F444816

General Info

Members Datasets Scaffolds Average Seq Length
442 196 442 63

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10273727|Ga0070658_102737272
Length 71
Sequence MQPSPCPVDMPNPSSQPKKCPLCGKPEHPDHAPFCSRGCKDRDLLKWLGEGYRIPGPPADPERVDSEGAGD

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
170 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
171 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
174 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
175 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
176 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
177 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
178 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
179 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
180 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
181 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
182 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
183 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
184 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
185 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
186 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
187 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
188 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
195 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 3.85
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10110552 3300001989 Bacteria 825
2 JGI24735J21928_10019243 3300002067 Bacteria 2100
3 Ga0070658_10001186 3300005327 Bacteria 22303
4 Ga0070658_10055326 3300005327 Bacteria 3223
5 Ga0070658_10057127 3300005327 Bacteria 3174
6 Ga0070658_10144811 3300005327 Bacteria 1986
7 Ga0070658_10273727 3300005327 Bacteria 1436
8 Ga0070658_10340582 3300005327 Bacteria 1282
9 Ga0070658_10520253 3300005327 Bacteria 1028
10 Ga0070658_10922036 3300005327 Bacteria 759
11 Ga0070683_100007551 3300005329 Bacteria 9189
12 Ga0070690_100722645 3300005330 Bacteria 767
13 Ga0070670_100044239 3300005331 Bacteria 3829
14 Ga0070666_10553813 3300005335 Bacteria 837
15 Ga0070680_100678500 3300005336 Bacteria 886
16 Ga0068868_100170289 3300005338 Bacteria 1803
17 Ga0070660_100043149 3300005339 Bacteria 3445
18 Ga0070660_100134068 3300005339 Bacteria 1984
19 Ga0070660_100277307 3300005339 Bacteria 1371
20 Ga0070660_100338641 3300005339 Bacteria 1238
21 Ga0070660_100534874 3300005339 Bacteria 977
22 Ga0070689_100619911 3300005340 Bacteria 939
23 Ga0070661_100000101 3300005344 Bacteria 70279
24 Ga0070661_100028576 3300005344 Bacteria 4022
25 Ga0070661_100271018 3300005344 Bacteria 1315
26 Ga0070661_100747090 3300005344 Bacteria 800
27 Ga0070661_101098425 3300005344 Bacteria 663
28 Ga0070692_10151889 3300005345 Bacteria 1320
29 Ga0070692_10161357 3300005345 Bacteria 1285
30 Ga0070668_101270209 3300005347 Bacteria 669
31 Ga0070669_100125376 3300005353 Bacteria 1964
32 Ga0070675_100135333 3300005354 Bacteria 2103
33 Ga0070671_100002984 3300005355 Bacteria 13166
34 Ga0070671_100022766 3300005355 Bacteria 5119
35 Ga0070671_100872294 3300005355 Bacteria 785
36 Ga0070671_101211720 3300005355 Bacteria 664
37 Ga0070674_100006893 3300005356 Bacteria 6660
38 Ga0070673_100076079 3300005364 Bacteria 2710
39 Ga0070659_100000045 3300005366 Bacteria 101520
40 Ga0070659_100019693 3300005366 Bacteria 5119
41 Ga0070659_100030426 3300005366 Bacteria 4179
42 Ga0070659_100139634 3300005366 Bacteria 1972
43 Ga0070659_100279520 3300005366 Bacteria 1389
44 Ga0070659_100530942 3300005366 Bacteria 1006
45 Ga0070667_100190111 3300005367 Bacteria 1818
46 Ga0070667_100643595 3300005367 Bacteria 978
47 Ga0070667_101409944 3300005367 Bacteria 654
48 Ga0070714_100006015 3300005435 Bacteria 9318
49 Ga0070714_100183404 3300005435 Bacteria 1906
50 Ga0070713_101252409 3300005436 Bacteria 718
51 Ga0070701_10194401 3300005438 Bacteria 1196
52 Ga0070711_101544141 3300005439 Bacteria 580
53 Ga0070663_101462231 3300005455 Bacteria 607
54 Ga0070663_101761668 3300005455 Bacteria 555
55 Ga0070662_100000036 3300005457 Bacteria 77190
56 Ga0070662_100010434 3300005457 Bacteria 6095
57 Ga0070662_100035585 3300005457 Bacteria 3518
58 Ga0070681_10302279 3300005458 Bacteria 1510
59 Ga0068867_100055083 3300005459 Bacteria 2939
60 Ga0070679_100059845 3300005530 Bacteria 3796
61 Ga0070679_100171728 3300005530 Bacteria 2140
62 Ga0070679_100223246 3300005530 Bacteria 1845
63 Ga0070679_100378001 3300005530 Bacteria 1363
64 Ga0070684_100025922 3300005535 Bacteria 4932
65 Ga0068853_100000059 3300005539 Bacteria 78301
66 Ga0068853_100287216 3300005539 Bacteria 1518
67 Ga0068853_100464470 3300005539 Bacteria 1192
68 Ga0068853_101436237 3300005539 Bacteria 668
69 Ga0068853_102147074 3300005539 Bacteria 541
70 Ga0070672_100209869 3300005543 Bacteria 1631
71 Ga0070672_100279265 3300005543 Bacteria 1412
72 Ga0070672_100496124 3300005543 Bacteria 1056
73 Ga0070672_100548450 3300005543 Bacteria 1004
74 Ga0070672_100776497 3300005543 Bacteria 842
75 Ga0068855_100176472 3300005563 Bacteria 2417
76 Ga0068855_100387931 3300005563 Bacteria 1533
77 Ga0070664_100005661 3300005564 Bacteria 10059
78 Ga0070664_100301691 3300005564 Bacteria 1448
79 Ga0070664_102111743 3300005564 Bacteria 535
80 Ga0068854_100937313 3300005578 Bacteria 763
81 Ga0068854_101407470 3300005578 Bacteria 631
82 Ga0068856_100664525 3300005614 Bacteria 1063
83 Ga0068852_100435934 3300005616 Bacteria 1295
84 Ga0068852_100538670 3300005616 Bacteria 1166
85 Ga0068852_100812473 3300005616 Bacteria 949
86 Ga0068852_100965083 3300005616 Bacteria 871
87 Ga0068852_101162141 3300005616 Bacteria 793
88 Ga0068852_102438002 3300005616 Bacteria 544
89 Ga0068859_100868670 3300005617 Bacteria 988
90 Ga0068864_100003082 3300005618 Bacteria 13762
91 Ga0068864_100624241 3300005618 Bacteria 1048
92 Ga0068866_10550115 3300005718 Bacteria 772
93 Ga0068861_100063960 3300005719 Bacteria 2829
94 Ga0068861_102136351 3300005719 Bacteria 560
95 Ga0068851_10059799 3300005834 Bacteria 1950
96 Ga0068863_100055164 3300005841 Bacteria 3764
97 Ga0068863_100899260 3300005841 Bacteria 885
98 Ga0068863_102343173 3300005841 Bacteria 544
99 Ga0068858_100140898 3300005842 Bacteria 2264
100 Ga0068860_100174117 3300005843 Bacteria 2080
101 Ga0068862_100016695 3300005844 Bacteria 6113
102 Ga0068862_100046121 3300005844 Bacteria 3719
103 Ga0070716_100079997 3300006173 Bacteria 1947
104 Ga0070712_100322386 3300006175 Bacteria 1257
105 Ga0075362_10178417 3300006177 Bacteria 1028
106 Ga0097621_100988822 3300006237 Bacteria 787
107 Ga0097621_101857847 3300006237 Bacteria 575
108 Ga0068871_101678697 3300006358 Bacteria 602
109 Ga0075434_100445797 3300006871 Bacteria 1316
110 Ga0075429_100188263 3300006880 Bacteria 1809
111 Ga0068865_100210231 3300006881 Bacteria 1516
112 Ga0097620_100868641 3300006931 Bacteria 988
113 Ga0105240_12461189 3300009093 Bacteria 538
114 Ga0111539_11671354 3300009094 Bacteria 738
115 Ga0105243_10005934 3300009148 Bacteria 9461
116 Ga0105248_10001451 3300009177 Bacteria 26388
117 Ga0105248_10016845 3300009177 Bacteria 8044
118 Ga0105248_11766285 3300009177 Bacteria 701
119 Ga0105237_11663747 3300009545 Bacteria 645
120 Ga0157327_1002491 3300012512 Bacteria 1275
121 Ga0157373_10069932 3300013100 Bacteria 2481
122 Ga0157373_10293064 3300013100 Bacteria 1154
123 Ga0157371_10084774 3300013102 Bacteria 2245
124 Ga0157371_11042575 3300013102 Bacteria 625
125 Ga0157370_10687069 3300013104 Bacteria 934
126 Ga0157369_10081438 3300013105 Bacteria 3464
127 Ga0157369_10180899 3300013105 Bacteria 2218
128 Ga0157369_10526410 3300013105 Bacteria 1223
129 Ga0157369_10967051 3300013105 Bacteria 872
130 Ga0157374_11569303 3300013296 Bacteria 682
131 Ga0157378_11784693 3300013297 Bacteria 663
132 Ga0163162_10642391 3300013306 Bacteria 1185
133 Ga0157372_10397720 3300013307 Bacteria 1605
134 Ga0157372_12167492 3300013307 Bacteria 638
135 Ga0157372_12429792 3300013307 Bacteria 602
136 Ga0157380_10142376 3300014326 Bacteria 2062
137 Ga0157377_11670759 3300014745 Bacteria 513
138 Ga0157379_11135945 3300014968 Bacteria 749
139 Ga0206353_10653832 3300020082 Bacteria 527
140 Ga0206353_11758431 3300020082 Bacteria 1651
141 Ga0207656_10249109 3300025321 Bacteria 870
142 Ga0207680_11344626 3300025903 Bacteria 507
143 Ga0207647_10099301 3300025904 Bacteria 1729
144 Ga0207645_10301392 3300025907 Bacteria 1067
145 Ga0207705_10003372 3300025909 Bacteria 12148
146 Ga0207705_10023916 3300025909 Bacteria 4360
147 Ga0207705_10134701 3300025909 Bacteria 1841
148 Ga0207705_10167834 3300025909 Bacteria 1651
149 Ga0207705_10184170 3300025909 Bacteria 1577
150 Ga0207705_10296997 3300025909 Bacteria 1238
151 Ga0207705_10816993 3300025909 Bacteria 723
152 Ga0207705_11223661 3300025909 Bacteria 575
153 Ga0207707_10793956 3300025912 Bacteria 789
154 Ga0207660_10082956 3300025917 Bacteria 2359
155 Ga0207660_10565295 3300025917 Bacteria 925
156 Ga0207660_10998315 3300025917 Bacteria 683
157 Ga0207657_10022765 3300025919 Bacteria 5852
158 Ga0207657_10091665 3300025919 Bacteria 2533
159 Ga0207657_10112047 3300025919 Bacteria 2252
160 Ga0207657_10215276 3300025919 Bacteria 1540
161 Ga0207657_10293001 3300025919 Bacteria 1290
162 Ga0207649_10049310 3300025920 Bacteria 2600
163 Ga0207649_10562377 3300025920 Bacteria 874
164 Ga0207652_10360265 3300025921 Bacteria 1313
165 Ga0207652_10572056 3300025921 Bacteria 1014
166 Ga0207681_10607500 3300025923 Bacteria 904
167 Ga0207681_11650450 3300025923 Bacteria 536
168 Ga0207659_10887043 3300025926 Bacteria 767
169 Ga0207700_10039024 3300025928 Bacteria 3452
170 Ga0207700_11013380 3300025928 Bacteria 743
171 Ga0207664_10136409 3300025929 Bacteria 2071
172 Ga0207664_10182623 3300025929 Bacteria 1802
173 Ga0207644_10006031 3300025931 Bacteria 7901
174 Ga0207690_10011411 3300025932 Bacteria 5314
175 Ga0207690_10017441 3300025932 Bacteria 4383
176 Ga0207690_10165399 3300025932 Bacteria 1653
177 Ga0207690_10392675 3300025932 Bacteria 1105
178 Ga0207690_10417861 3300025932 Bacteria 1072
179 Ga0207690_10419238 3300025932 Bacteria 1071
180 Ga0207706_10041864 3300025933 Bacteria 4059
181 Ga0207706_11469868 3300025933 Bacteria 557
182 Ga0207669_10039276 3300025937 Bacteria 2733
183 Ga0207711_10009213 3300025941 Bacteria 8245
184 Ga0207711_10194956 3300025941 Bacteria 1847
185 Ga0207661_10081996 3300025944 Bacteria 2666
186 Ga0207679_10046773 3300025945 Bacteria 3139
187 Ga0207679_10086909 3300025945 Bacteria 2406
188 Ga0207658_10026021 3300025986 Bacteria 4099
189 Ga0207677_10752325 3300026023 Bacteria 869
190 Ga0207703_10209038 3300026035 Bacteria 1739
191 Ga0207703_10486841 3300026035 Bacteria 1156
192 Ga0207678_10131025 3300026067 Bacteria 2139
193 Ga0207678_10342350 3300026067 Bacteria 1289
194 Ga0207702_10187673 3300026078 Bacteria 1908
195 Ga0207641_10684243 3300026088 Bacteria 1009
196 Ga0207648_10067355 3300026089 Bacteria 3121
197 Ga0207676_10109833 3300026095 Bacteria 2305
198 Ga0207676_11065934 3300026095 Bacteria 798
199 Ga0207674_10465285 3300026116 Bacteria 1222
200 Ga0207675_100025061 3300026118 Bacteria 5551
201 Ga0207675_100581322 3300026118 Bacteria 1122
202 Ga0207698_10016604 3300026142 Bacteria 4969
203 Ga0209982_1053174 3300027552 Bacteria 654
204 Ga0268265_10012837 3300028380 Bacteria 5689
205 Ga0268265_10027450 3300028380 Bacteria 4064
206 Ga0268264_10083144 3300028381 Bacteria 2742
207 Ga0307408_100029568 3300031548 Bacteria 3797
208 Ga0307408_100860723 3300031548 Bacteria 827
209 Ga0307405_10081046 3300031731 Bacteria 2120
210 Ga0307405_10108944 3300031731 Bacteria 1872
211 Ga0307405_10322618 3300031731 Bacteria 1180
212 Ga0307405_10328461 3300031731 Bacteria 1171
213 Ga0307413_10012950 3300031824 Bacteria 4172
214 Ga0307413_10027244 3300031824 Bacteria 3163
215 Ga0307413_10070953 3300031824 Bacteria 2192
216 Ga0307413_10266628 3300031824 Bacteria 1280
217 Ga0307413_10419368 3300031824 Bacteria 1054
218 Ga0307413_10573956 3300031824 Bacteria 919
219 Ga0307413_10639068 3300031824 Bacteria 876
220 Ga0307413_11229506 3300031824 Bacteria 652
221 Ga0307410_10009475 3300031852 Bacteria 5460
222 Ga0307410_10021714 3300031852 Bacteria 3953
223 Ga0307410_10044369 3300031852 Bacteria 2953
224 Ga0307410_10365146 3300031852 Bacteria 1157
225 Ga0307410_10635208 3300031852 Bacteria 894
226 Ga0307410_10783944 3300031852 Bacteria 809
227 Ga0307406_10025221 3300031901 Bacteria 3558
228 Ga0307406_10074940 3300031901 Bacteria 2230
229 Ga0307406_10119645 3300031901 Bacteria 1828
230 Ga0307406_10484523 3300031901 Bacteria 999
231 Ga0307406_11731207 3300031901 Bacteria 554
232 Ga0307406_11759582 3300031901 Bacteria 550
233 Ga0307407_10003578 3300031903 Bacteria 6417
234 Ga0307407_10012430 3300031903 Bacteria 4091
235 Ga0307407_10041093 3300031903 Bacteria 2583
236 Ga0307407_10298967 3300031903 Bacteria 1121
237 Ga0307407_10379733 3300031903 Bacteria 1008
238 Ga0307412_10042660 3300031911 Bacteria 2949
239 Ga0307412_10061009 3300031911 Bacteria 2533
240 Ga0307412_10553730 3300031911 Bacteria 966
241 Ga0307412_11049815 3300031911 Bacteria 722
242 Ga0307409_100008033 3300031995 Bacteria 6363
243 Ga0307409_100021019 3300031995 Bacteria 4464
244 Ga0307409_100110313 3300031995 Bacteria 2305
245 Ga0307409_100451026 3300031995 Bacteria 1241
246 Ga0307409_101039590 3300031995 Bacteria 838
247 Ga0307409_101278696 3300031995 Bacteria 758
248 Ga0307416_100101240 3300032002 Bacteria 2508
249 Ga0307416_100140463 3300032002 Bacteria 2194
250 Ga0307416_100272261 3300032002 Bacteria 1663
251 Ga0307416_100317111 3300032002 Bacteria 1559
252 Ga0307416_100532994 3300032002 Bacteria 1244
253 Ga0307416_100868714 3300032002 Bacteria 1001
254 Ga0307416_101468545 3300032002 Bacteria 787
255 Ga0307416_103706292 3300032002 Bacteria 511
256 Ga0307414_10004314 3300032004 Bacteria 7715
257 Ga0307414_10005052 3300032004 Bacteria 7226
258 Ga0307414_10007234 3300032004 Bacteria 6233
259 Ga0307414_10047978 3300032004 Bacteria 2943
260 Ga0307414_10093397 3300032004 Bacteria 2242
261 Ga0307414_10330412 3300032004 Bacteria 1301
262 Ga0307414_10471245 3300032004 Bacteria 1105
263 Ga0307414_11955023 3300032004 Bacteria 547
264 Ga0307414_11982426 3300032004 Bacteria 543
265 Ga0307411_10010893 3300032005 Bacteria 4874
266 Ga0307411_10048907 3300032005 Bacteria 2744
267 Ga0307411_10060839 3300032005 Bacteria 2510
268 Ga0307411_10324772 3300032005 Bacteria 1244
269 Ga0307411_10586473 3300032005 Bacteria 956
270 Ga0307411_10688169 3300032005 Bacteria 889
271 Ga0307411_11388288 3300032005 Bacteria 642
272 Ga0307411_11392880 3300032005 Bacteria 641
273 Ga0307411_11691202 3300032005 Bacteria 585
274 Ga0307415_100071824 3300032126 Bacteria 2435
275 Ga0307415_100129776 3300032126 Bacteria 1906
276 Ga0307415_100272763 3300032126 Bacteria 1386
277 Ga0307415_101091606 3300032126 Bacteria 746
278 Ga0373948_0189948 3300034817 Bacteria 531
279 Ga0373931_0166521 3300035691 Bacteria 1295
280 Ga0395899_0058462 3300037312 Bacteria 2843
281 Ga0395899_0130666 3300037312 Bacteria 1793
282 Ga0395899_0187322 3300037312 Bacteria 1449
283 Ga0395899_0213329 3300037312 Bacteria 1340
284 Ga0395899_0225068 3300037312 Bacteria 1298
285 Ga0395899_0361055 3300037312 Bacteria 969
286 Ga0395899_0391011 3300037312 Bacteria 922
287 Ga0395899_0441804 3300037312 Bacteria 853
288 Ga0395899_0604445 3300037312 Bacteria 698
289 Ga0395899_0772033 3300037312 Bacteria 596
290 Ga0395899_0819885 3300037312 Bacteria 573
291 Ga0395900_0000380 3300037418 Bacteria 64150
292 Ga0395900_0001277 3300037418 Bacteria 30753
293 Ga0395900_0009772 3300037418 Bacteria 9830
294 Ga0395900_0011611 3300037418 Bacteria 9013
295 Ga0395900_0015653 3300037418 Bacteria 7732
296 Ga0395900_0038484 3300037418 Bacteria 4930
297 Ga0395900_0121846 3300037418 Bacteria 2675
298 Ga0395900_0135288 3300037418 Bacteria 2525
299 Ga0395900_0443721 3300037418 Bacteria 1255
300 Ga0395900_0777468 3300037418 Bacteria 886
301 Ga0395900_1246082 3300037418 Bacteria 658
302 Ga0395900_1261383 3300037418 Bacteria 653
303 Ga0395900_1503113 3300037418 Bacteria 585
304 Ga0395898_0019138 3300037466 Bacteria 6970
305 Ga0395898_0034665 3300037466 Bacteria 5026
306 Ga0395898_0097247 3300037466 Bacteria 2828
307 Ga0395898_0097333 3300037466 Bacteria 2826
308 Ga0395898_0451473 3300037466 Bacteria 1224
309 Ga0395898_0573874 3300037466 Bacteria 1070
310 Ga0395898_0622154 3300037466 Bacteria 1022
311 Ga0395898_0662390 3300037466 Bacteria 986
312 Ga0395898_0866790 3300037466 Bacteria 842
313 Ga0395898_0872511 3300037466 Bacteria 839
314 Ga0395898_1239170 3300037466 Bacteria 676
315 Ga0395905_0001357 3300037471 Bacteria 29810
316 Ga0395905_0001453 3300037471 Bacteria 28424
317 Ga0395905_0007770 3300037471 Bacteria 10635
318 Ga0395905_0027269 3300037471 Bacteria 5387
319 Ga0395905_0033490 3300037471 Bacteria 4826
320 Ga0395905_0033646 3300037471 Bacteria 4813
321 Ga0395905_0041087 3300037471 Bacteria 4339
322 Ga0395905_0111296 3300037471 Bacteria 2571
323 Ga0395905_0117517 3300037471 Bacteria 2499
324 Ga0395905_0181096 3300037471 Bacteria 1978
325 Ga0395905_0212082 3300037471 Bacteria 1814
326 Ga0395905_0230422 3300037471 Bacteria 1732
327 Ga0395905_0282503 3300037471 Bacteria 1546
328 Ga0395905_0369116 3300037471 Bacteria 1328
329 Ga0395905_0774056 3300037471 Bacteria 862
330 Ga0395905_0781245 3300037471 Bacteria 858
331 Ga0395905_0781740 3300037471 Bacteria 857
332 Ga0395901_0002790 3300038443 Bacteria 17616
333 Ga0395901_0073452 3300038443 Bacteria 3567
334 Ga0395901_0113830 3300038443 Bacteria 2841
335 Ga0395901_0129119 3300038443 Bacteria 2656
336 Ga0395901_0132852 3300038443 Bacteria 2615
337 Ga0395901_0151110 3300038443 Bacteria 2440
338 Ga0395901_0181439 3300038443 Bacteria 2208
339 Ga0395901_0229874 3300038443 Bacteria 1936
340 Ga0395901_0244441 3300038443 Bacteria 1871
341 Ga0395901_0256151 3300038443 Bacteria 1822
342 Ga0395901_0496079 3300038443 Bacteria 1243
343 Ga0395901_0540985 3300038443 Bacteria 1181
344 Ga0395901_0712215 3300038443 Bacteria 1000
345 Ga0395901_1633456 3300038443 Bacteria 597
346 Ga0395901_1667233 3300038443 Bacteria 589
347 Ga0439439_0063488 3300041406 Bacteria 983
348 Ga0439433_0111900 3300041999 Bacteria 684
349 Ga0439448_0058003 3300042005 Bacteria 1276
350 Ga0439432_030721 3300042006 Bacteria 1741
351 Ga0439432_065098 3300042006 Bacteria 1118
352 Ga0439449_0254825 3300042007 Bacteria 660
353 Ga0439462_0063030 3300042015 Bacteria 1004
354 Ga0439446_0180578 3300042156 Bacteria 705
355 Ga0439446_0255414 3300042156 Bacteria 605
356 Ga0439458_0000009 3300042157 Bacteria 29761
357 Ga0439458_0000057 3300042157 Bacteria 19314
358 Ga0466972_0015644 3300044658 Bacteria 3794
359 Ga0466965_0413310 3300044683 Bacteria 747
360 Ga0466966_0079772 3300044684 Bacteria 2039
361 Ga0466966_0224808 3300044684 Bacteria 1133
362 Ga0466966_0561880 3300044684 Bacteria 686
363 Ga0466966_0725172 3300044684 Bacteria 599
364 Ga0466961_0047542 3300044693 Bacteria 2743
365 Ga0466963_0034454 3300044694 Bacteria 3294
366 Ga0466963_0271018 3300044694 Bacteria 1192
367 Ga0466963_1263976 3300044694 Bacteria 518
368 Ga0466964_0168074 3300044706 Bacteria 1030
369 Ga0466971_0080665 3300044719 Bacteria 1483
370 Ga0466970_0012966 3300044765 Bacteria 4269
371 Ga0466957_0017683 3300044842 Bacteria 4180
372 Ga0466957_0066571 3300044842 Bacteria 2221
373 Ga0466957_0094082 3300044842 Bacteria 1881
374 Ga0466960_0096812 3300044901 Bacteria 1513
375 Ga0466959_0075321 3300045049 Bacteria 2438
376 Ga0466959_0607810 3300045049 Bacteria 735
377 Ga0466958_0027959 3300045836 Bacteria 3340
378 Ga0466958_0089156 3300045836 Bacteria 1906
379 Ga0466958_0280702 3300045836 Bacteria 1067
380 Ga0466967_0049789 3300045976 Bacteria 3666
381 Ga0466967_0145774 3300045976 Bacteria 2209
382 Ga0466967_0370293 3300045976 Bacteria 1389
383 Ga0466967_0554293 3300045976 Bacteria 1131
384 Ga0495643_0213455 3300046522 Bacteria 920
385 Ga0495642_0198249 3300046528 Bacteria 875
386 Ga0495621_0451119 3300046539 Bacteria 550
387 Ga0495668_0504035 3300046616 Bacteria 667
388 Ga0495669_0143888 3300046684 Bacteria 1126
389 Ga0495669_0158363 3300046684 Bacteria 1074
390 Ga0495683_0318846 3300047323 Bacteria 663
391 Ga0495685_082379 3300047447 Bacteria 1071
392 Ga0496101_0147564 3300048904 Bacteria 1797
393 Ga0496106_0060754 3300048909 Bacteria 2865
394 Ga0496106_0802438 3300048909 Bacteria 747
395 Ga0496107_0058165 3300048910 Bacteria 2795
396 Ga0496107_0732889 3300048910 Bacteria 726
397 Ga0496108_0010237 3300048911 Bacteria 7615
398 Ga0496108_1024933 3300048911 Bacteria 704
399 Ga0496109_0008811 3300048912 Bacteria 8592
400 Ga0496110_0017674 3300048913 Bacteria 5964
401 Ga0496111_0001747 3300048914 Bacteria 12714
402 Ga0496111_0234418 3300048914 Bacteria 1363
403 Ga0496111_0507570 3300048914 Bacteria 887
404 Ga0496111_1147676 3300048914 Bacteria 552
405 Ga0496112_0001301 3300048915 Bacteria 18983
406 Ga0496112_0506609 3300048915 Bacteria 1142
407 Ga0496113_0019983 3300048916 Bacteria 4699
408 Ga0496114_0899425 3300048917 Bacteria 766
409 Ga0501067_0060672 3300049583 Bacteria 2093
410 Ga0501069_0072182 3300049585 Bacteria 1935
411 Ga0501202_029739 3300049652 Bacteria 1134
412 Ga0501214_052815 3300049659 Bacteria 622
413 Ga0501216_080335 3300049660 Unclassified 689
414 Ga0501223_057226 3300049663 Bacteria 759
415 Ga0501224_005509 3300049664 Bacteria 1816
416 Ga0501230_068217 3300049667 Bacteria 729
417 Ga0501239_015707 3300049672 Bacteria 887
418 Ga0501242_012471 3300049674 Bacteria 1035
419 Ga0501243_026234 3300049675 Bacteria 980
420 Ga0501243_123737 3300049675 Bacteria 537
421 Ga0501247_020265 3300049677 Bacteria 860
422 Ga0501249_058726 3300049679 Bacteria 889
423 Ga0501253_092314 3300049683 Bacteria 698
424 Ga0501221_150364 3300049704 Bacteria 616
425 Ga0501221_198523 3300049704 Unclassified 556
426 Ga0501229_036310 3300049706 Bacteria 690
427 Ga0501268_025504 3300049765 Bacteria 1039
428 Ga0501270_026808 3300049767 Bacteria 922
429 Ga0501271_018472 3300049768 Bacteria 796
430 Ga0501272_065147 3300049769 Bacteria 526
431 Ga0501273_026881 3300049770 Bacteria 804
432 Ga0501283_073713 3300049779 Bacteria 632
433 nmdc:mga03683_177310_c1 3300050489 Bacteria 971
434 nmdc:mga00v17_1019589_c1 3300050491 Bacteria 520
435 nmdc:mga0k408_895275_c1 3300050493 Bacteria 515
436 nmdc:mga09592_385996_c1 3300050508 Bacteria 1211
437 nmdc:mga0n895_113438_c1 3300050512 Bacteria 2728
438 Ga0495655_0110020 3300053083 Bacteria 827
439 Ga0590071_209592 3300059421 Bacteria 514
440 Ga0466962_0024832 3300061719 Bacteria 2877
441 Ga0466962_0059930 3300061719 Bacteria 1817
442 Ga0466962_0205764 3300061719 Bacteria 962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100029568 Ga0307408_1000295682 57
2 3300031731 Ga0307405_10108944 Ga0307405_101089442 57
3 3300031824 Ga0307413_10573956 Ga0307413_105739562 57
4 3300031852 Ga0307410_10021714 Ga0307410_100217142 57
5 3300031901 Ga0307406_10074940 Ga0307406_100749402 57
6 3300031911 Ga0307412_10061009 Ga0307412_100610092 57
7 3300032002 Ga0307416_100272261 Ga0307416_1002722613 57
8 3300032004 Ga0307414_10330412 Ga0307414_103304122 57
9 3300032005 Ga0307411_11388288 Ga0307411_113882882 57
10 3300032126 Ga0307415_100071824 Ga0307415_1000718244 57
11 3300037312 Ga0395899_0391011 Ga0395899_0391011_78_257 57
12 3300037418 Ga0395900_0000380 Ga0395900_0000380_44180_44359 57
13 3300037471 Ga0395905_0001357 Ga0395905_0001357_3063_3242 57
14 3300038443 Ga0395901_0002790 Ga0395901_0002790_11929_12108 57
15 3300005458 Ga0070681_10302279 Ga0070681_103022792 59
16 3300005543 Ga0070672_100496124 Ga0070672_1004961243 59
17 3300031731 Ga0307405_10081046 Ga0307405_100810462 59
18 3300031731 Ga0307405_10322618 Ga0307405_103226182 59
19 3300031731 Ga0307405_10328461 Ga0307405_103284612 59
20 3300031824 Ga0307413_10012950 Ga0307413_100129504 59
21 3300031824 Ga0307413_10027244 Ga0307413_100272443 59
22 3300031824 Ga0307413_10070953 Ga0307413_100709534 59
23 3300031824 Ga0307413_10639068 Ga0307413_106390681 59
24 3300031824 Ga0307413_11229506 Ga0307413_112295062 59
25 3300031852 Ga0307410_10009475 Ga0307410_100094756 59
26 3300031852 Ga0307410_10044369 Ga0307410_100443693 59
27 3300031852 Ga0307410_10365146 Ga0307410_103651462 59
28 3300031852 Ga0307410_10783944 Ga0307410_107839441 59
29 3300031901 Ga0307406_10025221 Ga0307406_100252213 59
30 3300031901 Ga0307406_10119645 Ga0307406_101196452 59
31 3300031901 Ga0307406_10484523 Ga0307406_104845232 59
32 3300031901 Ga0307406_11731207 Ga0307406_117312072 59
33 3300031901 Ga0307406_11759582 Ga0307406_117595821 59
34 3300031903 Ga0307407_10003578 Ga0307407_100035782 59
35 3300031903 Ga0307407_10041093 Ga0307407_100410935 59
36 3300031903 Ga0307407_10298967 Ga0307407_102989672 59
37 3300031911 Ga0307412_10042660 Ga0307412_100426605 59
38 3300031911 Ga0307412_11049815 Ga0307412_110498151 59
39 3300031995 Ga0307409_100021019 Ga0307409_1000210193 59
40 3300031995 Ga0307409_100110313 Ga0307409_1001103135 59
41 3300032002 Ga0307416_100140463 Ga0307416_1001404635 59
42 3300032002 Ga0307416_100317111 Ga0307416_1003171112 59
43 3300032002 Ga0307416_101468545 Ga0307416_1014685452 59
44 3300032002 Ga0307416_103706292 Ga0307416_1037062922 59
45 3300032004 Ga0307414_10004314 Ga0307414_100043141 59
46 3300032004 Ga0307414_10005052 Ga0307414_100050528 59
47 3300032004 Ga0307414_10007234 Ga0307414_100072343 59
48 3300032004 Ga0307414_10093397 Ga0307414_100933971 59
49 3300032004 Ga0307414_10471245 Ga0307414_104712452 59
50 3300032004 Ga0307414_11955023 Ga0307414_119550232 59
51 3300032005 Ga0307411_10010893 Ga0307411_100108932 59
52 3300032005 Ga0307411_10048907 Ga0307411_100489074 59
53 3300032005 Ga0307411_10060839 Ga0307411_100608392 59
54 3300032005 Ga0307411_10324772 Ga0307411_103247723 59
55 3300032005 Ga0307411_10586473 Ga0307411_105864733 59
56 3300032005 Ga0307411_11691202 Ga0307411_116912021 59
57 3300032126 Ga0307415_100129776 Ga0307415_1001297762 59
58 3300032126 Ga0307415_101091606 Ga0307415_1010916062 59
59 3300046616 Ga0495668_0504035 Ga0495668_0504035_280_474 59
60 3300049675 Ga0501243_123737 Ga0501243_123737_88_282 59
61 3300005339 Ga0070660_100534874 Ga0070660_1005348742 60
62 3300005347 Ga0070668_101270209 Ga0070668_1012702092 60
63 3300013307 Ga0157372_12429792 Ga0157372_124297923 60
64 3300025917 Ga0207660_10998315 Ga0207660_109983152 60
65 3300037418 Ga0395900_0121846 Ga0395900_0121846_583_765 60
66 3300037418 Ga0395900_1503113 Ga0395900_1503113_190_372 60
67 3300037466 Ga0395898_0451473 Ga0395898_0451473_852_1034 60
68 3300037466 Ga0395898_0662390 Ga0395898_0662390_750_932 60
69 3300037471 Ga0395905_0111296 Ga0395905_0111296_1317_1499 60
70 3300038443 Ga0395901_0129119 Ga0395901_0129119_2331_2513 60
71 3300005340 Ga0070689_100619911 Ga0070689_1006199112 61
72 3300005344 Ga0070661_100271018 Ga0070661_1002710182 61
73 3300005344 Ga0070661_100747090 Ga0070661_1007470902 61
74 3300005353 Ga0070669_100125376 Ga0070669_1001253762 61
75 3300005354 Ga0070675_100135333 Ga0070675_1001353332 61
76 3300005367 Ga0070667_100190111 Ga0070667_1001901112 61
77 3300005438 Ga0070701_10194401 Ga0070701_101944013 61
78 3300005457 Ga0070662_100035585 Ga0070662_1000355853 61
79 3300005459 Ga0068867_100055083 Ga0068867_1000550833 61
80 3300005543 Ga0070672_100279265 Ga0070672_1002792652 61
81 3300005543 Ga0070672_100776497 Ga0070672_1007764972 61
82 3300005564 Ga0070664_100005661 Ga0070664_10000566113 61
83 3300005618 Ga0068864_100624241 Ga0068864_1006242412 61
84 3300005718 Ga0068866_10550115 Ga0068866_105501152 61
85 3300005719 Ga0068861_100063960 Ga0068861_1000639603 61
86 3300005843 Ga0068860_100174117 Ga0068860_1001741174 61
87 3300005844 Ga0068862_100016695 Ga0068862_1000166956 61
88 3300005844 Ga0068862_100046121 Ga0068862_1000461215 61
89 3300006177 Ga0075362_10178417 Ga0075362_101784172 61
90 3300006358 Ga0068871_101678697 Ga0068871_1016786971 61
91 3300006880 Ga0075429_100188263 Ga0075429_1001882633 61
92 3300006881 Ga0068865_100210231 Ga0068865_1002102312 61
93 3300009094 Ga0111539_11671354 Ga0111539_116713542 61
94 3300009148 Ga0105243_10005934 Ga0105243_100059346 61
95 3300009177 Ga0105248_11766285 Ga0105248_117662853 61
96 3300013100 Ga0157373_10069932 Ga0157373_100699325 61
97 3300013306 Ga0163162_10642391 Ga0163162_106423913 61
98 3300014326 Ga0157380_10142376 Ga0157380_101423764 61
99 3300014745 Ga0157377_11670759 Ga0157377_116707591 61
100 3300025903 Ga0207680_11344626 Ga0207680_113446262 61
101 3300025907 Ga0207645_10301392 Ga0207645_103013922 61
102 3300025920 Ga0207649_10562377 Ga0207649_105623772 61
103 3300025923 Ga0207681_11650450 Ga0207681_116504502 61
104 3300025926 Ga0207659_10887043 Ga0207659_108870433 61
105 3300025933 Ga0207706_10041864 Ga0207706_100418644 61
106 3300025933 Ga0207706_11469868 Ga0207706_114698682 61
107 3300025941 Ga0207711_10194956 Ga0207711_101949563 61
108 3300025945 Ga0207679_10086909 Ga0207679_100869093 61
109 3300025986 Ga0207658_10026021 Ga0207658_100260212 61
110 3300026089 Ga0207648_10067355 Ga0207648_100673553 61
111 3300026095 Ga0207676_11065934 Ga0207676_110659341 61
112 3300026118 Ga0207675_100025061 Ga0207675_1000250612 61
113 3300027552 Ga0209982_1053174 Ga0209982_10531743 61
114 3300028380 Ga0268265_10012837 Ga0268265_100128376 61
115 3300028380 Ga0268265_10027450 Ga0268265_100274503 61
116 3300028381 Ga0268264_10083144 Ga0268264_100831442 61
117 3300031824 Ga0307413_10419368 Ga0307413_104193681 61
118 3300031903 Ga0307407_10012430 Ga0307407_100124304 61
119 3300031911 Ga0307412_10553730 Ga0307412_105537302 61
120 3300031995 Ga0307409_100008033 Ga0307409_1000080334 61
121 3300031995 Ga0307409_100451026 Ga0307409_1004510262 61
122 3300031995 Ga0307409_101278696 Ga0307409_1012786961 61
123 3300032002 Ga0307416_100101240 Ga0307416_1001012404 61
124 3300032004 Ga0307414_10047978 Ga0307414_100479785 61
125 3300032004 Ga0307414_11982426 Ga0307414_119824262 61
126 3300032005 Ga0307411_10688169 Ga0307411_106881693 61
127 3300032005 Ga0307411_11392880 Ga0307411_113928803 61
128 3300037471 Ga0395905_0369116 Ga0395905_0369116_249_434 61
129 3300041406 Ga0439439_0063488 Ga0439439_0063488_174_359 61
130 3300041999 Ga0439433_0111900 Ga0439433_0111900_421_606 61
131 3300042006 Ga0439432_030721 Ga0439432_030721_1485_1670 61
132 3300042006 Ga0439432_065098 Ga0439432_065098_140_325 61
133 3300042007 Ga0439449_0254825 Ga0439449_0254825_318_503 61
134 3300042015 Ga0439462_0063030 Ga0439462_0063030_85_270 61
135 3300042156 Ga0439446_0180578 Ga0439446_0180578_142_327 61
136 3300042156 Ga0439446_0255414 Ga0439446_0255414_175_360 61
137 3300046522 Ga0495643_0213455 Ga0495643_0213455_394_579 61
138 3300047323 Ga0495683_0318846 Ga0495683_0318846_256_453 61
139 3300048911 Ga0496108_1024933 Ga0496108_1024933_10_207 61
140 3300048917 Ga0496114_0899425 Ga0496114_0899425_396_593 61
141 3300050489 nmdc:mga03683_177310_c1 nmdc:mga03683_177310_c1_572_769 61
142 3300050491 nmdc:mga00v17_1019589_c1 nmdc:mga00v17_1019589_c1_178_375 61
143 3300050493 nmdc:mga0k408_895275_c1 nmdc:mga0k408_895275_c1_167_364 61
144 3300050508 nmdc:mga09592_385996_c1 nmdc:mga09592_385996_c1_872_1057 61
145 3300050512 nmdc:mga0n895_113438_c1 nmdc:mga0n895_113438_c1_1082_1279 61
146 3300053083 Ga0495655_0110020 Ga0495655_0110020_555_752 61
147 3300059421 Ga0590071_209592 Ga0590071_209592_109_312 61
148 3300001989 JGI24739J22299_10110552 JGI24739J22299_101105521 62
149 3300002067 JGI24735J21928_10019243 JGI24735J21928_100192431 62
150 3300005327 Ga0070658_10001186 Ga0070658_100011869 62
151 3300005327 Ga0070658_10055326 Ga0070658_100553262 62
152 3300005327 Ga0070658_10057127 Ga0070658_100571273 62
153 3300005327 Ga0070658_10144811 Ga0070658_101448114 62
154 3300005327 Ga0070658_10273727 Ga0070658_102737272 62
155 3300005327 Ga0070658_10340582 Ga0070658_103405822 62
156 3300005327 Ga0070658_10520253 Ga0070658_105202532 62
157 3300005327 Ga0070658_10922036 Ga0070658_109220361 62
158 3300005329 Ga0070683_100007551 Ga0070683_1000075514 62
159 3300005330 Ga0070690_100722645 Ga0070690_1007226452 62
160 3300005331 Ga0070670_100044239 Ga0070670_1000442393 62
161 3300005335 Ga0070666_10553813 Ga0070666_105538132 62
162 3300005336 Ga0070680_100678500 Ga0070680_1006785002 62
163 3300005338 Ga0068868_100170289 Ga0068868_1001702892 62
164 3300005339 Ga0070660_100043149 Ga0070660_1000431496 62
165 3300005339 Ga0070660_100134068 Ga0070660_1001340682 62
166 3300005339 Ga0070660_100277307 Ga0070660_1002773072 62
167 3300005339 Ga0070660_100338641 Ga0070660_1003386412 62
168 3300005344 Ga0070661_100000101 Ga0070661_10000010145 62
169 3300005344 Ga0070661_100028576 Ga0070661_1000285766 62
170 3300005344 Ga0070661_101098425 Ga0070661_1010984252 62
171 3300005345 Ga0070692_10151889 Ga0070692_101518893 62
172 3300005345 Ga0070692_10161357 Ga0070692_101613572 62
173 3300005355 Ga0070671_100002984 Ga0070671_1000029845 62
174 3300005355 Ga0070671_100022766 Ga0070671_1000227664 62
175 3300005355 Ga0070671_100872294 Ga0070671_1008722942 62
176 3300005355 Ga0070671_101211720 Ga0070671_1012117201 62
177 3300005356 Ga0070674_100006893 Ga0070674_1000068936 62
178 3300005364 Ga0070673_100076079 Ga0070673_1000760795 62
179 3300005366 Ga0070659_100000045 Ga0070659_10000004584 62
180 3300005366 Ga0070659_100019693 Ga0070659_1000196933 62
181 3300005366 Ga0070659_100030426 Ga0070659_1000304265 62
182 3300005366 Ga0070659_100139634 Ga0070659_1001396342 62
183 3300005366 Ga0070659_100279520 Ga0070659_1002795202 62
184 3300005366 Ga0070659_100530942 Ga0070659_1005309422 62
185 3300005367 Ga0070667_100643595 Ga0070667_1006435952 62
186 3300005367 Ga0070667_101409944 Ga0070667_1014099443 62
187 3300005435 Ga0070714_100006015 Ga0070714_1000060158 62
188 3300005435 Ga0070714_100183404 Ga0070714_1001834042 62
189 3300005436 Ga0070713_101252409 Ga0070713_1012524091 62
190 3300005439 Ga0070711_101544141 Ga0070711_1015441412 62
191 3300005455 Ga0070663_101462231 Ga0070663_1014622312 62
192 3300005455 Ga0070663_101761668 Ga0070663_1017616681 62
193 3300005457 Ga0070662_100000036 Ga0070662_10000003637 62
194 3300005457 Ga0070662_100010434 Ga0070662_1000104342 62
195 3300005530 Ga0070679_100059845 Ga0070679_1000598454 62
196 3300005530 Ga0070679_100171728 Ga0070679_1001717283 62
197 3300005530 Ga0070679_100223246 Ga0070679_1002232464 62
198 3300005530 Ga0070679_100378001 Ga0070679_1003780012 62
199 3300005535 Ga0070684_100025922 Ga0070684_1000259227 62
200 3300005539 Ga0068853_100000059 Ga0068853_10000005955 62
201 3300005539 Ga0068853_100287216 Ga0068853_1002872163 62
202 3300005539 Ga0068853_100464470 Ga0068853_1004644703 62
203 3300005539 Ga0068853_101436237 Ga0068853_1014362372 62
204 3300005539 Ga0068853_102147074 Ga0068853_1021470742 62
205 3300005543 Ga0070672_100209869 Ga0070672_1002098692 62
206 3300005543 Ga0070672_100548450 Ga0070672_1005484501 62
207 3300005563 Ga0068855_100176472 Ga0068855_1001764723 62
208 3300005563 Ga0068855_100387931 Ga0068855_1003879313 62
209 3300005564 Ga0070664_100301691 Ga0070664_1003016913 62
210 3300005564 Ga0070664_102111743 Ga0070664_1021117432 62
211 3300005578 Ga0068854_100937313 Ga0068854_1009373131 62
212 3300005578 Ga0068854_101407470 Ga0068854_1014074702 62
213 3300005614 Ga0068856_100664525 Ga0068856_1006645252 62
214 3300005616 Ga0068852_100435934 Ga0068852_1004359342 62
215 3300005616 Ga0068852_100538670 Ga0068852_1005386703 62
216 3300005616 Ga0068852_100812473 Ga0068852_1008124732 62
217 3300005616 Ga0068852_100965083 Ga0068852_1009650833 62
218 3300005616 Ga0068852_101162141 Ga0068852_1011621412 62
219 3300005616 Ga0068852_102438002 Ga0068852_1024380022 62
220 3300005617 Ga0068859_100868670 Ga0068859_1008686703 62
221 3300005618 Ga0068864_100003082 Ga0068864_1000030826 62
222 3300005719 Ga0068861_102136351 Ga0068861_1021363512 62
223 3300005834 Ga0068851_10059799 Ga0068851_100597992 62
224 3300005841 Ga0068863_100055164 Ga0068863_1000551642 62
225 3300005841 Ga0068863_100899260 Ga0068863_1008992602 62
226 3300005841 Ga0068863_102343173 Ga0068863_1023431732 62
227 3300005842 Ga0068858_100140898 Ga0068858_1001408983 62
228 3300006173 Ga0070716_100079997 Ga0070716_1000799974 62
229 3300006175 Ga0070712_100322386 Ga0070712_1003223862 62
230 3300006237 Ga0097621_100988822 Ga0097621_1009888222 62
231 3300006237 Ga0097621_101857847 Ga0097621_1018578472 62
232 3300006871 Ga0075434_100445797 Ga0075434_1004457972 62
233 3300006931 Ga0097620_100868641 Ga0097620_1008686413 62
234 3300009093 Ga0105240_12461189 Ga0105240_124611892 62
235 3300009177 Ga0105248_10001451 Ga0105248_100014516 62
236 3300009177 Ga0105248_10016845 Ga0105248_100168456 62
237 3300009545 Ga0105237_11663747 Ga0105237_116637472 62
238 3300012512 Ga0157327_1002491 Ga0157327_10024913 62
239 3300013100 Ga0157373_10293064 Ga0157373_102930643 62
240 3300013102 Ga0157371_10084774 Ga0157371_100847742 62
241 3300013102 Ga0157371_11042575 Ga0157371_110425752 62
242 3300013104 Ga0157370_10687069 Ga0157370_106870692 62
243 3300013105 Ga0157369_10081438 Ga0157369_100814385 62
244 3300013105 Ga0157369_10180899 Ga0157369_101808993 62
245 3300013105 Ga0157369_10526410 Ga0157369_105264102 62
246 3300013105 Ga0157369_10967051 Ga0157369_109670512 62
247 3300013296 Ga0157374_11569303 Ga0157374_115693032 62
248 3300013297 Ga0157378_11784693 Ga0157378_117846932 62
249 3300013307 Ga0157372_10397720 Ga0157372_103977202 62
250 3300013307 Ga0157372_12167492 Ga0157372_121674922 62
251 3300014968 Ga0157379_11135945 Ga0157379_111359452 62
252 3300020082 Ga0206353_10653832 Ga0206353_106538322 62
253 3300020082 Ga0206353_11758431 Ga0206353_117584312 62
254 3300025321 Ga0207656_10249109 Ga0207656_102491092 62
255 3300025904 Ga0207647_10099301 Ga0207647_100993012 62
256 3300025909 Ga0207705_10003372 Ga0207705_100033721 62
257 3300025909 Ga0207705_10023916 Ga0207705_100239165 62
258 3300025909 Ga0207705_10134701 Ga0207705_101347012 62
259 3300025909 Ga0207705_10167834 Ga0207705_101678341 62
260 3300025909 Ga0207705_10184170 Ga0207705_101841703 62
261 3300025909 Ga0207705_10296997 Ga0207705_102969972 62
262 3300025909 Ga0207705_10816993 Ga0207705_108169932 62
263 3300025909 Ga0207705_11223661 Ga0207705_112236612 62
264 3300025912 Ga0207707_10793956 Ga0207707_107939562 62
265 3300025917 Ga0207660_10082956 Ga0207660_100829562 62
266 3300025917 Ga0207660_10565295 Ga0207660_105652951 62
267 3300025919 Ga0207657_10022765 Ga0207657_100227657 62
268 3300025919 Ga0207657_10091665 Ga0207657_100916654 62
269 3300025919 Ga0207657_10112047 Ga0207657_101120473 62
270 3300025919 Ga0207657_10215276 Ga0207657_102152762 62
271 3300025919 Ga0207657_10293001 Ga0207657_102930012 62
272 3300025920 Ga0207649_10049310 Ga0207649_100493103 62
273 3300025921 Ga0207652_10360265 Ga0207652_103602652 62
274 3300025921 Ga0207652_10572056 Ga0207652_105720562 62
275 3300025923 Ga0207681_10607500 Ga0207681_106075001 62
276 3300025928 Ga0207700_10039024 Ga0207700_100390246 62
277 3300025928 Ga0207700_11013380 Ga0207700_110133802 62
278 3300025929 Ga0207664_10136409 Ga0207664_101364092 62
279 3300025929 Ga0207664_10182623 Ga0207664_101826233 62
280 3300025931 Ga0207644_10006031 Ga0207644_100060317 62
281 3300025932 Ga0207690_10011411 Ga0207690_100114113 62
282 3300025932 Ga0207690_10017441 Ga0207690_100174415 62
283 3300025932 Ga0207690_10165399 Ga0207690_101653992 62
284 3300025932 Ga0207690_10392675 Ga0207690_103926752 62
285 3300025932 Ga0207690_10417861 Ga0207690_104178612 62
286 3300025932 Ga0207690_10419238 Ga0207690_104192382 62
287 3300025937 Ga0207669_10039276 Ga0207669_100392764 62
288 3300025941 Ga0207711_10009213 Ga0207711_100092135 62
289 3300025944 Ga0207661_10081996 Ga0207661_100819963 62
290 3300025945 Ga0207679_10046773 Ga0207679_100467735 62
291 3300026023 Ga0207677_10752325 Ga0207677_107523252 62
292 3300026035 Ga0207703_10209038 Ga0207703_102090383 62
293 3300026035 Ga0207703_10486841 Ga0207703_104868413 62
294 3300026067 Ga0207678_10131025 Ga0207678_101310252 62
295 3300026067 Ga0207678_10342350 Ga0207678_103423502 62
296 3300026078 Ga0207702_10187673 Ga0207702_101876732 62
297 3300026088 Ga0207641_10684243 Ga0207641_106842432 62
298 3300026095 Ga0207676_10109833 Ga0207676_101098333 62
299 3300026116 Ga0207674_10465285 Ga0207674_104652852 62
300 3300026118 Ga0207675_100581322 Ga0207675_1005813222 62
301 3300026142 Ga0207698_10016604 Ga0207698_100166043 62
302 3300031548 Ga0307408_100860723 Ga0307408_1008607232 62
303 3300031824 Ga0307413_10266628 Ga0307413_102666282 62
304 3300031852 Ga0307410_10635208 Ga0307410_106352082 62
305 3300031903 Ga0307407_10379733 Ga0307407_103797333 62
306 3300031995 Ga0307409_101039590 Ga0307409_1010395903 62
307 3300032002 Ga0307416_100532994 Ga0307416_1005329943 62
308 3300032002 Ga0307416_100868714 Ga0307416_1008687142 62
309 3300032126 Ga0307415_100272763 Ga0307415_1002727632 62
310 3300034817 Ga0373948_0189948 Ga0373948_0189948_26_214 62
311 3300035691 Ga0373931_0166521 Ga0373931_0166521_283_471 62
312 3300037312 Ga0395899_0058462 Ga0395899_0058462_1447_1635 62
313 3300037312 Ga0395899_0130666 Ga0395899_0130666_295_483 62
314 3300037312 Ga0395899_0187322 Ga0395899_0187322_56_244 62
315 3300037312 Ga0395899_0213329 Ga0395899_0213329_515_703 62
316 3300037312 Ga0395899_0225068 Ga0395899_0225068_930_1118 62
317 3300037312 Ga0395899_0361055 Ga0395899_0361055_47_235 62
318 3300037312 Ga0395899_0441804 Ga0395899_0441804_399_587 62
319 3300037312 Ga0395899_0604445 Ga0395899_0604445_360_548 62
320 3300037312 Ga0395899_0772033 Ga0395899_0772033_129_317 62
321 3300037312 Ga0395899_0819885 Ga0395899_0819885_38_226 62
322 3300037418 Ga0395900_0001277 Ga0395900_0001277_7850_8038 62
323 3300037418 Ga0395900_0009772 Ga0395900_0009772_5313_5501 62
324 3300037418 Ga0395900_0011611 Ga0395900_0011611_1583_1771 62
325 3300037418 Ga0395900_0015653 Ga0395900_0015653_7418_7606 62
326 3300037418 Ga0395900_0038484 Ga0395900_0038484_2487_2675 62
327 3300037418 Ga0395900_0135288 Ga0395900_0135288_1244_1432 62
328 3300037418 Ga0395900_0443721 Ga0395900_0443721_1056_1244 62
329 3300037418 Ga0395900_0777468 Ga0395900_0777468_432_620 62
330 3300037418 Ga0395900_1246082 Ga0395900_1246082_56_244 62
331 3300037418 Ga0395900_1261383 Ga0395900_1261383_56_244 62
332 3300037466 Ga0395898_0019138 Ga0395898_0019138_1268_1456 62
333 3300037466 Ga0395898_0034665 Ga0395898_0034665_746_934 62
334 3300037466 Ga0395898_0097247 Ga0395898_0097247_276_464 62
335 3300037466 Ga0395898_0097333 Ga0395898_0097333_1136_1324 62
336 3300037466 Ga0395898_0573874 Ga0395898_0573874_122_310 62
337 3300037466 Ga0395898_0622154 Ga0395898_0622154_251_439 62
338 3300037466 Ga0395898_0866790 Ga0395898_0866790_161_349 62
339 3300037466 Ga0395898_0872511 Ga0395898_0872511_138_326 62
340 3300037466 Ga0395898_1239170 Ga0395898_1239170_330_518 62
341 3300037471 Ga0395905_0001453 Ga0395905_0001453_5840_6028 62
342 3300037471 Ga0395905_0007770 Ga0395905_0007770_3797_3985 62
343 3300037471 Ga0395905_0027269 Ga0395905_0027269_187_375 62
344 3300037471 Ga0395905_0033490 Ga0395905_0033490_3309_3497 62
345 3300037471 Ga0395905_0033646 Ga0395905_0033646_3731_3919 62
346 3300037471 Ga0395905_0041087 Ga0395905_0041087_3324_3512 62
347 3300037471 Ga0395905_0117517 Ga0395905_0117517_207_395 62
348 3300037471 Ga0395905_0181096 Ga0395905_0181096_884_1072 62
349 3300037471 Ga0395905_0212082 Ga0395905_0212082_354_542 62
350 3300037471 Ga0395905_0230422 Ga0395905_0230422_694_882 62
351 3300037471 Ga0395905_0282503 Ga0395905_0282503_1289_1477 62
352 3300037471 Ga0395905_0774056 Ga0395905_0774056_573_761 62
353 3300037471 Ga0395905_0781245 Ga0395905_0781245_113_301 62
354 3300037471 Ga0395905_0781740 Ga0395905_0781740_163_351 62
355 3300038443 Ga0395901_0073452 Ga0395901_0073452_2672_2860 62
356 3300038443 Ga0395901_0113830 Ga0395901_0113830_780_968 62
357 3300038443 Ga0395901_0132852 Ga0395901_0132852_1064_1264 62
358 3300038443 Ga0395901_0151110 Ga0395901_0151110_1704_1892 62
359 3300038443 Ga0395901_0181439 Ga0395901_0181439_1147_1335 62
360 3300038443 Ga0395901_0229874 Ga0395901_0229874_1693_1881 62
361 3300038443 Ga0395901_0244441 Ga0395901_0244441_1571_1759 62
362 3300038443 Ga0395901_0256151 Ga0395901_0256151_79_267 62
363 3300038443 Ga0395901_0496079 Ga0395901_0496079_1000_1188 62
364 3300038443 Ga0395901_0540985 Ga0395901_0540985_825_1013 62
365 3300038443 Ga0395901_0712215 Ga0395901_0712215_39_227 62
366 3300038443 Ga0395901_1633456 Ga0395901_1633456_114_302 62
367 3300038443 Ga0395901_1667233 Ga0395901_1667233_77_265 62
368 3300042005 Ga0439448_0058003 Ga0439448_0058003_867_1055 62
369 3300042157 Ga0439458_0000009 Ga0439458_0000009_219_407 62
370 3300042157 Ga0439458_0000057 Ga0439458_0000057_2531_2719 62
371 3300044658 Ga0466972_0015644 Ga0466972_0015644_1045_1233 62
372 3300044683 Ga0466965_0413310 Ga0466965_0413310_139_327 62
373 3300044684 Ga0466966_0079772 Ga0466966_0079772_424_612 62
374 3300044684 Ga0466966_0224808 Ga0466966_0224808_188_376 62
375 3300044684 Ga0466966_0561880 Ga0466966_0561880_424_612 62
376 3300044684 Ga0466966_0725172 Ga0466966_0725172_94_282 62
377 3300044693 Ga0466961_0047542 Ga0466961_0047542_2242_2430 62
378 3300044694 Ga0466963_0034454 Ga0466963_0034454_182_370 62
379 3300044694 Ga0466963_0271018 Ga0466963_0271018_299_487 62
380 3300044694 Ga0466963_1263976 Ga0466963_1263976_83_271 62
381 3300044706 Ga0466964_0168074 Ga0466964_0168074_214_402 62
382 3300044719 Ga0466971_0080665 Ga0466971_0080665_934_1122 62
383 3300044765 Ga0466970_0012966 Ga0466970_0012966_2293_2481 62
384 3300044842 Ga0466957_0017683 Ga0466957_0017683_90_278 62
385 3300044842 Ga0466957_0066571 Ga0466957_0066571_496_684 62
386 3300044842 Ga0466957_0094082 Ga0466957_0094082_1426_1614 62
387 3300044901 Ga0466960_0096812 Ga0466960_0096812_381_569 62
388 3300045049 Ga0466959_0075321 Ga0466959_0075321_529_717 62
389 3300045049 Ga0466959_0607810 Ga0466959_0607810_29_217 62
390 3300045836 Ga0466958_0027959 Ga0466958_0027959_113_301 62
391 3300045836 Ga0466958_0089156 Ga0466958_0089156_1352_1540 62
392 3300045836 Ga0466958_0280702 Ga0466958_0280702_766_954 62
393 3300045976 Ga0466967_0049789 Ga0466967_0049789_1895_2083 62
394 3300045976 Ga0466967_0145774 Ga0466967_0145774_344_532 62
395 3300045976 Ga0466967_0370293 Ga0466967_0370293_1043_1231 62
396 3300045976 Ga0466967_0554293 Ga0466967_0554293_140_328 62
397 3300046528 Ga0495642_0198249 Ga0495642_0198249_395_583 62
398 3300046539 Ga0495621_0451119 Ga0495621_0451119_238_426 62
399 3300046684 Ga0495669_0143888 Ga0495669_0143888_208_396 62
400 3300046684 Ga0495669_0158363 Ga0495669_0158363_566_754 62
401 3300047447 Ga0495685_082379 Ga0495685_082379_791_979 62
402 3300048904 Ga0496101_0147564 Ga0496101_0147564_129_317 62
403 3300048909 Ga0496106_0060754 Ga0496106_0060754_1923_2111 62
404 3300048909 Ga0496106_0802438 Ga0496106_0802438_45_233 62
405 3300048910 Ga0496107_0058165 Ga0496107_0058165_1645_1833 62
406 3300048910 Ga0496107_0732889 Ga0496107_0732889_454_642 62
407 3300048911 Ga0496108_0010237 Ga0496108_0010237_5936_6124 62
408 3300048912 Ga0496109_0008811 Ga0496109_0008811_3349_3537 62
409 3300048913 Ga0496110_0017674 Ga0496110_0017674_3127_3315 62
410 3300048914 Ga0496111_0001747 Ga0496111_0001747_10960_11148 62
411 3300048914 Ga0496111_0234418 Ga0496111_0234418_144_332 62
412 3300048914 Ga0496111_0507570 Ga0496111_0507570_683_871 62
413 3300048914 Ga0496111_1147676 Ga0496111_1147676_138_326 62
414 3300048915 Ga0496112_0001301 Ga0496112_0001301_1555_1743 62
415 3300048915 Ga0496112_0506609 Ga0496112_0506609_305_493 62
416 3300048916 Ga0496113_0019983 Ga0496113_0019983_2550_2738 62
417 3300049583 Ga0501067_0060672 Ga0501067_0060672_1764_1952 62
418 3300049585 Ga0501069_0072182 Ga0501069_0072182_10_198 62
419 3300049652 Ga0501202_029739 Ga0501202_029739_600_788 62
420 3300049659 Ga0501214_052815 Ga0501214_052815_355_543 62
421 3300049660 Ga0501216_080335 Ga0501216_080335_76_264 62
422 3300049663 Ga0501223_057226 Ga0501223_057226_397_585 62
423 3300049664 Ga0501224_005509 Ga0501224_005509_1549_1737 62
424 3300049667 Ga0501230_068217 Ga0501230_068217_455_643 62
425 3300049672 Ga0501239_015707 Ga0501239_015707_130_318 62
426 3300049674 Ga0501242_012471 Ga0501242_012471_833_1021 62
427 3300049675 Ga0501243_026234 Ga0501243_026234_421_609 62
428 3300049677 Ga0501247_020265 Ga0501247_020265_433_621 62
429 3300049679 Ga0501249_058726 Ga0501249_058726_603_791 62
430 3300049683 Ga0501253_092314 Ga0501253_092314_155_343 62
431 3300049704 Ga0501221_150364 Ga0501221_150364_316_504 62
432 3300049704 Ga0501221_198523 Ga0501221_198523_47_235 62
433 3300049706 Ga0501229_036310 Ga0501229_036310_18_206 62
434 3300049765 Ga0501268_025504 Ga0501268_025504_664_852 62
435 3300049767 Ga0501270_026808 Ga0501270_026808_47_235 62
436 3300049768 Ga0501271_018472 Ga0501271_018472_49_237 62
437 3300049769 Ga0501272_065147 Ga0501272_065147_269_457 62
438 3300049770 Ga0501273_026881 Ga0501273_026881_154_342 62
439 3300049779 Ga0501283_073713 Ga0501283_073713_357_545 62
440 3300061719 Ga0466962_0024832 Ga0466962_0024832_2374_2562 62
441 3300061719 Ga0466962_0059930 Ga0466962_0059930_306_494 62
442 3300061719 Ga0466962_0205764 Ga0466962_0205764_380_568 62

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03884

YacG

DNA gyrase inhibitor YacG

18

65

0.9

Feature Viewer

pLDDT pTM Quality
69.54 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map