F444850

General Info

Members Datasets Scaffolds Average Seq Length
442 298 884 371

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100015934|Ga0075431_1000159344
Length 391
Sequence MPDSEPSSPXXXXASATEVRNLPVPVPRPSEIARGNGEGWLARALRAIFGWNASTIRADLKDVLEGSAGAHGFSPQERKMLQNILALRERRVMDVMVPRADIIAVQRGITLGELLKVFANAGHSRLVVYDETLDDAIGMVHIRDLIAFMTARAANAKANARRKKPLPAGLDLKAVDLAMPLSETKIVREILFVPPSMPAIDLLAKMQTTRIHLALVVDEYGGADGVVSIEDIVEQIVGDIEDEHDEDAAPGVVRQADSSFVADARASLEDVAAFVGPEFEVGEVAKEVDTLAGYVATRIGRVPVRGELVPGPGPFEIEILDADPRRVKKLKIYRSLDRPRGAGRDPRRRPGEPDKAATAVGTPPRPELPVAGDESVKLSPDAAPSKSARRP

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
288 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
297 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
298 2928125067 Methylobacterium sp. 1973 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0
Rhizoplane 9.73
Rhizosphere 82.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100015934 3300006847 Bacteria 7626
2 JGI25406J46586_10002868 3300003203 Bacteria 8123
3 Ga0065715_10109883 3300005293 Bacteria 2599
4 Ga0065707_10135394 3300005295 Bacteria 1850
5 Ga0070658_10125290 3300005327 Bacteria 2138
6 Ga0070676_10031426 3300005328 Bacteria 3033
7 Ga0070670_100042388 3300005331 Bacteria 3912
8 Ga0070677_10001689 3300005333 Bacteria 6976
9 Ga0070682_100007084 3300005337 Bacteria 6309
10 Ga0068868_100003086 3300005338 Bacteria 11592
11 Ga0068868_100107518 3300005338 Bacteria 2264
12 Ga0070689_100003434 3300005340 Bacteria 10545
13 Ga0070668_100043139 3300005347 Bacteria 3459
14 Ga0070668_100053361 3300005347 Bacteria 3117
15 Ga0070669_100195541 3300005353 Bacteria 1588
16 Ga0070675_100031273 3300005354 Bacteria 4302
17 Ga0070671_100036858 3300005355 Bacteria 4054
18 Ga0070674_100008445 3300005356 Bacteria 6132
19 Ga0070674_100084718 3300005356 Bacteria 2273
20 Ga0070673_100040759 3300005364 Bacteria 3565
21 Ga0070688_100010157 3300005365 Bacteria 5181
22 Ga0070688_100010176 3300005365 Bacteria 5176
23 Ga0070659_100092548 3300005366 Bacteria 2424
24 Ga0070659_100195175 3300005366 Bacteria 1665
25 Ga0070667_100032054 3300005367 Bacteria 4382
26 Ga0070667_100130629 3300005367 Bacteria 2192
27 Ga0070709_10000882 3300005434 Bacteria 16808
28 Ga0070709_10210840 3300005434 Bacteria 1381
29 Ga0070714_100001689 3300005435 Bacteria 16045
30 Ga0070714_100022720 3300005435 Bacteria 5145
31 Ga0070713_100102979 3300005436 Bacteria 2477
32 Ga0070710_10007175 3300005437 Bacteria 5387
33 Ga0070711_100093766 3300005439 Bacteria 2169
34 Ga0070700_100009415 3300005441 Bacteria 5360
35 Ga0070694_100022122 3300005444 Bacteria 4072
36 Ga0070663_100145472 3300005455 Bacteria 1813
37 Ga0070678_100018182 3300005456 Bacteria 4551
38 Ga0070662_100028138 3300005457 Bacteria 3908
39 Ga0068867_100006680 3300005459 Bacteria 8157
40 Ga0068867_100060925 3300005459 Bacteria 2801
41 Ga0068867_100292633 3300005459 Bacteria 1339
42 Ga0070685_10006942 3300005466 Bacteria 5780
43 Ga0070698_100339735 3300005471 Bacteria 1433
44 Ga0070699_100003045 3300005518 Bacteria 14875
45 Ga0070684_100031983 3300005535 Bacteria 4482
46 Ga0070684_100083899 3300005535 Bacteria 2824
47 Ga0070697_100051084 3300005536 Bacteria 3358
48 Ga0068853_100015385 3300005539 Bacteria 6285
49 Ga0070672_100000630 3300005543 Bacteria 20636
50 Ga0070672_100039529 3300005543 Bacteria 3614
51 Ga0070696_100001477 3300005546 Bacteria 15393
52 Ga0070665_100050181 3300005548 Bacteria 4187
53 Ga0070704_100002201 3300005549 Bacteria 10864
54 Ga0070664_100104003 3300005564 Bacteria 2472
55 Ga0068856_100069717 3300005614 Bacteria 3477
56 Ga0068852_100033519 3300005616 Bacteria 4265
57 Ga0068864_100005707 3300005618 Bacteria 10206
58 Ga0068866_10002193 3300005718 Bacteria 8131
59 Ga0068861_100005727 3300005719 Bacteria 8423
60 Ga0068863_100132083 3300005841 Bacteria 2384
61 Ga0068858_100206955 3300005842 Bacteria 1856
62 Ga0068860_100025911 3300005843 Bacteria 5657
63 Ga0068862_100003247 3300005844 Bacteria 14065
64 Ga0081455_10000634 3300005937 Bacteria 45563
65 Ga0081455_10000655 3300005937 Bacteria 44851
66 Ga0081455_10011036 3300005937 Bacteria 9099
67 Ga0081540_1006263 3300005983 Bacteria 8712
68 Ga0081539_10001661 3300005985 Bacteria 36064
69 Ga0070717_10089519 3300006028 Bacteria 2596
70 Ga0075365_10004566 3300006038 Bacteria 7360
71 Ga0075365_10019998 3300006038 Bacteria 4143
72 Ga0075365_10049694 3300006038 Bacteria 2763
73 Ga0075365_10216419 3300006038 Bacteria 1343
74 Ga0075365_10251166 3300006038 Bacteria 1243
75 Ga0075363_100002417 3300006048 Bacteria 7623
76 Ga0075363_100003676 3300006048 Bacteria 6590
77 Ga0075363_100031545 3300006048 Bacteria 2748
78 Ga0075364_10003059 3300006051 Bacteria 9452
79 Ga0075364_10075499 3300006051 Bacteria 2224
80 Ga0070715_10002161 3300006163 Bacteria 5959
81 Ga0070712_100035982 3300006175 Bacteria 3365
82 Ga0070712_100046706 3300006175 Bacteria 2994
83 Ga0070712_100126300 3300006175 Bacteria 1932
84 Ga0075362_10004602 3300006177 Bacteria 4970
85 Ga0075362_10010274 3300006177 Bacteria 3649
86 Ga0075367_10025319 3300006178 Bacteria 3355
87 Ga0075367_10029973 3300006178 Bacteria 3116
88 Ga0075366_10027201 3300006195 Bacteria 3355
89 Ga0068871_100006501 3300006358 Bacteria 8276
90 Ga0068871_100106750 3300006358 Bacteria 2351
91 Ga0075428_100064263 3300006844 Bacteria 4019
92 Ga0075430_100030495 3300006846 Bacteria 4581
93 Ga0075431_100007601 3300006847 Bacteria 10791
94 Ga0075434_100138821 3300006871 Bacteria 2450
95 Ga0068865_100021334 3300006881 Bacteria 4210
96 Ga0075435_100023272 3300007076 Bacteria 4788
97 Ga0075435_100023569 3300007076 Bacteria 4763
98 Ga0075435_100088538 3300007076 Bacteria 2552
99 Ga0099794_10001341 3300007265 Bacteria 8537
100 Ga0099795_10020380 3300007788 Bacteria 2159
101 Ga0111539_10012642 3300009094 Bacteria 10576
102 Ga0111539_10661844 3300009094 Bacteria 1216
103 Ga0105245_10002495 3300009098 Bacteria 16606
104 Ga0105245_10046065 3300009098 Bacteria 3897
105 Ga0105245_10052114 3300009098 Bacteria 3669
106 Ga0105247_10004828 3300009101 Bacteria 8579
107 Ga0105247_10062344 3300009101 Bacteria 2313
108 Ga0114129_10008610 3300009147 Bacteria 14548
109 Ga0114129_10045248 3300009147 Bacteria 6187
110 Ga0114129_10122860 3300009147 Bacteria 3572
111 Ga0114129_10227166 3300009147 Bacteria 2515
112 Ga0114129_10515565 3300009147 Bacteria 1559
113 Ga0105243_10036977 3300009148 Bacteria 3792
114 Ga0105241_10049316 3300009174 Bacteria 3206
115 Ga0105242_10075413 3300009176 Bacteria 2808
116 Ga0105248_10012305 3300009177 Bacteria 9437
117 Ga0105248_10118357 3300009177 Bacteria 2988
118 Ga0105248_10459584 3300009177 Bacteria 1435
119 Ga0105238_10023335 3300009551 Bacteria 6307
120 Ga0105238_10263183 3300009551 Bacteria 1704
121 Ga0105249_10000366 3300009553 Bacteria 44857
122 Ga0105249_10020983 3300009553 Bacteria 5845
123 Ga0105239_10066348 3300010375 Bacteria 3964
124 Ga0157374_10005600 3300013296 Bacteria 10578
125 Ga0163162_10146240 3300013306 Bacteria 2480
126 Ga0163162_10272592 3300013306 Bacteria 1824
127 Ga0157372_10087232 3300013307 Bacteria 3540
128 Ga0157375_10026835 3300013308 Bacteria 5375
129 Ga0163163_10038755 3300014325 Bacteria 4646
130 Ga0157380_10122278 3300014326 Bacteria 2207
131 Ga0157380_10286485 3300014326 Bacteria 1510
132 Ga0157377_10006571 3300014745 Bacteria 5554
133 Ga0157377_10240122 3300014745 Bacteria 1169
134 Ga0157379_10036303 3300014968 Bacteria 4395
135 Ga0163161_10022790 3300017792 Bacteria 4411
136 Ga0213872_10021943 3300021361 Bacteria 2940
137 Ga0213876_10164015 3300021384 Bacteria 1182
138 Ga0207653_10027690 3300025885 Bacteria 1819
139 Ga0207682_10000660 3300025893 Bacteria 16114
140 Ga0207692_10010217 3300025898 Bacteria 3948
141 Ga0207692_10010825 3300025898 Bacteria 3859
142 Ga0207692_10043228 3300025898 Bacteria 2241
143 Ga0207688_10002814 3300025901 Bacteria 9448
144 Ga0207680_10013198 3300025903 Bacteria 4235
145 Ga0207647_10004268 3300025904 Bacteria 10599
146 Ga0207685_10003833 3300025905 Bacteria 3722
147 Ga0207699_10004149 3300025906 Bacteria 6937
148 Ga0207645_10002945 3300025907 Bacteria 13153
149 Ga0207643_10000282 3300025908 Bacteria 35347
150 Ga0207705_10017533 3300025909 Bacteria 5126
151 Ga0207684_10012746 3300025910 Bacteria 7292
152 Ga0207654_10078368 3300025911 Bacteria 1982
153 Ga0207693_10000825 3300025915 Bacteria 27536
154 Ga0207693_10012419 3300025915 Bacteria 6881
155 Ga0207693_10100129 3300025915 Bacteria 2272
156 Ga0207663_10036309 3300025916 Bacteria 2964
157 Ga0207663_10041044 3300025916 Bacteria 2817
158 Ga0207662_10003773 3300025918 Bacteria 7863
159 Ga0207662_10018249 3300025918 Bacteria 3977
160 Ga0207657_10029007 3300025919 Bacteria 5042
161 Ga0207681_10123262 3300025923 Bacteria 1904
162 Ga0207694_10028085 3300025924 Bacteria 4289
163 Ga0207694_10033723 3300025924 Bacteria 3922
164 Ga0207694_10199416 3300025924 Bacteria 1628
165 Ga0207650_10006766 3300025925 Bacteria 7817
166 Ga0207659_10019524 3300025926 Bacteria 4464
167 Ga0207659_10094212 3300025926 Bacteria 2243
168 Ga0207687_10004751 3300025927 Bacteria 9040
169 Ga0207687_10005621 3300025927 Bacteria 8288
170 Ga0207700_10004075 3300025928 Bacteria 8564
171 Ga0207700_10081205 3300025928 Bacteria 2531
172 Ga0207664_10005670 3300025929 Bacteria 8533
173 Ga0207690_10018860 3300025932 Bacteria 4237
174 Ga0207706_10001336 3300025933 Bacteria 24661
175 Ga0207709_10003540 3300025935 Bacteria 9237
176 Ga0207709_10149007 3300025935 Bacteria 1618
177 Ga0207670_10001149 3300025936 Bacteria 13922
178 Ga0207670_10095547 3300025936 Bacteria 2111
179 Ga0207669_10021132 3300025937 Bacteria 3428
180 Ga0207704_10003348 3300025938 Bacteria 7275
181 Ga0207704_10101699 3300025938 Bacteria 1918
182 Ga0207665_10000350 3300025939 Bacteria 31910
183 Ga0207665_10081922 3300025939 Bacteria 2223
184 Ga0207691_10000635 3300025940 Bacteria 34764
185 Ga0207691_10007956 3300025940 Bacteria 10200
186 Ga0207691_10091916 3300025940 Bacteria 2718
187 Ga0207711_10023118 3300025941 Bacteria 5205
188 Ga0207689_10003641 3300025942 Bacteria 14070
189 Ga0207661_10025650 3300025944 Bacteria 4484
190 Ga0207679_10075895 3300025945 Bacteria 2552
191 Ga0207651_10102994 3300025960 Bacteria 2123
192 Ga0207712_10002399 3300025961 Bacteria 12137
193 Ga0207712_10175085 3300025961 Bacteria 1681
194 Ga0207668_10005993 3300025972 Bacteria 7164
195 Ga0207658_10018992 3300025986 Bacteria 4754
196 Ga0207677_10006182 3300026023 Bacteria 6546
197 Ga0207677_10081662 3300026023 Bacteria 2320
198 Ga0207703_10008972 3300026035 Bacteria 7879
199 Ga0207703_10019067 3300026035 Bacteria 5358
200 Ga0207639_10017917 3300026041 Bacteria 5023
201 Ga0207639_10121472 3300026041 Bacteria 2147
202 Ga0207708_10001330 3300026075 Bacteria 18590
203 Ga0207641_10244567 3300026088 Bacteria 1673
204 Ga0207648_10001759 3300026089 Bacteria 23721
205 Ga0207648_10011750 3300026089 Bacteria 8232
206 Ga0207676_10001268 3300026095 Bacteria 18787
207 Ga0207674_10023720 3300026116 Bacteria 6566
208 Ga0207675_100174325 3300026118 Bacteria 2057
209 Ga0207683_10007301 3300026121 Bacteria 9470
210 Ga0207698_10026542 3300026142 Bacteria 4098
211 Ga0209179_1002344 3300027512 Bacteria 2543
212 Ga0207428_10068984 3300027907 Bacteria 2780
213 Ga0207428_10078257 3300027907 Bacteria 2587
214 Ga0268266_10030131 3300028379 Bacteria 4610
215 Ga0268265_10003591 3300028380 Bacteria 11076
216 Ga0268265_10062045 3300028380 Bacteria 2871
217 Ga0268264_10005325 3300028381 Bacteria 10898
218 Ga0265332_10012410 3300031238 Bacteria 3782
219 Ga0265325_10000888 3300031241 Bacteria 21577
220 Ga0265325_10012326 3300031241 Bacteria 4891
221 Ga0265329_10013808 3300031242 Bacteria 2866
222 Ga0265331_10023837 3300031250 Bacteria 3102
223 Ga0265316_10025713 3300031344 Bacteria 4909
224 Ga0265316_10129255 3300031344 Bacteria 1904
225 Ga0265313_10009626 3300031595 Bacteria 6249
226 Ga0265313_10010974 3300031595 Bacteria 5669
227 Ga0373923_0000430 3300035111 Bacteria 9861
228 Ga0373936_0003085 3300035113 Bacteria 6235
229 Ga0373945_0043349 3300035116 Bacteria 1632
230 Ga0373953_0022985 3300035117 Bacteria 2357
231 Ga0373954_0002962 3300035118 Bacteria 7168
232 Ga0373957_0004046 3300035120 Bacteria 4418
233 Ga0373946_0002008 3300035171 Bacteria 7125
234 Ga0373946_0015721 3300035171 Bacteria 2874
235 Ga0373955_0001169 3300035172 Bacteria 11147
236 Ga0373947_0001141 3300035725 Bacteria 16319
237 Ga0373947_0007791 3300035725 Bacteria 6187
238 Ga0373947_0014001 3300035725 Bacteria 4597
239 Ga0373947_0072875 3300035725 Bacteria 2110
240 Ga0373937_0000081 3300036401 Bacteria 88009
241 Ga0373925_0000425 3300037068 Bacteria 42725
242 Ga0373925_0037914 3300037068 Bacteria 3560
243 Ga0395899_0033323 3300037312 Bacteria 3868
244 Ga0395899_0085476 3300037312 Bacteria 2292
245 Ga0395900_0026341 3300037418 Bacteria 5955
246 Ga0395898_0021059 3300037466 Bacteria 6616
247 Ga0395898_0036035 3300037466 Bacteria 4916
248 Ga0395898_0038548 3300037466 Bacteria 4735
249 Ga0395898_0039737 3300037466 Bacteria 4655
250 Ga0436364_1106114 3300037853 Bacteria 1894
251 Ga0395901_0013570 3300038443 Bacteria 8284
252 Ga0395901_0020734 3300038443 Bacteria 6728
253 Ga0436365_1000379 3300039437 Bacteria 3753
254 Ga0436360_0108197 3300039438 Bacteria 2483
255 Ga0436361_0511179 3300039447 Bacteria 1596
256 Ga0436361_0950726 3300039447 Bacteria 11725
257 Ga0436362_0908277 3300039453 Bacteria 1339
258 Ga0439443_002819 3300042003 Bacteria 2124
259 Ga0466966_0048107 3300044684 Bacteria 2717
260 Ga0466961_0122225 3300044693 Bacteria 1634
261 Ga0466963_0055780 3300044694 Bacteria 2628
262 Ga0466963_0113798 3300044694 Bacteria 1859
263 Ga0466968_0019964 3300044735 Bacteria 2701
264 Ga0466970_0060901 3300044765 Bacteria 2022
265 Ga0466957_0010961 3300044842 Bacteria 5214
266 Ga0466957_0055852 3300044842 Bacteria 2413
267 Ga0466959_0102515 3300045049 Bacteria 2048
268 Ga0466958_0068116 3300045836 Bacteria 2175
269 Ga0466958_0079469 3300045836 Bacteria 2017
270 Ga0466967_0094642 3300045976 Bacteria 2721
271 Ga0495592_0000107 3300046454 Bacteria 74318
272 Ga0495603_0019766 3300046455 Bacteria 4077
273 Ga0495603_0084859 3300046455 Bacteria 1854
274 Ga0495591_030163 3300046458 Bacteria 1640
275 Ga0495638_0025142 3300046460 Bacteria 3874
276 Ga0495638_0030134 3300046460 Bacteria 3495
277 Ga0495641_0012363 3300046461 Bacteria 4781
278 Ga0495651_0000541 3300046462 Bacteria 29187
279 Ga0495653_0000054 3300046463 Bacteria 102885
280 Ga0495582_0110467 3300046473 Bacteria 1544
281 Ga0495639_0022708 3300046475 Bacteria 2753
282 Ga0495662_0003262 3300046476 Bacteria 8204
283 Ga0495662_0050114 3300046476 Bacteria 2015
284 Ga0495664_0000020 3300046477 Bacteria 150749
285 Ga0495584_0042495 3300046491 Bacteria 2294
286 Ga0495584_0044357 3300046491 Bacteria 2244
287 Ga0495584_0047069 3300046491 Bacteria 2175
288 Ga0495585_0039784 3300046492 Bacteria 2642
289 Ga0495585_0078047 3300046492 Bacteria 1797
290 Ga0495607_0075613 3300046501 Bacteria 1866
291 Ga0495607_0084253 3300046501 Bacteria 1740
292 Ga0495608_0000024 3300046511 Bacteria 159429
293 Ga0495618_0000020 3300046514 Bacteria 130661
294 Ga0495628_0000015 3300046516 Bacteria 198912
295 Ga0495630_0001945 3300046517 Bacteria 14370
296 Ga0495630_0067915 3300046517 Bacteria 2680
297 Ga0495630_0087218 3300046517 Bacteria 2357
298 Ga0495663_0005144 3300046525 Bacteria 3647
299 Ga0495652_0000006 3300046529 Bacteria 459709
300 Ga0495640_0000002 3300046533 Bacteria 646434
301 Ga0495586_0039837 3300046535 Bacteria 2527
302 Ga0495587_0000001 3300046536 Bacteria 724132
303 Ga0495598_0000233 3300046537 Bacteria 9950
304 Ga0495645_0000013 3300046543 Bacteria 186399
305 Ga0495622_0037687 3300046557 Bacteria 2252
306 Ga0495633_0020170 3300046558 Bacteria 3357
307 Ga0495667_0000030 3300046559 Bacteria 147898
308 Ga0495656_0003244 3300046615 Bacteria 5488
309 Ga0495656_0003715 3300046615 Bacteria 5180
310 Ga0495656_0014316 3300046615 Bacteria 2972
311 Ga0495668_0114983 3300046616 Bacteria 1472
312 Ga0495634_0002355 3300046642 Bacteria 15774
313 Ga0495635_0000001 3300046663 Bacteria 704901
314 Ga0495661_0043712 3300046665 Bacteria 2752
315 Ga0495657_0000028 3300046675 Bacteria 131008
316 Ga0495599_0000056 3300046678 Bacteria 76761
317 Ga0495623_0000013 3300046679 Bacteria 119870
318 Ga0495646_0000003 3300046680 Bacteria 287773
319 Ga0495647_0031271 3300046681 Bacteria 1979
320 Ga0495658_0064299 3300046683 Bacteria 2113
321 Ga0495613_0136080 3300046689 Bacteria 1758
322 Ga0495624_0009810 3300046690 Bacteria 6624
323 Ga0495624_0032136 3300046690 Bacteria 3404
324 Ga0495670_0081844 3300046691 Bacteria 1645
325 Ga0495600_0000002 3300046809 Bacteria 186597
326 Ga0495604_0000001 3300047317 Bacteria 708627
327 Ga0495674_0000018 3300047319 Bacteria 204024
328 Ga0495674_0016576 3300047319 Bacteria 6875
329 Ga0495676_0021358 3300047321 Bacteria 5656
330 Ga0495680_0000159 3300047322 Bacteria 68873
331 Ga0495684_0000010 3300047471 Bacteria 198915
332 Ga0495593_0002238 3300047673 Bacteria 11604
333 Ga0495593_0076166 3300047673 Bacteria 1739
334 Ga0495602_0000016 3300048088 Bacteria 190311
335 Ga0495602_0074468 3300048088 Bacteria 2886
336 Ga0496100_0001513 3300048903 Bacteria 11387
337 Ga0496101_0001682 3300048904 Bacteria 13254
338 Ga0496101_0056932 3300048904 Bacteria 2826
339 Ga0496101_0065134 3300048904 Bacteria 2656
340 Ga0496101_0086785 3300048904 Bacteria 2321
341 Ga0496102_0003377 3300048905 Bacteria 13531
342 Ga0496102_0190409 3300048905 Bacteria 1933
343 Ga0496103_0016132 3300048906 Bacteria 4457
344 Ga0496104_0000431 3300048907 Bacteria 36365
345 Ga0496104_0001133 3300048907 Bacteria 22800
346 Ga0496104_0007436 3300048907 Bacteria 9680
347 Ga0496105_0002032 3300048908 Bacteria 14631
348 Ga0496105_0003143 3300048908 Bacteria 12154
349 Ga0496105_0007813 3300048908 Bacteria 8302
350 Ga0496105_0019743 3300048908 Bacteria 5437
351 Ga0496106_0012702 3300048909 Bacteria 6221
352 Ga0496106_0039362 3300048909 Bacteria 3540
353 Ga0496106_0047281 3300048909 Bacteria 3238
354 Ga0496107_0000436 3300048910 Bacteria 22636
355 Ga0496107_0062550 3300048910 Bacteria 2697
356 Ga0496107_0083454 3300048910 Bacteria 2330
357 Ga0496107_0229420 3300048910 Bacteria 1381
358 Ga0496108_0001616 3300048911 Bacteria 17871
359 Ga0496108_0052905 3300048911 Bacteria 3404
360 Ga0496108_0175815 3300048911 Bacteria 1853
361 Ga0496109_0000404 3300048912 Bacteria 38842
362 Ga0496109_0006252 3300048912 Bacteria 10015
363 Ga0496109_0107925 3300048912 Bacteria 2587
364 Ga0496110_0001910 3300048913 Bacteria 15419
365 Ga0496110_0002394 3300048913 Bacteria 14052
366 Ga0496110_0004191 3300048913 Bacteria 11143
367 Ga0496110_0106530 3300048913 Bacteria 2516
368 Ga0496111_0000892 3300048914 Bacteria 16248
369 Ga0496111_0001774 3300048914 Bacteria 12653
370 Ga0496111_0106669 3300048914 Bacteria 2062
371 Ga0496112_0003601 3300048915 Bacteria 12888
372 Ga0496113_0001396 3300048916 Bacteria 13436
373 Ga0496113_0001735 3300048916 Bacteria 12339
374 Ga0496114_0003326 3300048917 Bacteria 12354
375 Ga0496114_0109441 3300048917 Bacteria 2366
376 Ga0496115_0012441 3300048918 Bacteria 6405
377 Ga0496115_0062183 3300048918 Bacteria 3011
378 Ga0496115_0187853 3300048918 Bacteria 1707
379 Ga0501033_0048394 3300049570 Bacteria 3158
380 Ga0501034_0014136 3300049571 Bacteria 8226
381 Ga0501034_0082785 3300049571 Bacteria 3211
382 Ga0501036_0017243 3300049572 Bacteria 6035
383 Ga0501038_0058070 3300049574 Bacteria 3319
384 Ga0501043_0016961 3300049579 Bacteria 5708
385 Ga0501046_0096425 3300049580 Bacteria 2272
386 Ga0501047_0016311 3300049581 Bacteria 7088
387 Ga0501048_0059358 3300049582 Bacteria 2711
388 Ga0501070_0059416 3300049586 Bacteria 3169
389 Ga0501072_0170539 3300049588 Bacteria 1737
390 Ga0501073_0103827 3300049589 Bacteria 1973
391 Ga0501074_0141477 3300049590 Bacteria 1721
392 Ga0501075_0254753 3300049591 Bacteria 1338
393 Ga0501076_0017323 3300049592 Bacteria 5474
394 Ga0501076_0181939 3300049592 Bacteria 1714
395 Ga0501077_0033340 3300049593 Bacteria 3277
396 Ga0501079_0008594 3300049741 Bacteria 7751
397 Ga0501079_0260281 3300049741 Bacteria 1356
398 Ga0501080_0293505 3300049742 Bacteria 1476
399 Ga0501081_0002742 3300049743 Bacteria 11160
400 Ga0501035_0014264 3300049822 Bacteria 7335
401 Ga0501044_0009295 3300049823 Bacteria 10727
402 Ga0501044_0043628 3300049823 Bacteria 4658
403 Ga0501044_0214615 3300049823 Bacteria 1877
404 nmdc:mga03683_38158_c1 3300050489 Bacteria 1961
405 nmdc:mga03n38_1006_c1 3300050490 Bacteria 7714
406 nmdc:mga03n38_31269_c1 3300050490 Bacteria 2245
407 nmdc:mga00v17_3607_c1 3300050491 Bacteria 7997
408 nmdc:mga00v17_48843_c1 3300050491 Bacteria 2565
409 nmdc:mga06z11_13348_c1 3300050494 Bacteria 3604
410 nmdc:mga05p37_14557_c1 3300050507 Bacteria 9445
411 nmdc:mga05p37_20281_c1 3300050507 Bacteria 8044
412 nmdc:mga05p37_30731_c1 3300050507 Bacteria 6554
413 nmdc:mga05p37_33695_c1 3300050507 Bacteria 6273
414 nmdc:mga05p37_54663_c1 3300050507 Bacteria 4911
415 nmdc:mga09592_42505_c1 3300050508 Bacteria 3822
416 nmdc:mga09592_96440_c1 3300050508 Bacteria 2530
417 nmdc:mga08y16_156127_c1 3300050511 Bacteria 2371
418 nmdc:mga08y16_48648_c1 3300050511 Bacteria 4437
419 nmdc:mga0n895_45902_c1 3300050512 Bacteria 4266
420 nmdc:mga0n895_62501_c1 3300050512 Bacteria 3681
421 nmdc:mga0a205_98685_c1 3300050515 Bacteria 2819
422 nmdc:mga0sz30_40381_c1 3300050516 Bacteria 1961
423 Ga0495601_0000021 3300053077 Bacteria 159355
424 Ga0495612_0000018 3300053078 Bacteria 150870
425 Ga0495655_0004748 3300053083 Bacteria 2350
426 Ga0495595_0000042 3300053084 Bacteria 67264
427 Ga0495619_0000006 3300053085 Bacteria 384835
428 Ga0495619_0004954 3300053085 Bacteria 8458
429 Ga0500562_023420 3300053108 Bacteria 1612
430 Ga0500642_0023932 3300053130 Bacteria 2460
431 Ga0500568_0033002 3300053139 Bacteria 2127
432 Ga0500577_0070283 3300053142 Bacteria 1371
433 Ga0500616_0022768 3300053153 Bacteria 3495
434 Ga0500627_0054262 3300053158 Bacteria 1753
435 Ga0501082_0000145 3300060353 Bacteria 58967
436 Ga0501082_0010181 3300060353 Bacteria 8100
437 Ga0501082_0154055 3300060353 Bacteria 1997
438 Ga0466962_0045642 3300061719 Bacteria 2094
439 Ga0530510_0067536 3300061734 Bacteria 2594
440 2596371723 2595698237 Bacteria 6712432
441 2902411162 2902405164 Bacteria 6784948
442 2928127983 2928125067 Bacteria 5937560
443 Ga0075431_100015934
444 JGI25406J46586_10002868
445 Ga0065715_10109883
446 Ga0065707_10135394
447 Ga0070658_10125290
448 Ga0070676_10031426
449 Ga0070670_100042388
450 Ga0070677_10001689
451 Ga0070682_100007084
452 Ga0068868_100003086
453 Ga0068868_100107518
454 Ga0070689_100003434
455 Ga0070668_100043139
456 Ga0070668_100053361
457 Ga0070669_100195541
458 Ga0070675_100031273
459 Ga0070671_100036858
460 Ga0070674_100008445
461 Ga0070674_100084718
462 Ga0070673_100040759
463 Ga0070688_100010157
464 Ga0070688_100010176
465 Ga0070659_100092548
466 Ga0070659_100195175
467 Ga0070667_100032054
468 Ga0070667_100130629
469 Ga0070709_10000882
470 Ga0070709_10210840
471 Ga0070714_100001689
472 Ga0070714_100022720
473 Ga0070713_100102979
474 Ga0070710_10007175
475 Ga0070711_100093766
476 Ga0070700_100009415
477 Ga0070694_100022122
478 Ga0070663_100145472
479 Ga0070678_100018182
480 Ga0070662_100028138
481 Ga0068867_100006680
482 Ga0068867_100060925
483 Ga0068867_100292633
484 Ga0070685_10006942
485 Ga0070698_100339735
486 Ga0070699_100003045
487 Ga0070684_100031983
488 Ga0070684_100083899
489 Ga0070697_100051084
490 Ga0068853_100015385
491 Ga0070672_100000630
492 Ga0070672_100039529
493 Ga0070696_100001477
494 Ga0070665_100050181
495 Ga0070704_100002201
496 Ga0070664_100104003
497 Ga0068856_100069717
498 Ga0068852_100033519
499 Ga0068864_100005707
500 Ga0068866_10002193
501 Ga0068861_100005727
502 Ga0068863_100132083
503 Ga0068858_100206955
504 Ga0068860_100025911
505 Ga0068862_100003247
506 Ga0081455_10000634
507 Ga0081455_10000655
508 Ga0081455_10011036
509 Ga0081540_1006263
510 Ga0081539_10001661
511 Ga0070717_10089519
512 Ga0075365_10004566
513 Ga0075365_10019998
514 Ga0075365_10049694
515 Ga0075365_10216419
516 Ga0075365_10251166
517 Ga0075363_100002417
518 Ga0075363_100003676
519 Ga0075363_100031545
520 Ga0075364_10003059
521 Ga0075364_10075499
522 Ga0070715_10002161
523 Ga0070712_100035982
524 Ga0070712_100046706
525 Ga0070712_100126300
526 Ga0075362_10004602
527 Ga0075362_10010274
528 Ga0075367_10025319
529 Ga0075367_10029973
530 Ga0075366_10027201
531 Ga0068871_100006501
532 Ga0068871_100106750
533 Ga0075428_100064263
534 Ga0075430_100030495
535 Ga0075431_100007601
536 Ga0075434_100138821
537 Ga0068865_100021334
538 Ga0075435_100023272
539 Ga0075435_100023569
540 Ga0075435_100088538
541 Ga0099794_10001341
542 Ga0099795_10020380
543 Ga0111539_10012642
544 Ga0111539_10661844
545 Ga0105245_10002495
546 Ga0105245_10046065
547 Ga0105245_10052114
548 Ga0105247_10004828
549 Ga0105247_10062344
550 Ga0114129_10008610
551 Ga0114129_10045248
552 Ga0114129_10122860
553 Ga0114129_10227166
554 Ga0114129_10515565
555 Ga0105243_10036977
556 Ga0105241_10049316
557 Ga0105242_10075413
558 Ga0105248_10012305
559 Ga0105248_10118357
560 Ga0105248_10459584
561 Ga0105238_10023335
562 Ga0105238_10263183
563 Ga0105249_10000366
564 Ga0105249_10020983
565 Ga0105239_10066348
566 Ga0157374_10005600
567 Ga0163162_10146240
568 Ga0163162_10272592
569 Ga0157372_10087232
570 Ga0157375_10026835
571 Ga0163163_10038755
572 Ga0157380_10122278
573 Ga0157380_10286485
574 Ga0157377_10006571
575 Ga0157377_10240122
576 Ga0157379_10036303
577 Ga0163161_10022790
578 Ga0213872_10021943
579 Ga0213876_10164015
580 Ga0207653_10027690
581 Ga0207682_10000660
582 Ga0207692_10010217
583 Ga0207692_10010825
584 Ga0207692_10043228
585 Ga0207688_10002814
586 Ga0207680_10013198
587 Ga0207647_10004268
588 Ga0207685_10003833
589 Ga0207699_10004149
590 Ga0207645_10002945
591 Ga0207643_10000282
592 Ga0207705_10017533
593 Ga0207684_10012746
594 Ga0207654_10078368
595 Ga0207693_10000825
596 Ga0207693_10012419
597 Ga0207693_10100129
598 Ga0207663_10036309
599 Ga0207663_10041044
600 Ga0207662_10003773
601 Ga0207662_10018249
602 Ga0207657_10029007
603 Ga0207681_10123262
604 Ga0207694_10028085
605 Ga0207694_10033723
606 Ga0207694_10199416
607 Ga0207650_10006766
608 Ga0207659_10019524
609 Ga0207659_10094212
610 Ga0207687_10004751
611 Ga0207687_10005621
612 Ga0207700_10004075
613 Ga0207700_10081205
614 Ga0207664_10005670
615 Ga0207690_10018860
616 Ga0207706_10001336
617 Ga0207709_10003540
618 Ga0207709_10149007
619 Ga0207670_10001149
620 Ga0207670_10095547
621 Ga0207669_10021132
622 Ga0207704_10003348
623 Ga0207704_10101699
624 Ga0207665_10000350
625 Ga0207665_10081922
626 Ga0207691_10000635
627 Ga0207691_10007956
628 Ga0207691_10091916
629 Ga0207711_10023118
630 Ga0207689_10003641
631 Ga0207661_10025650
632 Ga0207679_10075895
633 Ga0207651_10102994
634 Ga0207712_10002399
635 Ga0207712_10175085
636 Ga0207668_10005993
637 Ga0207658_10018992
638 Ga0207677_10006182
639 Ga0207677_10081662
640 Ga0207703_10008972
641 Ga0207703_10019067
642 Ga0207639_10017917
643 Ga0207639_10121472
644 Ga0207708_10001330
645 Ga0207641_10244567
646 Ga0207648_10001759
647 Ga0207648_10011750
648 Ga0207676_10001268
649 Ga0207674_10023720
650 Ga0207675_100174325
651 Ga0207683_10007301
652 Ga0207698_10026542
653 Ga0209179_1002344
654 Ga0207428_10068984
655 Ga0207428_10078257
656 Ga0268266_10030131
657 Ga0268265_10003591
658 Ga0268265_10062045
659 Ga0268264_10005325
660 Ga0265332_10012410
661 Ga0265325_10000888
662 Ga0265325_10012326
663 Ga0265329_10013808
664 Ga0265331_10023837
665 Ga0265316_10025713
666 Ga0265316_10129255
667 Ga0265313_10009626
668 Ga0265313_10010974
669 Ga0373923_0000430
670 Ga0373936_0003085
671 Ga0373945_0043349
672 Ga0373953_0022985
673 Ga0373954_0002962
674 Ga0373957_0004046
675 Ga0373946_0002008
676 Ga0373946_0015721
677 Ga0373955_0001169
678 Ga0373947_0001141
679 Ga0373947_0007791
680 Ga0373947_0014001
681 Ga0373947_0072875
682 Ga0373937_0000081
683 Ga0373925_0000425
684 Ga0373925_0037914
685 Ga0395899_0033323
686 Ga0395899_0085476
687 Ga0395900_0026341
688 Ga0395898_0021059
689 Ga0395898_0036035
690 Ga0395898_0038548
691 Ga0395898_0039737
692 Ga0436364_1106114
693 Ga0395901_0013570
694 Ga0395901_0020734
695 Ga0436365_1000379
696 Ga0436360_0108197
697 Ga0436361_0511179
698 Ga0436361_0950726
699 Ga0436362_0908277
700 Ga0439443_002819
701 Ga0466966_0048107
702 Ga0466961_0122225
703 Ga0466963_0055780
704 Ga0466963_0113798
705 Ga0466968_0019964
706 Ga0466970_0060901
707 Ga0466957_0010961
708 Ga0466957_0055852
709 Ga0466959_0102515
710 Ga0466958_0068116
711 Ga0466958_0079469
712 Ga0466967_0094642
713 Ga0495592_0000107
714 Ga0495603_0019766
715 Ga0495603_0084859
716 Ga0495591_030163
717 Ga0495638_0025142
718 Ga0495638_0030134
719 Ga0495641_0012363
720 Ga0495651_0000541
721 Ga0495653_0000054
722 Ga0495582_0110467
723 Ga0495639_0022708
724 Ga0495662_0003262
725 Ga0495662_0050114
726 Ga0495664_0000020
727 Ga0495584_0042495
728 Ga0495584_0044357
729 Ga0495584_0047069
730 Ga0495585_0039784
731 Ga0495585_0078047
732 Ga0495607_0075613
733 Ga0495607_0084253
734 Ga0495608_0000024
735 Ga0495618_0000020
736 Ga0495628_0000015
737 Ga0495630_0001945
738 Ga0495630_0067915
739 Ga0495630_0087218
740 Ga0495663_0005144
741 Ga0495652_0000006
742 Ga0495640_0000002
743 Ga0495586_0039837
744 Ga0495587_0000001
745 Ga0495598_0000233
746 Ga0495645_0000013
747 Ga0495622_0037687
748 Ga0495633_0020170
749 Ga0495667_0000030
750 Ga0495656_0003244
751 Ga0495656_0003715
752 Ga0495656_0014316
753 Ga0495668_0114983
754 Ga0495634_0002355
755 Ga0495635_0000001
756 Ga0495661_0043712
757 Ga0495657_0000028
758 Ga0495599_0000056
759 Ga0495623_0000013
760 Ga0495646_0000003
761 Ga0495647_0031271
762 Ga0495658_0064299
763 Ga0495613_0136080
764 Ga0495624_0009810
765 Ga0495624_0032136
766 Ga0495670_0081844
767 Ga0495600_0000002
768 Ga0495604_0000001
769 Ga0495674_0000018
770 Ga0495674_0016576
771 Ga0495676_0021358
772 Ga0495680_0000159
773 Ga0495684_0000010
774 Ga0495593_0002238
775 Ga0495593_0076166
776 Ga0495602_0000016
777 Ga0495602_0074468
778 Ga0496100_0001513
779 Ga0496101_0001682
780 Ga0496101_0056932
781 Ga0496101_0065134
782 Ga0496101_0086785
783 Ga0496102_0003377
784 Ga0496102_0190409
785 Ga0496103_0016132
786 Ga0496104_0000431
787 Ga0496104_0001133
788 Ga0496104_0007436
789 Ga0496105_0002032
790 Ga0496105_0003143
791 Ga0496105_0007813
792 Ga0496105_0019743
793 Ga0496106_0012702
794 Ga0496106_0039362
795 Ga0496106_0047281
796 Ga0496107_0000436
797 Ga0496107_0062550
798 Ga0496107_0083454
799 Ga0496107_0229420
800 Ga0496108_0001616
801 Ga0496108_0052905
802 Ga0496108_0175815
803 Ga0496109_0000404
804 Ga0496109_0006252
805 Ga0496109_0107925
806 Ga0496110_0001910
807 Ga0496110_0002394
808 Ga0496110_0004191
809 Ga0496110_0106530
810 Ga0496111_0000892
811 Ga0496111_0001774
812 Ga0496111_0106669
813 Ga0496112_0003601
814 Ga0496113_0001396
815 Ga0496113_0001735
816 Ga0496114_0003326
817 Ga0496114_0109441
818 Ga0496115_0012441
819 Ga0496115_0062183
820 Ga0496115_0187853
821 Ga0501033_0048394
822 Ga0501034_0014136
823 Ga0501034_0082785
824 Ga0501036_0017243
825 Ga0501038_0058070
826 Ga0501043_0016961
827 Ga0501046_0096425
828 Ga0501047_0016311
829 Ga0501048_0059358
830 Ga0501070_0059416
831 Ga0501072_0170539
832 Ga0501073_0103827
833 Ga0501074_0141477
834 Ga0501075_0254753
835 Ga0501076_0017323
836 Ga0501076_0181939
837 Ga0501077_0033340
838 Ga0501079_0008594
839 Ga0501079_0260281
840 Ga0501080_0293505
841 Ga0501081_0002742
842 Ga0501035_0014264
843 Ga0501044_0009295
844 Ga0501044_0043628
845 Ga0501044_0214615
846 nmdc:mga03683_38158_c1
847 nmdc:mga03n38_1006_c1
848 nmdc:mga03n38_31269_c1
849 nmdc:mga00v17_3607_c1
850 nmdc:mga00v17_48843_c1
851 nmdc:mga06z11_13348_c1
852 nmdc:mga05p37_14557_c1
853 nmdc:mga05p37_20281_c1
854 nmdc:mga05p37_30731_c1
855 nmdc:mga05p37_33695_c1
856 nmdc:mga05p37_54663_c1
857 nmdc:mga09592_42505_c1
858 nmdc:mga09592_96440_c1
859 nmdc:mga08y16_156127_c1
860 nmdc:mga08y16_48648_c1
861 nmdc:mga0n895_45902_c1
862 nmdc:mga0n895_62501_c1
863 nmdc:mga0a205_98685_c1
864 nmdc:mga0sz30_40381_c1
865 Ga0495601_0000021
866 Ga0495612_0000018
867 Ga0495655_0004748
868 Ga0495595_0000042
869 Ga0495619_0000006
870 Ga0495619_0004954
871 Ga0500562_023420
872 Ga0500642_0023932
873 Ga0500568_0033002
874 Ga0500577_0070283
875 Ga0500616_0022768
876 Ga0500627_0054262
877 Ga0501082_0000145
878 Ga0501082_0010181
879 Ga0501082_0154055
880 Ga0466962_0045642
881 Ga0530510_0067536
882 2596371723
883 2902411162
884 2928127983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03471

CorC_HlyC

Transporter associated domain

253

335

0.91

PF00571

CBS

CBS domain

184

238

0.9

PF00571

CBS

CBS domain

92

151

0.82

Map