943
170 Ga0213875_10015087 3300021388 Bacteria 3762
171 Ga0213875_10036418 3300021388 Bacteria 2320
172 Ga0213875_10082712 3300021388 Bacteria 1498
173 Ga0209051_1056992 3300025303 Bacteria 1255
174 Ga0207692_10002758 3300025898 Bacteria 6767
175 Ga0207642_10000230 3300025899 Bacteria 16535
176 Ga0207710_10000046 3300025900 Bacteria 198754
177 Ga0207688_10000208 3300025901 Bacteria 26121
178 Ga0207688_10049978 3300025901 Bacteria 2339
179 Ga0207647_10046619 3300025904 Bacteria 2700
180 Ga0207685_10002125 3300025905 Bacteria 4444
181 Ga0207685_10093368 3300025905 Bacteria 1272
182 Ga0207645_10022908 3300025907 Bacteria 4059
183 Ga0207693_10000614 3300025915 Bacteria 31922
184 Ga0207663_10049297 3300025916 Bacteria 2611
185 Ga0207657_10217863 3300025919 Bacteria 1530
186 Ga0207681_10000948 3300025923 Bacteria 18907
187 Ga0207681_10006923 3300025923 Bacteria 6957
188 Ga0207687_10007362 3300025927 Bacteria 7253
189 Ga0207687_10158328 3300025927 Bacteria 1735
190 Ga0207687_10368025 3300025927 Bacteria 1175
191 Ga0207644_10182382 3300025931 Bacteria 1646
192 Ga0207644_10653573 3300025931 Bacteria 875
193 Ga0207690_10020349 3300025932 Bacteria 4099
194 Ga0207706_10053669 3300025933 Bacteria 3558
195 Ga0207686_10004857 3300025934 Bacteria 7225
196 Ga0207686_10074112 3300025934 Bacteria 2199
197 Ga0207686_10104701 3300025934 Bacteria 1896
198 Ga0207709_10006644 3300025935 Bacteria 6490
199 Ga0207709_10106126 3300025935 Bacteria 1868
200 Ga0207670_10008584 3300025936 Bacteria 5775
201 Ga0207669_10010358 3300025937 Bacteria 4484
202 Ga0207704_10003738 3300025938 Bacteria 6927
203 Ga0207665_10002840 3300025939 Bacteria 11623
204 Ga0207665_10007811 3300025939 Bacteria 7059
205 Ga0207665_10086686 3300025939 Bacteria 2163
206 Ga0207691_10314124 3300025940 Bacteria 1344
207 Ga0207711_10000111 3300025941 Bacteria 85466
208 Ga0207711_10119968 3300025941 Bacteria 2347
209 Ga0207711_10130156 3300025941 Bacteria 2255
210 Ga0207689_10010719 3300025942 Bacteria 7887
211 Ga0207661_10689547 3300025944 Bacteria 939
212 Ga0207651_10172082 3300025960 Bacteria 1709
213 Ga0207712_10000017 3300025961 Bacteria 337943
214 Ga0207668_10022542 3300025972 Bacteria 4034
215 Ga0207668_10026222 3300025972 Bacteria 3781
216 Ga0207640_10044024 3300025981 Bacteria 2857
217 Ga0207658_10000016 3300025986 Bacteria 215618
218 Ga0207658_10020042 3300025986 Bacteria 4629
219 Ga0207658_10271092 3300025986 Bacteria 1451
220 Ga0207677_10015294 3300026023 Bacteria 4508
221 Ga0207703_10016881 3300026035 Bacteria 5694
222 Ga0207703_10057977 3300026035 Bacteria 3159
223 Ga0207703_10202926 3300026035 Bacteria 1763
224 Ga0207678_10003908 3300026067 Bacteria 13401
225 Ga0207678_10057320 3300026067 Bacteria 3352
226 Ga0207702_10280142 3300026078 Bacteria 1576
227 Ga0207641_10001756 3300026088 Bacteria 20884
228 Ga0207641_10008314 3300026088 Bacteria 8576
229 Ga0207641_10207975 3300026088 Bacteria 1808
230 Ga0207641_10444271 3300026088 Bacteria 1252
231 Ga0207648_10000112 3300026089 Bacteria 78746
232 Ga0207676_10016432 3300026095 Bacteria 5360
233 Ga0207676_10415952 3300026095 Bacteria 1260
234 Ga0207675_100000917 3300026118 Bacteria 29411
235 Ga0207675_100116948 3300026118 Bacteria 2520
236 Ga0207683_10000451 3300026121 Bacteria 38077
237 Ga0207683_10131193 3300026121 Bacteria 2254
238 Ga0207683_10150364 3300026121 Bacteria 2101
239 Ga0268266_10005455 3300028379 Bacteria 11851
240 Ga0268266_10010157 3300028379 Bacteria 8250
241 Ga0268265_10000067 3300028380 Bacteria 142389
242 Ga0268265_10006910 3300028380 Bacteria 7675
243 Ga0268265_10041932 3300028380 Bacteria 3392
244 Ga0268264_10000146 3300028381 Bacteria 165733
245 Ga0316576_10472212 3300031727 Bacteria 925
246 Ga0307413_10015591 3300031824 Bacteria 3901
247 Ga0307410_10009089 3300031852 Bacteria 5554
248 Ga0307409_100138476 3300031995 Bacteria 2093
249 Ga0307416_100034035 3300032002 Bacteria 3872
250 Ga0307416_100233677 3300032002 Bacteria 1775
251 Ga0307411_10059219 3300032005 Bacteria 2538
252 Ga0307415_100594449 3300032126 Bacteria 984
253 Ga0373943_0210186 3300035170 Bacteria 1080
254 Ga0373961_0024187 3300035241 Bacteria 1641
255 Ga0373931_0002988 3300035691 Bacteria 7550
256 Ga0373931_0067563 3300035691 Bacteria 1943
257 Ga0265778_014599 3300036457 Bacteria 930
258 Ga0436364_0166962 3300037853 Bacteria 6539
259 Ga0436364_0706017 3300037853 Bacteria 6620
260 Ga0436364_0907426 3300037853 Bacteria 2346
261 Ga0395901_0587284 3300038443 Bacteria 1125
262 Ga0436365_0271296 3300039437 Bacteria 39035
263 Ga0436365_0430385 3300039437 Bacteria 20042
264 Ga0436365_1685157 3300039437 Bacteria 17329
265 Ga0436365_1781365 3300039437 Bacteria 36167
266 Ga0436363_0005942 3300039450 Bacteria 3934
267 Ga0436363_1257506 3300039450 Bacteria 4178
268 Ga0439461_0004961 3300041410 Bacteria 2247
269 Ga0439466_0009445 3300041411 Bacteria 3643
270 Ga0439466_0038715 3300041411 Bacteria 1601
271 Ga0439465_0005630 3300041413 Bacteria 3990
272 Ga0439465_0005901 3300041413 Bacteria 3894
273 Ga0451853_1512470 3300041512 Bacteria 1256
274 Ga0439431_0025764 3300041997 Bacteria 1438
275 Ga0439442_004437 3300042002 Bacteria 2788
276 Ga0466969_0025918 3300044656 Bacteria 3011
277 Ga0466972_0182318 3300044658 Bacteria 984
278 Ga0466965_0103242 3300044683 Bacteria 1459
279 Ga0466966_0010057 3300044684 Bacteria 6271
280 Ga0466966_0019768 3300044684 Bacteria 4430
281 Ga0466966_0043857 3300044684 Bacteria 2865
282 Ga0466966_0066671 3300044684 Bacteria 2262
283 Ga0466961_0016900 3300044693 Bacteria 4688
284 Ga0466961_0017544 3300044693 Bacteria 4599
285 Ga0466961_0020608 3300044693 Bacteria 4243
286 Ga0466963_0010509 3300044694 Bacteria 5606
287 Ga0466963_0018937 3300044694 Bacteria 4311
288 Ga0466963_0335173 3300044694 Bacteria 1065
289 Ga0466963_0429218 3300044694 Bacteria 932
290 Ga0466971_0060527 3300044719 Bacteria 1711
291 Ga0466968_0006620 3300044735 Bacteria 4375
292 Ga0466968_0016883 3300044735 Bacteria 2910
293 Ga0466970_0008373 3300044765 Bacteria 5204
294 Ga0466970_0009540 3300044765 Bacteria 4908
295 Ga0466957_0022738 3300044842 Bacteria 3701
296 Ga0466957_0064590 3300044842 Bacteria 2252
297 Ga0466957_0333676 3300044842 Bacteria 1026
298 Ga0466960_0001146 3300044901 Bacteria 9511
299 Ga0466960_0004090 3300044901 Bacteria 5669
300 Ga0466960_0061109 3300044901 Bacteria 1849
301 Ga0466960_0225131 3300044901 Bacteria 1033
302 Ga0466959_0016228 3300045049 Bacteria 5437
303 Ga0466959_0100421 3300045049 Bacteria 2071
304 Ga0466959_0312413 3300045049 Bacteria 1075
305 Ga0466958_0001611 3300045836 Bacteria 10858
306 Ga0466958_0014906 3300045836 Bacteria 4444
307 Ga0466958_0026895 3300045836 Bacteria 3401
308 Ga0466967_0004425 3300045976 Bacteria 9470
309 Ga0466967_0039777 3300045976 Bacteria 4045
310 Ga0466967_0131491 3300045976 Bacteria 2324
311 Ga0466967_0204644 3300045976 Bacteria 1870
312 Ga0495629_0013469 3300046459 Bacteria 5898
313 Ga0495639_0040540 3300046475 Bacteria 2095
314 Ga0495662_0081425 3300046476 Bacteria 1574
315 Ga0495640_0044166 3300046533 Bacteria 3100
316 Ga0495667_0114901 3300046559 Bacteria 1739
317 Ga0495581_0036565 3300047315 Bacteria 2841
318 Ga0495672_0228035 3300047320 Bacteria 916
319 Ga0495676_0068711 3300047321 Bacteria 2736
320 Ga0495686_0035607 3300047472 Bacteria 3198
321 Ga0495686_0178961 3300047472 Bacteria 1230
322 Ga0496100_0005283 3300048903 Bacteria 6938
323 Ga0496100_0032895 3300048903 Bacteria 3239
324 Ga0496100_0412653 3300048903 Bacteria 1030
325 Ga0496101_0005556 3300048904 Bacteria 8047
326 Ga0496101_0009026 3300048904 Bacteria 6538
327 Ga0496101_0023436 3300048904 Bacteria 4265
328 Ga0496102_0000587 3300048905 Bacteria 38525
329 Ga0496102_0012278 3300048905 Bacteria 7408
330 Ga0496102_0026207 3300048905 Bacteria 5197
331 Ga0496102_0032917 3300048905 Bacteria 4659
332 Ga0496102_0157975 3300048905 Bacteria 2132
333 Ga0496102_0177824 3300048905 Bacteria 2004
334 Ga0496103_0001354 3300048906 Bacteria 16543
335 Ga0496104_0011430 3300048907 Bacteria 7952
336 Ga0496104_0033199 3300048907 Bacteria 4806
337 Ga0496104_0228536 3300048907 Bacteria 1773
338 Ga0496105_0023567 3300048908 Bacteria 4994
339 Ga0496105_0153779 3300048908 Bacteria 1890
340 Ga0496106_0005094 3300048909 Bacteria 9728
341 Ga0496106_0008195 3300048909 Bacteria 7723
342 Ga0496106_0327760 3300048909 Bacteria 1229
343 Ga0496107_0001833 3300048910 Bacteria 13417
344 Ga0496107_0003385 3300048910 Bacteria 10664
345 Ga0496107_0059042 3300048910 Bacteria 2775
346 Ga0496107_0081961 3300048910 Bacteria 2353
347 Ga0496108_0006048 3300048911 Bacteria 9795
348 Ga0496108_0008335 3300048911 Bacteria 8407
349 Ga0496108_0025696 3300048911 Bacteria 4855
350 Ga0496108_0408003 3300048911 Bacteria 1187
351 Ga0496109_0016623 3300048912 Bacteria 6435
352 Ga0496109_0032804 3300048912 Bacteria 4670
353 Ga0496109_0347475 3300048912 Bacteria 1401
354 Ga0496110_0036695 3300048913 Bacteria 4258
355 Ga0496110_0074772 3300048913 Bacteria 3010
356 Ga0496110_0077224 3300048913 Bacteria 2962
357 Ga0496111_0717527 3300048914 Bacteria 726
358 Ga0496112_0001686 3300048915 Bacteria 17213
359 Ga0496112_0024360 3300048915 Bacteria 5793
360 Ga0496112_0109913 3300048915 Bacteria 2727
361 Ga0496112_0128754 3300048915 Bacteria 2502
362 Ga0496113_0349396 3300048916 Bacteria 1186
363 Ga0496113_0354433 3300048916 Bacteria 1177
364 Ga0496114_0003685 3300048917 Bacteria 11785
365 Ga0496114_0004362 3300048917 Bacteria 10953
366 Ga0496114_0768830 3300048917 Bacteria 841
367 Ga0496115_0188814 3300048918 Bacteria 1703
368 Ga0496116_0027247 3300048919 Bacteria 4163
369 Ga0496117_0005770 3300048920 Bacteria 12857
370 Ga0496118_0000272 3300048921 Bacteria 91016
371 Ga0496118_0003575 3300048921 Bacteria 19367
372 Ga0496119_0001469 3300048922 Bacteria 28203
373 Ga0496120_0026118 3300048923 Bacteria 3611
374 Ga0496124_0215112 3300048927 Bacteria 1450
375 Ga0496126_0007764 3300048929 Bacteria 11691
376 Ga0496126_0097303 3300048929 Bacteria 2579
377 Ga0501032_0025311 3300049569 Bacteria 4092
378 Ga0501032_0027297 3300049569 Bacteria 3924
379 Ga0501033_0058994 3300049570 Bacteria 2834
380 Ga0501033_0066659 3300049570 Bacteria 2647
381 Ga0501034_0001406 3300049571 Bacteria 32322
382 Ga0501034_0025622 3300049571 Bacteria 6006
383 Ga0501034_0218076 3300049571 Bacteria 1861
384 Ga0501036_0056865 3300049572 Bacteria 3314
385 Ga0501037_0005160 3300049573 Bacteria 9505
386 Ga0501038_0317744 3300049574 Bacteria 1219
387 Ga0501039_0400500 3300049575 Bacteria 1078
388 Ga0501046_0000302 3300049580 Bacteria 49738
389 Ga0501047_0035404 3300049581 Bacteria 4823
390 Ga0501047_0141701 3300049581 Bacteria 2282
391 Ga0501048_0152730 3300049582 Bacteria 1633
392 Ga0501070_0000731 3300049586 Bacteria 30025
393 Ga0501070_0012738 3300049586 Bacteria 7090
394 Ga0501035_0000742 3300049822 Bacteria 35160
395 Ga0501035_0006371 3300049822 Bacteria 11096
396 Ga0501044_0000313 3300049823 Bacteria 61310
397 Ga0501044_0022214 3300049823 Bacteria 6761
398 nmdc:mga03n38_1994_c1 3300050490 Bacteria 6148
399 nmdc:mga03n38_221323_c1 3300050490 Bacteria 988
400 nmdc:mga03n38_4713_c1 3300050490 Bacteria 4556
401 nmdc:mga03n38_50390_c1 3300050490 Bacteria 1855
402 nmdc:mga03n38_60165_c1 3300050490 Bacteria 1726
403 nmdc:mga03n38_6367_c1 3300050490 Bacteria 4096
404 nmdc:mga00v17_2735_c1 3300050491 Bacteria 9051
405 nmdc:mga00v17_3093_c1 3300050491 Bacteria 8560
406 nmdc:mga0yw44_228390_c1 3300050492 Bacteria 1235
407 nmdc:mga0yw44_2783_c1 3300050492 Bacteria 7577
408 nmdc:mga0yw44_335245_c1 3300050492 Bacteria 1017
409 nmdc:mga0yw44_62925_c1 3300050492 Bacteria 2280
410 nmdc:mga06z11_178456_c1 3300050494 Bacteria 1223
411 nmdc:mga06z11_21230_c1 3300050494 Bacteria 3015
412 nmdc:mga07m45_12582_c1 3300050496 Bacteria 4474
413 nmdc:mga07m45_222865_c1 3300050496 Bacteria 1097
414 nmdc:mga05p37_17907_c1 3300050507 Bacteria 8551
415 nmdc:mga0qj67_118334_c1 3300050509 Bacteria 2142
416 nmdc:mga0sz30_101492_c1 3300050516 Bacteria 1257
417 nmdc:mga0sz30_17655_c1 3300050516 Bacteria 2848
418 nmdc:mga0sz30_2644_c1 3300050516 Bacteria 6384
419 nmdc:mga0sz30_9361_c1 3300050516 Bacteria 3725
420 nmdc:mga0sz30_9965_c1 3300050516 Bacteria 3631
421 Ga0500635_0039456 3300053080 Bacteria 1571
422 Ga0500643_034637 3300053087 Bacteria 1519
423 Ga0500641_0095066 3300053096 Bacteria 1275
424 Ga0500652_063095 3300053131 Bacteria 1529
425 Ga0500559_0013721 3300053136 Bacteria 3427
426 Ga0500627_0008809 3300053158 Bacteria 3603
427 Ga0500645_000016 3300053730 Bacteria 147392
428 Ga0500645_021663 3300053730 Bacteria 1982
429 Ga0500645_044856 3300053730 Bacteria 1300
430 Ga0466962_0011881 3300061719 Bacteria 4192
431 Ga0466962_0070677 3300061719 Bacteria 1668
432 2738704507 2738541274 Bacteria 6909446
433 2738708124 2738541274 Bacteria 6909446
434 2739331010 2738543028 Bacteria 6917070
435 2739334723 2738543028 Bacteria 6917070
436 2744954956 2744054611 Bacteria 5611514
437 2842140229 2842134933 Bacteria 5847019
438 2902802209 2902799365 Bacteria 5419524
439 2902803815 2902799365 Bacteria 5419524
440 2929216805 2929212328 Bacteria 7708288
441 2939588848 2939582691 Bacteria 7088898
442 Ga0496108_0385786
443 JGI24737J22298_10086576
444 JGI24748J21848_1007397
445 JGI24744J21845_10000056
446 JGI24742J22300_10000298
447 Ga0070676_10009360
448 Ga0070683_100573764
449 Ga0070690_100138849
450 Ga0068869_100026751
451 Ga0068869_100031639
452 Ga0070680_100189390
453 Ga0070682_100002572
454 Ga0070682_100060269
455 Ga0068868_100003487
456 Ga0068868_100060928
457 Ga0070660_100667576
458 Ga0070689_100092810
459 Ga0070692_10206782
460 Ga0070668_100001188
461 Ga0070668_100060067
462 Ga0070669_100000597
463 Ga0070669_100008771
464 Ga0070669_100208492
465 Ga0070671_100035331
466 Ga0070674_100043807
467 Ga0070688_100094295
468 Ga0070659_100010064
469 Ga0070667_100000388
470 Ga0070667_100009690
471 Ga0070667_100460440
472 Ga0070714_100056402
473 Ga0070710_10002861
474 Ga0070711_100015566
475 Ga0070711_100050470
476 Ga0070711_100455780
477 Ga0070705_100003517
478 Ga0070700_100001498
479 Ga0070694_100294658
480 Ga0070678_100001466
481 Ga0070678_100085628
482 Ga0070678_100124376
483 Ga0070678_100521211
484 Ga0068867_100007367
485 Ga0070685_10040055
486 Ga0070684_100095799
487 Ga0070684_100403302
488 Ga0068853_100003962
489 Ga0070672_100310512
490 Ga0070695_100003335
491 Ga0070696_100294219
492 Ga0070696_100458033
493 Ga0070693_100043486
494 Ga0070693_100256341
495 Ga0070665_100004946
496 Ga0070665_100006513
497 Ga0070665_100084282
498 Ga0070704_100002412
499 Ga0070704_100342416
500 Ga0068854_100002546
501 Ga0068856_100134700
502 Ga0070702_100013152
503 Ga0070702_100034359
504 Ga0070702_100174269
505 Ga0070702_100266012
506 Ga0068859_100000276
507 Ga0068859_100008624
508 Ga0068864_100039998
509 Ga0068866_10001276
510 Ga0068866_10207910
511 Ga0068861_100000307
512 Ga0068861_100080787
513 Ga0068861_100608388
514 Ga0068863_100000431
515 Ga0068863_100090030
516 Ga0068863_100119240
517 Ga0068858_100000440
518 Ga0068858_100058958
519 Ga0068860_100000232
520 Ga0068860_100007260
521 Ga0068860_100274904
522 Ga0068862_100000055
523 Ga0068862_100002080
524 Ga0081455_10096905
525 Ga0081455_10139110
526 Ga0075365_10002978
527 Ga0075365_10003735
528 Ga0075365_10034408
529 Ga0075365_10162682
530 Ga0075363_100000301
531 Ga0075363_100002272
532 Ga0075363_100003512
533 Ga0075363_100005175
534 Ga0075363_100005377
535 Ga0075363_100010832
536 Ga0075363_100094913
537 Ga0075363_100104820
538 Ga0075363_100264509
539 Ga0075364_10003925
540 Ga0075364_10009589
541 Ga0075364_10141109
542 Ga0070715_10028473
543 Ga0070715_10048157
544 Ga0070716_100003667
545 Ga0070716_100004132
546 Ga0070712_100003774
547 Ga0075367_10004632
548 Ga0075367_10084765
549 Ga0075369_10006868
550 Ga0075369_10016492
551 Ga0075369_10081999
552 Ga0075370_10000890
553 Ga0075370_10004551
554 Ga0075370_10014001
555 Ga0075370_10083473
556 Ga0075428_100006189
557 Ga0075430_100117388
558 Ga0068865_100001579
559 Ga0068865_100155609
560 Ga0097620_100000276
561 Ga0097620_100008624
562 Ga0105250_10058617
563 Ga0105245_10002313
564 Ga0105245_10022670
565 Ga0105245_10062155
566 Ga0105247_10000029
567 Ga0105247_10000584
568 Ga0105247_10014653
569 Ga0105243_10001688
570 Ga0105243_10135388
571 Ga0105241_10014332
572 Ga0105241_10195166
573 Ga0105242_10000923
574 Ga0105242_10070058
575 Ga0105242_10146632
576 Ga0105248_10000136
577 Ga0105248_10002643
578 Ga0105248_10089746
579 Ga0105248_10182458
580 Ga0105237_10024507
581 Ga0105238_10407264
582 Ga0105249_10000077
583 Ga0105249_10003484
584 Ga0105249_10057305
585 Ga0105249_10060875
586 Ga0105239_10082222
587 Ga0105239_10131889
588 Ga0105239_10502591
589 Ga0105246_10114130
590 Ga0105246_10117230
591 Ga0105246_10628877
592 Ga0157374_10007254
593 Ga0157378_10002579
594 Ga0157378_10060973
595 Ga0157378_10218295
596 Ga0163162_10002796
597 Ga0163162_10007824
598 Ga0157372_10000875
599 Ga0157375_10002649
600 Ga0157375_10200845
601 Ga0157375_10323995
602 Ga0163163_10108311
603 Ga0163163_10121163
604 Ga0163163_11066633
605 Ga0157380_10000844
606 Ga0182008_10122575
607 Ga0157379_10003466
608 Ga0157379_10256439
609 Ga0163161_10001223
610 Ga0213876_10002900
611 Ga0213875_10015087
612 Ga0213875_10036418
613 Ga0213875_10082712
614 Ga0209051_1056992
615 Ga0207692_10002758
616 Ga0207642_10000230
617 Ga0207710_10000046
618 Ga0207688_10000208
619 Ga0207688_10049978
620 Ga0207647_10046619
621 Ga0207685_10002125
622 Ga0207685_10093368
623 Ga0207645_10022908
624 Ga0207693_10000614
625 Ga0207663_10049297
626 Ga0207657_10217863
627 Ga0207681_10000948
628 Ga0207681_10006923
629 Ga0207687_10007362
630 Ga0207687_10158328
631 Ga0207687_10368025
632 Ga0207644_10182382
633 Ga0207644_10653573
634 Ga0207690_10020349
635 Ga0207706_10053669
636 Ga0207686_10004857
637 Ga0207686_10074112
638 Ga0207686_10104701
639 Ga0207709_10006644
640 Ga0207709_10106126
641 Ga0207670_10008584
642 Ga0207669_10010358
643 Ga0207704_10003738
644 Ga0207665_10002840
645 Ga0207665_10007811
646 Ga0207665_10086686
647 Ga0207691_10314124
648 Ga0207711_10000111
649 Ga0207711_10119968
650 Ga0207711_10130156
651 Ga0207689_10010719
652 Ga0207661_10689547
653 Ga0207651_10172082
654 Ga0207712_10000017
655 Ga0207668_10022542
656 Ga0207668_10026222
657 Ga0207640_10044024
658 Ga0207658_10000016
659 Ga0207658_10020042
660 Ga0207658_10271092
661 Ga0207677_10015294
662 Ga0207703_10016881
663 Ga0207703_10057977
664 Ga0207703_10202926
665 Ga0207678_10003908
666 Ga0207678_10057320
667 Ga0207702_10280142
668 Ga0207641_10001756
669 Ga0207641_10008314
670 Ga0207641_10207975
671 Ga0207641_10444271
672 Ga0207648_10000112
673 Ga0207676_10016432
674 Ga0207676_10415952
675 Ga0207675_100000917
676 Ga0207675_100116948
677 Ga0207683_10000451
678 Ga0207683_10131193
679 Ga0207683_10150364
680 Ga0268266_10005455
681 Ga0268266_10010157
682 Ga0268265_10000067
683 Ga0268265_10006910
684 Ga0268265_10041932
685 Ga0268264_10000146
686 Ga0316576_10472212
687 Ga0307413_10015591
688 Ga0307410_10009089
689 Ga0307409_100138476
690 Ga0307416_100034035
691 Ga0307416_100233677
692 Ga0307411_10059219
693 Ga0307415_100594449
694 Ga0373943_0210186
695 Ga0373961_0024187
696 Ga0373931_0002988
697 Ga0373931_0067563
698 Ga0265778_014599
699 Ga0436364_0166962
700 Ga0436364_0706017
701 Ga0436364_0907426
702 Ga0395901_0587284
703 Ga0436365_0271296
704 Ga0436365_0430385
705 Ga0436365_1685157
706 Ga0436365_1781365
707 Ga0436363_0005942
708 Ga0436363_1257506
709 Ga0439461_0004961
710 Ga0439466_0009445
711 Ga0439466_0038715
712 Ga0439465_0005630
713 Ga0439465_0005901
714 Ga0451853_1512470
715 Ga0439431_0025764
716 Ga0439442_004437
717 Ga0466969_0025918
718 Ga0466972_0182318
719 Ga0466965_0103242
720 Ga0466966_0010057
721 Ga0466966_0019768
722 Ga0466966_0043857
723 Ga0466966_0066671
724 Ga0466961_0016900
725 Ga0466961_0017544
726 Ga0466961_0020608
727 Ga0466963_0010509
728 Ga0466963_0018937
729 Ga0466963_0335173
730 Ga0466963_0429218
731 Ga0466971_0060527
732 Ga0466968_0006620
733 Ga0466968_0016883
734 Ga0466970_0008373
735 Ga0466970_0009540
736 Ga0466957_0022738
737 Ga0466957_0064590
738 Ga0466957_0333676
739 Ga0466960_0001146
740 Ga0466960_0004090
741 Ga0466960_0061109
742 Ga0466960_0225131
743 Ga0466959_0016228
744 Ga0466959_0100421
745 Ga0466959_0312413
746 Ga0466958_0001611
747 Ga0466958_0014906
748 Ga0466958_0026895
749 Ga0466967_0004425
750 Ga0466967_0039777
751 Ga0466967_0131491
752 Ga0466967_0204644
753 Ga0495629_0013469
754 Ga0495639_0040540
755 Ga0495662_0081425
756 Ga0495640_0044166
757 Ga0495667_0114901
758 Ga0495581_0036565
759 Ga0495672_0228035
760 Ga0495676_0068711
761 Ga0495686_0035607
762 Ga0495686_0178961
763 Ga0496100_0005283
764 Ga0496100_0032895
765 Ga0496100_0412653
766 Ga0496101_0005556
767 Ga0496101_0009026
768 Ga0496101_0023436
769 Ga0496102_0000587
770 Ga0496102_0012278
771 Ga0496102_0026207
772 Ga0496102_0032917
773 Ga0496102_0157975
774 Ga0496102_0177824
775 Ga0496103_0001354
776 Ga0496104_0011430
777 Ga0496104_0033199
778 Ga0496104_0228536
779 Ga0496105_0023567
780 Ga0496105_0153779
781 Ga0496106_0005094
782 Ga0496106_0008195
783 Ga0496106_0327760
784 Ga0496107_0001833
785 Ga0496107_0003385
786 Ga0496107_0059042
787 Ga0496107_0081961
788 Ga0496108_0006048
789 Ga0496108_0008335
790 Ga0496108_0025696
791 Ga0496108_0408003
792 Ga0496109_0016623
793 Ga0496109_0032804
794 Ga0496109_0347475
795 Ga0496110_0036695
796 Ga0496110_0074772
797 Ga0496110_0077224
798 Ga0496111_0717527
799 Ga0496112_0001686
800 Ga0496112_0024360
801 Ga0496112_0109913
802 Ga0496112_0128754
803 Ga0496113_0349396
804 Ga0496113_0354433
805 Ga0496114_0003685
806 Ga0496114_0004362
807 Ga0496114_0768830
808 Ga0496115_0188814
809 Ga0496116_0027247
810 Ga0496117_0005770
811 Ga0496118_0000272
812 Ga0496118_0003575
813 Ga0496119_0001469
814 Ga0496120_0026118
815 Ga0496124_0215112
816 Ga0496126_0007764
817 Ga0496126_0097303
818 Ga0501032_0025311
819 Ga0501032_0027297
820 Ga0501033_0058994
821 Ga0501033_0066659
822 Ga0501034_0001406
823 Ga0501034_0025622
824 Ga0501034_0218076
825 Ga0501036_0056865
826 Ga0501037_0005160
827 Ga0501038_0317744
828 Ga0501039_0400500
829 Ga0501046_0000302
830 Ga0501047_0035404
831 Ga0501047_0141701
832 Ga0501048_0152730
833 Ga0501070_0000731
834 Ga0501070_0012738
835 Ga0501035_0000742
836 Ga0501035_0006371
837 Ga0501044_0000313
838 Ga0501044_0022214
839 nmdc:mga03n38_1994_c1
840 nmdc:mga03n38_221323_c1
841 nmdc:mga03n38_4713_c1
842 nmdc:mga03n38_50390_c1
843 nmdc:mga03n38_60165_c1
844 nmdc:mga03n38_6367_c1
845 nmdc:mga00v17_2735_c1
846 nmdc:mga00v17_3093_c1
847 nmdc:mga0yw44_228390_c1
848 nmdc:mga0yw44_2783_c1
849 nmdc:mga0yw44_335245_c1
850 nmdc:mga0yw44_62925_c1
851 nmdc:mga06z11_178456_c1
852 nmdc:mga06z11_21230_c1
853 nmdc:mga07m45_12582_c1
854 nmdc:mga07m45_222865_c1
855 nmdc:mga05p37_17907_c1
856 nmdc:mga0qj67_118334_c1
857 nmdc:mga0sz30_101492_c1
858 nmdc:mga0sz30_17655_c1
859 nmdc:mga0sz30_2644_c1
860 nmdc:mga0sz30_9361_c1
861 nmdc:mga0sz30_9965_c1
862 Ga0500635_0039456
863 Ga0500643_034637
864 Ga0500641_0095066
865 Ga0500652_063095
866 Ga0500559_0013721
867 Ga0500627_0008809
868 Ga0500645_000016
869 Ga0500645_021663
870 Ga0500645_044856
871 Ga0466962_0011881
872 Ga0466962_0070677
873 2738704507
874 2738708124
875 2739331010
876 2739334723
877 2744954956
878 2842140229
879 2902802209
880 2902803815
881 2929216805
882 2939588848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

41

172

0.92

PF03982

DAGAT

Diacylglycerol acyltransferase

70

270

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7929 19 258
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7688 19 264
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6422 19 258
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6299 19 264
3ld9-assembly1.cif.gz_A crystal structure of thymidylate kinase from ehrlichia chaffeensis at 2.15a resolution 0.5491 48 125
ID Description Score Start End Superfamily
af_O06830_42_173_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9102 35 167 3.40.50.2000
af_O06830_42_173_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9036 35 167 3.40.50.2000
af_P9WKT1_129_261_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.826 37 165 3.40.50.2000
af_P9WKT1_129_261_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7981 37 165 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7889 40 165 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7I7YD69-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.8992 7 171 GO:0016020
GO:0016746
AF-A0A2S8M934-F1-model_v4 deleted 0.8846 14 126
AF-A0A7X5WME4-F1-model_v4 Glycerol acyltransferase 0.8809 7 171 GO:0016020
GO:0016746
AF-A0A7G1IS05-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.8804 54 167 GO:0016020
GO:0016746
AF-A0A498QZ32-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.875 7 146 GO:0016746

Map