F444828

General Info

Members Datasets Scaffolds Average Seq Length
442 230 884 129

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100124851|Ga0070659_1001248512
Length 127
Sequence MSNSKLNKPTESEMEILQVLWELGPSSVREVHDVLSETKDSGYTTTLKLMQIMYEKGLLSRNDEARSHIYSSAIKKEINGLFKGSPAKLVMHALGNHRASKEEILEIKKYLDQMETDAAAKKKVSKQ

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
229 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
230 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.01
Nodule 0
Rhizoplane 1.13
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 14.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100124851 3300005366 Bacteria 2088
2 JGI24740J21852_10098442 3300001979 Bacteria 747
3 JGI25154J39366_1000022 3300002738 Bacteria 219590
4 JGI25157J39369_1006256 3300002741 Bacteria 1833
5 JGI25153J46596_10002218 3300003215 Bacteria 11341
6 rootH2_10032702 3300003320 Bacteria 7311
7 rootH2_10059525 3300003320 Bacteria 4336
8 rootH1_10131965 3300003323 Bacteria 10540
9 rootH1_10333914 3300003323 Bacteria 1289
10 JGI25160J50197_1002097 3300003354 Bacteria 9475
11 JGI25160J50197_1002580 3300003354 Bacteria 8375
12 JGI25404J52841_10077965 3300003659 Unclassified 692
13 Ga0055526_1019710 3300003771 Bacteria 2443
14 Ga0055528_1001451 3300003790 Bacteria 14459
15 Ga0055530_10002191 3300003791 Bacteria 12921
16 Ga0055531_10018875 3300003794 Bacteria 2823
17 Ga0065165_1000219 3300005262 Bacteria 100119
18 Ga0065165_1133869 3300005262 Bacteria 591
19 Ga0065714_10080916 3300005288 Bacteria 2408
20 Ga0065712_10334905 3300005290 Bacteria 808
21 Ga0070658_10002100 3300005327 Bacteria 16706
22 Ga0070658_10055839 3300005327 Bacteria 3208
23 Ga0070658_10323315 3300005327 Unclassified 1317
24 Ga0070676_10000086 3300005328 Bacteria 32492
25 Ga0070676_10457149 3300005328 Bacteria 899
26 Ga0070683_100004362 3300005329 Bacteria 11641
27 Ga0070683_100035637 3300005329 Bacteria 4548
28 Ga0070683_102119092 3300005329 Unclassified 540
29 Ga0070690_100034341 3300005330 Bacteria 3178
30 Ga0070690_101123506 3300005330 Bacteria 624
31 Ga0070670_100515738 3300005331 Unclassified 1064
32 Ga0070670_101049214 3300005331 Unclassified 742
33 Ga0070670_101960758 3300005331 Bacteria 539
34 Ga0070677_10174303 3300005333 Unclassified 1019
35 Ga0070677_10268654 3300005333 Bacteria 854
36 Ga0068869_100063467 3300005334 Bacteria 2714
37 Ga0068869_100614881 3300005334 Bacteria 919
38 Ga0070666_10012726 3300005335 Bacteria 5317
39 Ga0070680_100006663 3300005336 Bacteria 8788
40 Ga0070680_100007125 3300005336 Bacteria 8518
41 Ga0070680_100040138 3300005336 Bacteria 3788
42 Ga0070682_100000060 3300005337 Bacteria 105136
43 Ga0070682_100040615 3300005337 Bacteria 2863
44 Ga0070682_101139469 3300005337 Bacteria 655
45 Ga0068868_100000420 3300005338 Bacteria 28736
46 Ga0068868_100036600 3300005338 Bacteria 3800
47 Ga0070660_100014935 3300005339 Bacteria 5603
48 Ga0070660_100198337 3300005339 Bacteria 1627
49 Ga0070689_100507206 3300005340 Unclassified 1034
50 Ga0070687_100058973 3300005343 Bacteria 2019
51 Ga0070661_100920509 3300005344 Bacteria 722
52 Ga0070661_101248269 3300005344 Bacteria 622
53 Ga0070668_100000077 3300005347 Bacteria 60697
54 Ga0070668_100831015 3300005347 Unclassified 822
55 Ga0070675_100049532 3300005354 Bacteria 3448
56 Ga0070675_100049867 3300005354 Bacteria 3437
57 Ga0070671_100013354 3300005355 Bacteria 6620
58 Ga0070671_101422279 3300005355 Unclassified 613
59 Ga0070674_100301886 3300005356 Bacteria 1277
60 Ga0070674_100614804 3300005356 Unclassified 920
61 Ga0070673_100000072 3300005364 Bacteria 43011
62 Ga0070673_100060409 3300005364 Bacteria 3004
63 Ga0070659_100073875 3300005366 Bacteria 2715
64 Ga0070667_100000693 3300005367 Bacteria 32502
65 Ga0070667_100163435 3300005367 Bacteria 1962
66 Ga0070710_11003279 3300005437 Bacteria 608
67 Ga0070701_10150882 3300005438 Unclassified 1338
68 Ga0070700_100059539 3300005441 Bacteria 2405
69 Ga0070663_100020447 3300005455 Bacteria 4384
70 Ga0070663_100204333 3300005455 Bacteria 1543
71 Ga0070663_101743605 3300005455 Unclassified 557
72 Ga0070678_100566375 3300005456 Bacteria 1010
73 Ga0070662_100016267 3300005457 Bacteria 4992
74 Ga0070662_100275550 3300005457 Bacteria 1360
75 Ga0068867_100000558 3300005459 Bacteria 24610
76 Ga0068867_100180219 3300005459 Bacteria 1679
77 Ga0068867_100901805 3300005459 Bacteria 795
78 Ga0068867_101545215 3300005459 Unclassified 619
79 Ga0070679_100024582 3300005530 Bacteria 5906
80 Ga0070679_100112563 3300005530 Bacteria 2707
81 Ga0070679_100390716 3300005530 Bacteria 1337
82 Ga0070684_100009520 3300005535 Bacteria 7655
83 Ga0070684_100281799 3300005535 Bacteria 1523
84 Ga0068853_100021270 3300005539 Bacteria 5406
85 Ga0068853_100023908 3300005539 Bacteria 5121
86 Ga0068853_100283105 3300005539 Bacteria 1529
87 Ga0070672_100000240 3300005543 Bacteria 30633
88 Ga0070672_100024126 3300005543 Bacteria 4489
89 Ga0070672_100670151 3300005543 Unclassified 907
90 Ga0070693_100144625 3300005547 Bacteria 1500
91 Ga0070665_100001677 3300005548 Bacteria 25513
92 Ga0070665_100838626 3300005548 Bacteria 932
93 Ga0068855_100007759 3300005563 Bacteria 12959
94 Ga0068855_100020874 3300005563 Bacteria 7855
95 Ga0068855_100024443 3300005563 Bacteria 7228
96 Ga0068855_100024561 3300005563 Bacteria 7210
97 Ga0068855_100088500 3300005563 Bacteria 3576
98 Ga0070664_100034244 3300005564 Bacteria 4260
99 Ga0070664_100164631 3300005564 Bacteria 1964
100 Ga0068857_100306705 3300005577 Bacteria 1464
101 Ga0068857_100323186 3300005577 Bacteria 1425
102 Ga0068854_100190356 3300005578 Bacteria 1607
103 Ga0068854_100441229 3300005578 Unclassified 1085
104 Ga0068854_100456077 3300005578 Bacteria 1069
105 Ga0068854_100624731 3300005578 Bacteria 922
106 Ga0068854_101232905 3300005578 Bacteria 671
107 Ga0068856_100051544 3300005614 Bacteria 4057
108 Ga0070702_100014192 3300005615 Unclassified 4039
109 Ga0068852_100076797 3300005616 Bacteria 2950
110 Ga0068852_100082011 3300005616 Unclassified 2865
111 Ga0068852_100249619 3300005616 Bacteria 1700
112 Ga0068859_100523790 3300005617 Bacteria 1280
113 Ga0068859_100946503 3300005617 Bacteria 945
114 Ga0068859_102190410 3300005617 Bacteria 610
115 Ga0068864_100000387 3300005618 Bacteria 38441
116 Ga0068864_100052948 3300005618 Bacteria 3499
117 Ga0068866_10015901 3300005718 Bacteria 3352
118 Ga0068866_10281592 3300005718 Bacteria 1030
119 Ga0068861_100422487 3300005719 Bacteria 1188
120 Ga0068861_100794593 3300005719 Unclassified 888
121 Ga0068851_10000082 3300005834 Bacteria 52889
122 Ga0068870_10107489 3300005840 Bacteria 1587
123 Ga0068863_100003731 3300005841 Bacteria 15063
124 Ga0068863_101198390 3300005841 Unclassified 765
125 Ga0068858_100000634 3300005842 Bacteria 36584
126 Ga0068858_100327095 3300005842 Bacteria 1466
127 Ga0068860_100011739 3300005843 Bacteria 8633
128 Ga0068860_100042236 3300005843 Bacteria 4356
129 Ga0068860_100525899 3300005843 Bacteria 1183
130 Ga0068860_102074399 3300005843 Unclassified 590
131 Ga0068862_100500802 3300005844 Bacteria 1153
132 Ga0081540_1044331 3300005983 Bacteria 2271
133 Ga0070715_10494459 3300006163 Bacteria 699
134 Ga0070716_101231396 3300006173 Bacteria 602
135 Ga0070716_101725039 3300006173 Bacteria 517
136 Ga0075366_10021016 3300006195 Bacteria 3793
137 Ga0097621_100020536 3300006237 Bacteria 5089
138 Ga0097621_100072522 3300006237 Bacteria 2848
139 Ga0097621_100333876 3300006237 Bacteria 1345
140 Ga0097621_100362196 3300006237 Bacteria 1292
141 Ga0075370_10388663 3300006353 Bacteria 836
142 Ga0068871_100012118 3300006358 Bacteria 6347
143 Ga0068871_100141288 3300006358 Bacteria 2047
144 Ga0068871_100145382 3300006358 Bacteria 2018
145 Ga0068871_100471274 3300006358 Bacteria 1128
146 Ga0068871_101094401 3300006358 Bacteria 745
147 Ga0075434_100910700 3300006871 Unclassified 894
148 Ga0068865_100013931 3300006881 Bacteria 5099
149 Ga0097620_100523745 3300006931 Bacteria 1280
150 Ga0097620_100946502 3300006931 Bacteria 945
151 Ga0097620_102191078 3300006931 Bacteria 610
152 Ga0105240_10000893 3300009093 Bacteria 53349
153 Ga0105240_10108731 3300009093 Bacteria 3359
154 Ga0105240_10156916 3300009093 Bacteria 2705
155 Ga0105240_10172594 3300009093 Bacteria 2559
156 Ga0105240_10271381 3300009093 Bacteria 1953
157 Ga0105240_10701269 3300009093 Bacteria 1105
158 Ga0111539_10127844 3300009094 Bacteria 2976
159 Ga0105245_10515593 3300009098 Bacteria 1213
160 Ga0105247_11375627 3300009101 Unclassified 570
161 Ga0105243_10861113 3300009148 Bacteria 898
162 Ga0105241_10125905 3300009174 Bacteria 2069
163 Ga0105241_11953276 3300009174 Bacteria 576
164 Ga0105242_10366624 3300009176 Bacteria 1335
165 Ga0105242_10752544 3300009176 Bacteria 959
166 Ga0105242_10951998 3300009176 Bacteria 863
167 Ga0105248_10053177 3300009177 Bacteria 4544
168 Ga0105248_10339380 3300009177 Bacteria 1692
169 Ga0105237_10010078 3300009545 Bacteria 10080
170 Ga0105237_10267938 3300009545 Bacteria 1711
171 Ga0105238_10265337 3300009551 Bacteria 1697
172 Ga0105249_10002750 3300009553 Bacteria 15212
173 Ga0105249_13364703 3300009553 Bacteria 515
174 Ga0105239_10000345 3300010375 Bacteria 67861
175 Ga0105239_10201674 3300010375 Bacteria 2229
176 Ga0105239_10475209 3300010375 Bacteria 1420
177 Ga0105239_10511275 3300010375 Bacteria 1366
178 Ga0105246_10465153 3300011119 Bacteria 1066
179 Ga0157373_10008614 3300013100 Bacteria 7573
180 Ga0157373_10111373 3300013100 Bacteria 1924
181 Ga0157373_10224525 3300013100 Bacteria 1325
182 Ga0157371_10000168 3300013102 Bacteria 95185
183 Ga0157371_10000932 3300013102 Bacteria 32766
184 Ga0157371_10006429 3300013102 Bacteria 9700
185 Ga0157371_10013834 3300013102 Bacteria 6113
186 Ga0157371_10101337 3300013102 Bacteria 2043
187 Ga0157371_10211891 3300013102 Bacteria 1390
188 Ga0157371_10993003 3300013102 Unclassified 640
189 Ga0157370_10002455 3300013104 Bacteria 22373
190 Ga0157370_10005337 3300013104 Bacteria 14436
191 Ga0157370_10082147 3300013104 Bacteria 3031
192 Ga0157370_10127372 3300013104 Bacteria 2376
193 Ga0157370_10367510 3300013104 Bacteria 1326
194 Ga0157370_10422526 3300013104 Bacteria 1226
195 Ga0157370_10767683 3300013104 Bacteria 878
196 Ga0157370_11868514 3300013104 Bacteria 539
197 Ga0157369_10016124 3300013105 Bacteria 8409
198 Ga0157369_10036510 3300013105 Bacteria 5383
199 Ga0157369_10178180 3300013105 Unclassified 2237
200 Ga0157369_10198782 3300013105 Unclassified 2104
201 Ga0157369_10257799 3300013105 Bacteria 1819
202 Ga0157369_10735080 3300013105 Unclassified 1016
203 Ga0157369_11556649 3300013105 Bacteria 672
204 Ga0157374_10000089 3300013296 Bacteria 89250
205 Ga0157374_11003106 3300013296 Unclassified 854
206 Ga0157378_10008467 3300013297 Bacteria 8960
207 Ga0157378_10008790 3300013297 Bacteria 8791
208 Ga0157378_10127538 3300013297 Bacteria 2352
209 Ga0163162_10000084 3300013306 Bacteria 86252
210 Ga0163162_10663679 3300013306 Bacteria 1166
211 Ga0163162_11932084 3300013306 Unclassified 676
212 Ga0163162_12420847 3300013306 Bacteria 604
213 Ga0163162_12759068 3300013306 Unclassified 565
214 Ga0157372_10021087 3300013307 Bacteria 7037
215 Ga0157372_10024500 3300013307 Bacteria 6557
216 Ga0157372_10024598 3300013307 Bacteria 6545
217 Ga0157372_10041780 3300013307 Bacteria 5069
218 Ga0157372_10116164 3300013307 Unclassified 3068
219 Ga0157372_10246995 3300013307 Unclassified 2071
220 Ga0157372_10346740 3300013307 Bacteria 1730
221 Ga0157372_10420189 3300013307 Bacteria 1558
222 Ga0157372_10468477 3300013307 Bacteria 1468
223 Ga0157372_10651844 3300013307 Bacteria 1226
224 Ga0157372_11220699 3300013307 Unclassified 869
225 Ga0157375_10000219 3300013308 Bacteria 53586
226 Ga0157375_10053683 3300013308 Bacteria 3967
227 Ga0157375_10145952 3300013308 Bacteria 2497
228 Ga0157375_10171248 3300013308 Bacteria 2319
229 Ga0157375_12174742 3300013308 Bacteria 661
230 Ga0163163_10000388 3300014325 Bacteria 41885
231 Ga0157380_10000544 3300014326 Bacteria 23197
232 Ga0157380_10471102 3300014326 Bacteria 1212
233 Ga0157380_10491235 3300014326 Bacteria 1190
234 Ga0157380_13504420 3300014326 Unclassified 503
235 Ga0157377_10066030 3300014745 Bacteria 2079
236 Ga0157379_10000078 3300014968 Bacteria 63565
237 Ga0157379_10751771 3300014968 Bacteria 918
238 Ga0157376_10000686 3300014969 Bacteria 21899
239 Ga0157376_10003055 3300014969 Bacteria 11467
240 Ga0157376_10731013 3300014969 Bacteria 997
241 Ga0163161_10020313 3300017792 Bacteria 4660
242 Ga0163161_10133950 3300017792 Bacteria 1871
243 Ga0163161_11185958 3300017792 Bacteria 660
244 Ga0209646_1000003 3300025246 Bacteria 1160860
245 Ga0209026_1000354 3300025250 Bacteria 43355
246 Ga0209129_1019483 3300025258 Bacteria 1281
247 Ga0209673_1000103 3300025273 Bacteria 188104
248 Ga0209130_1056512 3300025284 Bacteria 695
249 Ga0209564_1003560 3300025295 Bacteria 10454
250 Ga0209758_1004783 3300025297 Bacteria 10956
251 Ga0209758_1008457 3300025297 Bacteria 6658
252 Ga0209758_1024514 3300025297 Bacteria 2685
253 Ga0209050_1000561 3300025298 Bacteria 60726
254 Ga0207426_1000187 3300025302 Bacteria 153809
255 Ga0207426_1000476 3300025302 Bacteria 61500
256 Ga0209257_1002131 3300025304 Bacteria 20634
257 Ga0207697_10059503 3300025315 Bacteria 1588
258 Ga0207656_10001082 3300025321 Bacteria 8911
259 Ga0207656_10476893 3300025321 Bacteria 632
260 Ga0207682_10268413 3300025893 Unclassified 796
261 Ga0207692_10807559 3300025898 Bacteria 614
262 Ga0207688_10006966 3300025901 Bacteria 6151
263 Ga0207680_10002599 3300025903 Bacteria 8420
264 Ga0207647_10055685 3300025904 Bacteria 2430
265 Ga0207647_10499591 3300025904 Unclassified 678
266 Ga0207645_10002654 3300025907 Bacteria 13918
267 Ga0207645_10036151 3300025907 Bacteria 3171
268 Ga0207645_10087546 3300025907 Bacteria 2001
269 Ga0207705_10002014 3300025909 Bacteria 15810
270 Ga0207705_10006909 3300025909 Bacteria 8382
271 Ga0207705_10341777 3300025909 Bacteria 1152
272 Ga0207707_10106772 3300025912 Bacteria 2447
273 Ga0207695_10000128 3300025913 Bacteria 226098
274 Ga0207695_10002282 3300025913 Bacteria 28668
275 Ga0207695_10167843 3300025913 Unclassified 2122
276 Ga0207695_10453489 3300025913 Bacteria 1165
277 Ga0207671_10007881 3300025914 Bacteria 9144
278 Ga0207671_10175516 3300025914 Bacteria 1665
279 Ga0207660_10005826 3300025917 Bacteria 7996
280 Ga0207662_10584402 3300025918 Unclassified 776
281 Ga0207657_10016558 3300025919 Bacteria 7105
282 Ga0207657_10060034 3300025919 Bacteria 3265
283 Ga0207657_10453821 3300025919 Bacteria 1006
284 Ga0207649_11112130 3300025920 Bacteria 623
285 Ga0207652_10000093 3300025921 Bacteria 98248
286 Ga0207652_10192544 3300025921 Unclassified 1834
287 Ga0207652_11270870 3300025921 Unclassified 638
288 Ga0207650_10704852 3300025925 Unclassified 853
289 Ga0207650_11675837 3300025925 Bacteria 539
290 Ga0207659_10239838 3300025926 Bacteria 1466
291 Ga0207659_10516815 3300025926 Bacteria 1012
292 Ga0207644_10533354 3300025931 Unclassified 970
293 Ga0207690_10063532 3300025932 Bacteria 2518
294 Ga0207690_10240607 3300025932 Bacteria 1394
295 Ga0207706_10297254 3300025933 Bacteria 1407
296 Ga0207706_10318065 3300025933 Bacteria 1355
297 Ga0207686_10782414 3300025934 Bacteria 764
298 Ga0207709_11478537 3300025935 Bacteria 563
299 Ga0207670_10403466 3300025936 Bacteria 1093
300 Ga0207669_10256973 3300025937 Bacteria 1304
301 Ga0207669_10344498 3300025937 Unclassified 1149
302 Ga0207669_11097888 3300025937 Bacteria 671
303 Ga0207704_10019524 3300025938 Bacteria 3562
304 Ga0207704_10294099 3300025938 Bacteria 1241
305 Ga0207665_10922953 3300025939 Bacteria 693
306 Ga0207691_10000014 3300025940 Bacteria 142542
307 Ga0207691_10133768 3300025940 Bacteria 2189
308 Ga0207691_10356667 3300025940 Bacteria 1251
309 Ga0207691_10723827 3300025940 Bacteria 838
310 Ga0207711_10085293 3300025941 Bacteria 2767
311 Ga0207689_10032553 3300025942 Bacteria 4336
312 Ga0207661_10016601 3300025944 Bacteria 5435
313 Ga0207679_10020229 3300025945 Bacteria 4489
314 Ga0207667_10001317 3300025949 Bacteria 31149
315 Ga0207667_10005652 3300025949 Bacteria 15254
316 Ga0207667_10029051 3300025949 Bacteria 6000
317 Ga0207667_10045061 3300025949 Bacteria 4671
318 Ga0207667_10074915 3300025949 Bacteria 3515
319 Ga0207651_10001016 3300025960 Bacteria 12403
320 Ga0207651_10129022 3300025960 Bacteria 1932
321 Ga0207712_10041805 3300025961 Bacteria 3152
322 Ga0207668_10000286 3300025972 Bacteria 33154
323 Ga0207668_10703302 3300025972 Unclassified 888
324 Ga0207640_10146749 3300025981 Bacteria 1727
325 Ga0207640_10727606 3300025981 Bacteria 853
326 Ga0207658_10002339 3300025986 Bacteria 13922
327 Ga0207658_10152096 3300025986 Unclassified 1887
328 Ga0207658_10908300 3300025986 Unclassified 802
329 Ga0207658_11098966 3300025986 Unclassified 726
330 Ga0207677_10000815 3300026023 Bacteria 17837
331 Ga0207703_10001163 3300026035 Bacteria 24833
332 Ga0207703_10244447 3300026035 Unclassified 1615
333 Ga0207639_10013294 3300026041 Bacteria 5757
334 Ga0207639_10017135 3300026041 Bacteria 5134
335 Ga0207639_10589804 3300026041 Bacteria 1024
336 Ga0207639_12068762 3300026041 Bacteria 530
337 Ga0207678_10224507 3300026067 Bacteria 1608
338 Ga0207678_10648687 3300026067 Bacteria 927
339 Ga0207708_10290745 3300026075 Bacteria 1326
340 Ga0207702_10052913 3300026078 Bacteria 3437
341 Ga0207641_10008214 3300026088 Bacteria 8628
342 Ga0207641_10853470 3300026088 Bacteria 903
343 Ga0207641_11183585 3300026088 Unclassified 764
344 Ga0207648_10000645 3300026089 Bacteria 39153
345 Ga0207648_10885792 3300026089 Unclassified 833
346 Ga0207676_10001362 3300026095 Bacteria 18180
347 Ga0207674_10189538 3300026116 Bacteria 2006
348 Ga0207674_10205763 3300026116 Bacteria 1917
349 Ga0207675_101055524 3300026118 Unclassified 832
350 Ga0207683_10060098 3300026121 Bacteria 3340
351 Ga0207683_10388185 3300026121 Bacteria 1284
352 Ga0207683_10578270 3300026121 Bacteria 1039
353 Ga0207698_10149315 3300026142 Bacteria 2026
354 Ga0207698_10186781 3300026142 Bacteria 1841
355 Ga0207698_10244450 3300026142 Bacteria 1638
356 Ga0209995_1027439 3300027471 Bacteria 950
357 Ga0268266_10002464 3300028379 Bacteria 19788
358 Ga0268266_10784506 3300028379 Bacteria 920
359 Ga0268264_10008219 3300028381 Bacteria 8667
360 Ga0268264_10040777 3300028381 Bacteria 3836
361 Ga0307515_10000001 3300028794 Bacteria 4259510
362 Ga0265324_10034508 3300029957 Unclassified 1762
363 Ga0265327_10000196 3300031251 Bacteria 127325
364 Ga0265327_10000272 3300031251 Bacteria 102100
365 Ga0265313_10015296 3300031595 Bacteria 4478
366 Ga0307516_10736258 3300031730 Unclassified 645
367 Ga0307412_11567794 3300031911 Bacteria 600
368 Ga0373953_0150528 3300035117 Bacteria 998
369 Ga0373954_0162562 3300035118 Unclassified 1093
370 Ga0373955_0361668 3300035172 Bacteria 880
371 Ga0373924_0180496 3300035410 Bacteria 929
372 Ga0373927_0927105 3300035695 Unclassified 575
373 Ga0373933_0884770 3300035724 Bacteria 588
374 Ga0373937_0074203 3300036401 Bacteria 3139
375 Ga0373937_0319568 3300036401 Bacteria 1469
376 Ga0373937_0657317 3300036401 Bacteria 994
377 Ga0395899_0010127 3300037312 Bacteria 7229
378 Ga0395899_0041937 3300037312 Bacteria 3417
379 Ga0395899_0177389 3300037312 Unclassified 1497
380 Ga0395899_0215567 3300037312 Bacteria 1332
381 Ga0395899_0265835 3300037312 Bacteria 1171
382 Ga0395900_0081539 3300037418 Bacteria 3323
383 Ga0395900_0284831 3300037418 Bacteria 1643
384 Ga0395900_0397751 3300037418 Unclassified 1342
385 Ga0395900_0795992 3300037418 Bacteria 873
386 Ga0395898_0023011 3300037466 Bacteria 6301
387 Ga0395898_0072648 3300037466 Bacteria 3323
388 Ga0395898_0089107 3300037466 Bacteria 2969
389 Ga0395905_0022120 3300037471 Bacteria 6015
390 Ga0395905_0635410 3300037471 Unclassified 969
391 Ga0395905_0865836 3300037471 Bacteria 807
392 Ga0395901_0121248 3300038443 Bacteria 2748
393 Ga0395901_0559992 3300038443 Unclassified 1157
394 Ga0395901_1738702 3300038443 Bacteria 574
395 Ga0439439_0074982 3300041406 Bacteria 909
396 Ga0451800_0312068 3300041459 Bacteria 535
397 Ga0451802_1130000 3300041460 Bacteria 874
398 Ga0439442_014998 3300042002 Bacteria 1596
399 Ga0451577_0037403 3300042876 Bacteria 4369
400 Ga0451577_0816613 3300042876 Unclassified 842
401 Ga0466965_0103749 3300044683 Unclassified 1456
402 Ga0495664_0362218 3300046477 Bacteria 873
403 Ga0495618_0658692 3300046514 Unclassified 619
404 Ga0495628_1048929 3300046516 Unclassified 559
405 Ga0495652_0449271 3300046529 Bacteria 903
406 Ga0495586_0034579 3300046535 Bacteria 2715
407 Ga0495668_0007414 3300046616 Bacteria 7012
408 Ga0495634_0463272 3300046642 Bacteria 746
409 Ga0495657_0466928 3300046675 Bacteria 738
410 Ga0495649_0028302 3300046694 Bacteria 3106
411 Ga0495600_0343474 3300046809 Bacteria 936
412 Ga0495581_0347500 3300047315 Unclassified 866
413 Ga0495674_0526024 3300047319 Unclassified 944
414 Ga0495672_0052321 3300047320 Bacteria 2399
415 Ga0495686_0414233 3300047472 Bacteria 721
416 Ga0495602_0490185 3300048088 Bacteria 861
417 Ga0496108_1242282 3300048911 Bacteria 629
418 Ga0496109_0030723 3300048912 Bacteria 4815
419 Ga0496109_2003623 3300048912 Bacteria 511
420 Ga0501033_0806247 3300049570 Bacteria 634
421 Ga0501034_0000017 3300049571 Bacteria 285938
422 Ga0501034_0025125 3300049571 Bacteria 6063
423 Ga0501034_0276426 3300049571 Bacteria 1619
424 Ga0501034_1707218 3300049571 Bacteria 502
425 Ga0501047_0427753 3300049581 Bacteria 1155
426 Ga0501048_0865702 3300049582 Bacteria 650
427 Ga0501035_0015120 3300049822 Bacteria 7123
428 Ga0501035_0178781 3300049822 Bacteria 1829
429 Ga0501044_0265216 3300049823 Bacteria 1655
430 nmdc:mga0k408_91300_c1 3300050493 Bacteria 1789
431 nmdc:mga07m45_274196_c1 3300050496 Bacteria 981
432 nmdc:mga0n895_961674_c1 3300050512 Unclassified 837
433 Ga0495619_0131975 3300053085 Bacteria 1717
434 Ga0500644_0003456 3300053088 Bacteria 3909
435 Ga0500583_0606130 3300053092 Bacteria 503
436 Ga0500652_058816 3300053131 Bacteria 1579
437 Ga0500561_0250812 3300053137 Bacteria 563
438 Ga0500568_0004209 3300053139 Bacteria 7756
439 Ga0500604_0067689 3300053151 Bacteria 1133
440 Ga0500633_0013761 3300053160 Bacteria 2277
441 2929926743 2929921140 Bacteria 8649150
442 8003156212 8003151029 Bacteria 8187759
443 Ga0070659_100124851
444 JGI24740J21852_10098442
445 JGI25154J39366_1000022
446 JGI25157J39369_1006256
447 JGI25153J46596_10002218
448 rootH2_10032702
449 rootH2_10059525
450 rootH1_10131965
451 rootH1_10333914
452 JGI25160J50197_1002097
453 JGI25160J50197_1002580
454 JGI25404J52841_10077965
455 Ga0055526_1019710
456 Ga0055528_1001451
457 Ga0055530_10002191
458 Ga0055531_10018875
459 Ga0065165_1000219
460 Ga0065165_1133869
461 Ga0065714_10080916
462 Ga0065712_10334905
463 Ga0070658_10002100
464 Ga0070658_10055839
465 Ga0070658_10323315
466 Ga0070676_10000086
467 Ga0070676_10457149
468 Ga0070683_100004362
469 Ga0070683_100035637
470 Ga0070683_102119092
471 Ga0070690_100034341
472 Ga0070690_101123506
473 Ga0070670_100515738
474 Ga0070670_101049214
475 Ga0070670_101960758
476 Ga0070677_10174303
477 Ga0070677_10268654
478 Ga0068869_100063467
479 Ga0068869_100614881
480 Ga0070666_10012726
481 Ga0070680_100006663
482 Ga0070680_100007125
483 Ga0070680_100040138
484 Ga0070682_100000060
485 Ga0070682_100040615
486 Ga0070682_101139469
487 Ga0068868_100000420
488 Ga0068868_100036600
489 Ga0070660_100014935
490 Ga0070660_100198337
491 Ga0070689_100507206
492 Ga0070687_100058973
493 Ga0070661_100920509
494 Ga0070661_101248269
495 Ga0070668_100000077
496 Ga0070668_100831015
497 Ga0070675_100049532
498 Ga0070675_100049867
499 Ga0070671_100013354
500 Ga0070671_101422279
501 Ga0070674_100301886
502 Ga0070674_100614804
503 Ga0070673_100000072
504 Ga0070673_100060409
505 Ga0070659_100073875
506 Ga0070667_100000693
507 Ga0070667_100163435
508 Ga0070710_11003279
509 Ga0070701_10150882
510 Ga0070700_100059539
511 Ga0070663_100020447
512 Ga0070663_100204333
513 Ga0070663_101743605
514 Ga0070678_100566375
515 Ga0070662_100016267
516 Ga0070662_100275550
517 Ga0068867_100000558
518 Ga0068867_100180219
519 Ga0068867_100901805
520 Ga0068867_101545215
521 Ga0070679_100024582
522 Ga0070679_100112563
523 Ga0070679_100390716
524 Ga0070684_100009520
525 Ga0070684_100281799
526 Ga0068853_100021270
527 Ga0068853_100023908
528 Ga0068853_100283105
529 Ga0070672_100000240
530 Ga0070672_100024126
531 Ga0070672_100670151
532 Ga0070693_100144625
533 Ga0070665_100001677
534 Ga0070665_100838626
535 Ga0068855_100007759
536 Ga0068855_100020874
537 Ga0068855_100024443
538 Ga0068855_100024561
539 Ga0068855_100088500
540 Ga0070664_100034244
541 Ga0070664_100164631
542 Ga0068857_100306705
543 Ga0068857_100323186
544 Ga0068854_100190356
545 Ga0068854_100441229
546 Ga0068854_100456077
547 Ga0068854_100624731
548 Ga0068854_101232905
549 Ga0068856_100051544
550 Ga0070702_100014192
551 Ga0068852_100076797
552 Ga0068852_100082011
553 Ga0068852_100249619
554 Ga0068859_100523790
555 Ga0068859_100946503
556 Ga0068859_102190410
557 Ga0068864_100000387
558 Ga0068864_100052948
559 Ga0068866_10015901
560 Ga0068866_10281592
561 Ga0068861_100422487
562 Ga0068861_100794593
563 Ga0068851_10000082
564 Ga0068870_10107489
565 Ga0068863_100003731
566 Ga0068863_101198390
567 Ga0068858_100000634
568 Ga0068858_100327095
569 Ga0068860_100011739
570 Ga0068860_100042236
571 Ga0068860_100525899
572 Ga0068860_102074399
573 Ga0068862_100500802
574 Ga0081540_1044331
575 Ga0070715_10494459
576 Ga0070716_101231396
577 Ga0070716_101725039
578 Ga0075366_10021016
579 Ga0097621_100020536
580 Ga0097621_100072522
581 Ga0097621_100333876
582 Ga0097621_100362196
583 Ga0075370_10388663
584 Ga0068871_100012118
585 Ga0068871_100141288
586 Ga0068871_100145382
587 Ga0068871_100471274
588 Ga0068871_101094401
589 Ga0075434_100910700
590 Ga0068865_100013931
591 Ga0097620_100523745
592 Ga0097620_100946502
593 Ga0097620_102191078
594 Ga0105240_10000893
595 Ga0105240_10108731
596 Ga0105240_10156916
597 Ga0105240_10172594
598 Ga0105240_10271381
599 Ga0105240_10701269
600 Ga0111539_10127844
601 Ga0105245_10515593
602 Ga0105247_11375627
603 Ga0105243_10861113
604 Ga0105241_10125905
605 Ga0105241_11953276
606 Ga0105242_10366624
607 Ga0105242_10752544
608 Ga0105242_10951998
609 Ga0105248_10053177
610 Ga0105248_10339380
611 Ga0105237_10010078
612 Ga0105237_10267938
613 Ga0105238_10265337
614 Ga0105249_10002750
615 Ga0105249_13364703
616 Ga0105239_10000345
617 Ga0105239_10201674
618 Ga0105239_10475209
619 Ga0105239_10511275
620 Ga0105246_10465153
621 Ga0157373_10008614
622 Ga0157373_10111373
623 Ga0157373_10224525
624 Ga0157371_10000168
625 Ga0157371_10000932
626 Ga0157371_10006429
627 Ga0157371_10013834
628 Ga0157371_10101337
629 Ga0157371_10211891
630 Ga0157371_10993003
631 Ga0157370_10002455
632 Ga0157370_10005337
633 Ga0157370_10082147
634 Ga0157370_10127372
635 Ga0157370_10367510
636 Ga0157370_10422526
637 Ga0157370_10767683
638 Ga0157370_11868514
639 Ga0157369_10016124
640 Ga0157369_10036510
641 Ga0157369_10178180
642 Ga0157369_10198782
643 Ga0157369_10257799
644 Ga0157369_10735080
645 Ga0157369_11556649
646 Ga0157374_10000089
647 Ga0157374_11003106
648 Ga0157378_10008467
649 Ga0157378_10008790
650 Ga0157378_10127538
651 Ga0163162_10000084
652 Ga0163162_10663679
653 Ga0163162_11932084
654 Ga0163162_12420847
655 Ga0163162_12759068
656 Ga0157372_10021087
657 Ga0157372_10024500
658 Ga0157372_10024598
659 Ga0157372_10041780
660 Ga0157372_10116164
661 Ga0157372_10246995
662 Ga0157372_10346740
663 Ga0157372_10420189
664 Ga0157372_10468477
665 Ga0157372_10651844
666 Ga0157372_11220699
667 Ga0157375_10000219
668 Ga0157375_10053683
669 Ga0157375_10145952
670 Ga0157375_10171248
671 Ga0157375_12174742
672 Ga0163163_10000388
673 Ga0157380_10000544
674 Ga0157380_10471102
675 Ga0157380_10491235
676 Ga0157380_13504420
677 Ga0157377_10066030
678 Ga0157379_10000078
679 Ga0157379_10751771
680 Ga0157376_10000686
681 Ga0157376_10003055
682 Ga0157376_10731013
683 Ga0163161_10020313
684 Ga0163161_10133950
685 Ga0163161_11185958
686 Ga0209646_1000003
687 Ga0209026_1000354
688 Ga0209129_1019483
689 Ga0209673_1000103
690 Ga0209130_1056512
691 Ga0209564_1003560
692 Ga0209758_1004783
693 Ga0209758_1008457
694 Ga0209758_1024514
695 Ga0209050_1000561
696 Ga0207426_1000187
697 Ga0207426_1000476
698 Ga0209257_1002131
699 Ga0207697_10059503
700 Ga0207656_10001082
701 Ga0207656_10476893
702 Ga0207682_10268413
703 Ga0207692_10807559
704 Ga0207688_10006966
705 Ga0207680_10002599
706 Ga0207647_10055685
707 Ga0207647_10499591
708 Ga0207645_10002654
709 Ga0207645_10036151
710 Ga0207645_10087546
711 Ga0207705_10002014
712 Ga0207705_10006909
713 Ga0207705_10341777
714 Ga0207707_10106772
715 Ga0207695_10000128
716 Ga0207695_10002282
717 Ga0207695_10167843
718 Ga0207695_10453489
719 Ga0207671_10007881
720 Ga0207671_10175516
721 Ga0207660_10005826
722 Ga0207662_10584402
723 Ga0207657_10016558
724 Ga0207657_10060034
725 Ga0207657_10453821
726 Ga0207649_11112130
727 Ga0207652_10000093
728 Ga0207652_10192544
729 Ga0207652_11270870
730 Ga0207650_10704852
731 Ga0207650_11675837
732 Ga0207659_10239838
733 Ga0207659_10516815
734 Ga0207644_10533354
735 Ga0207690_10063532
736 Ga0207690_10240607
737 Ga0207706_10297254
738 Ga0207706_10318065
739 Ga0207686_10782414
740 Ga0207709_11478537
741 Ga0207670_10403466
742 Ga0207669_10256973
743 Ga0207669_10344498
744 Ga0207669_11097888
745 Ga0207704_10019524
746 Ga0207704_10294099
747 Ga0207665_10922953
748 Ga0207691_10000014
749 Ga0207691_10133768
750 Ga0207691_10356667
751 Ga0207691_10723827
752 Ga0207711_10085293
753 Ga0207689_10032553
754 Ga0207661_10016601
755 Ga0207679_10020229
756 Ga0207667_10001317
757 Ga0207667_10005652
758 Ga0207667_10029051
759 Ga0207667_10045061
760 Ga0207667_10074915
761 Ga0207651_10001016
762 Ga0207651_10129022
763 Ga0207712_10041805
764 Ga0207668_10000286
765 Ga0207668_10703302
766 Ga0207640_10146749
767 Ga0207640_10727606
768 Ga0207658_10002339
769 Ga0207658_10152096
770 Ga0207658_10908300
771 Ga0207658_11098966
772 Ga0207677_10000815
773 Ga0207703_10001163
774 Ga0207703_10244447
775 Ga0207639_10013294
776 Ga0207639_10017135
777 Ga0207639_10589804
778 Ga0207639_12068762
779 Ga0207678_10224507
780 Ga0207678_10648687
781 Ga0207708_10290745
782 Ga0207702_10052913
783 Ga0207641_10008214
784 Ga0207641_10853470
785 Ga0207641_11183585
786 Ga0207648_10000645
787 Ga0207648_10885792
788 Ga0207676_10001362
789 Ga0207674_10189538
790 Ga0207674_10205763
791 Ga0207675_101055524
792 Ga0207683_10060098
793 Ga0207683_10388185
794 Ga0207683_10578270
795 Ga0207698_10149315
796 Ga0207698_10186781
797 Ga0207698_10244450
798 Ga0209995_1027439
799 Ga0268266_10002464
800 Ga0268266_10784506
801 Ga0268264_10008219
802 Ga0268264_10040777
803 Ga0307515_10000001
804 Ga0265324_10034508
805 Ga0265327_10000196
806 Ga0265327_10000272
807 Ga0265313_10015296
808 Ga0307516_10736258
809 Ga0307412_11567794
810 Ga0373953_0150528
811 Ga0373954_0162562
812 Ga0373955_0361668
813 Ga0373924_0180496
814 Ga0373927_0927105
815 Ga0373933_0884770
816 Ga0373937_0074203
817 Ga0373937_0319568
818 Ga0373937_0657317
819 Ga0395899_0010127
820 Ga0395899_0041937
821 Ga0395899_0177389
822 Ga0395899_0215567
823 Ga0395899_0265835
824 Ga0395900_0081539
825 Ga0395900_0284831
826 Ga0395900_0397751
827 Ga0395900_0795992
828 Ga0395898_0023011
829 Ga0395898_0072648
830 Ga0395898_0089107
831 Ga0395905_0022120
832 Ga0395905_0635410
833 Ga0395905_0865836
834 Ga0395901_0121248
835 Ga0395901_0559992
836 Ga0395901_1738702
837 Ga0439439_0074982
838 Ga0451800_0312068
839 Ga0451802_1130000
840 Ga0439442_014998
841 Ga0451577_0037403
842 Ga0451577_0816613
843 Ga0466965_0103749
844 Ga0495664_0362218
845 Ga0495618_0658692
846 Ga0495628_1048929
847 Ga0495652_0449271
848 Ga0495586_0034579
849 Ga0495668_0007414
850 Ga0495634_0463272
851 Ga0495657_0466928
852 Ga0495649_0028302
853 Ga0495600_0343474
854 Ga0495581_0347500
855 Ga0495674_0526024
856 Ga0495672_0052321
857 Ga0495686_0414233
858 Ga0495602_0490185
859 Ga0496108_1242282
860 Ga0496109_0030723
861 Ga0496109_2003623
862 Ga0501033_0806247
863 Ga0501034_0000017
864 Ga0501034_0025125
865 Ga0501034_0276426
866 Ga0501034_1707218
867 Ga0501047_0427753
868 Ga0501048_0865702
869 Ga0501035_0015120
870 Ga0501035_0178781
871 Ga0501044_0265216
872 nmdc:mga0k408_91300_c1
873 nmdc:mga07m45_274196_c1
874 nmdc:mga0n895_961674_c1
875 Ga0495619_0131975
876 Ga0500644_0003456
877 Ga0500583_0606130
878 Ga0500652_058816
879 Ga0500561_0250812
880 Ga0500568_0004209
881 Ga0500604_0067689
882 Ga0500633_0013761
883 2929926743
884 8003156212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

9

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9299 14 73
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9129 14 74
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9128 11 74
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8735 16 72
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8724 11 74
ID Description Score Start End Superfamily
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9424 11 73 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 10 73 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9373 10 71 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9299 14 73 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9272 11 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y5MU04-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9685 5 86 GO:0003677
GO:0005737
GO:0045892
AF-A0A838QGT6-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9462 2 88 GO:0003677
GO:0045892
AF-A0A7Y5MU04-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9352 5 86 GO:0003677
GO:0005737
GO:0045892
AF-A0A1G3WQU3-F1-model_v4 Transcriptional regulator 0.932 7 91 GO:0003677
GO:0045892
AF-A0A838QGT6-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9255 2 88 GO:0003677
GO:0045892

Map