F444858

General Info

Members Datasets Scaffolds Average Seq Length
442 294 442 125

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11044676|Ga0105240_110446762
Length 150
Sequence MVGGRGEETFGPDRVIRKRGANVFADTKATNGFAVNDIEAAKRFYGETLGLGFKVMSEEFGLASIQLAGGRDTLVYAKPDFVPATYTILNFEVDDVDAAVDELGAKGVEFERYEGFEQDEKGIARGPGPSIAWFKDPAGNILAVLQQPSD

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
99 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
100 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
101 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
187 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
188 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
189 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
190 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
290 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
291 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 7.01
Rhizosphere 91.63
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10443795 3300005328 Bacteria 911
2 Ga0070683_100017829 3300005329 Bacteria 6275
3 Ga0070683_100035577 3300005329 Bacteria 4552
4 Ga0070683_100265673 3300005329 Bacteria 1632
5 Ga0070670_100648624 3300005331 Bacteria 947
6 Ga0068869_100035411 3300005334 Bacteria 3537
7 Ga0070666_10013002 3300005335 Bacteria 5270
8 Ga0070666_10229780 3300005335 Bacteria 1310
9 Ga0070666_11100951 3300005335 Bacteria 590
10 Ga0070680_100734715 3300005336 Bacteria 850
11 Ga0070682_100000077 3300005337 Bacteria 89055
12 Ga0070682_100037652 3300005337 Bacteria 2963
13 Ga0068868_100002341 3300005338 Bacteria 13109
14 Ga0070689_100075918 3300005340 Bacteria 2632
15 Ga0070689_100302104 3300005340 Bacteria 1332
16 Ga0070691_10031087 3300005341 Bacteria 2503
17 Ga0070661_100000116 3300005344 Bacteria 66712
18 Ga0070661_100103860 3300005344 Bacteria 2117
19 Ga0070668_100001597 3300005347 Bacteria 16399
20 Ga0070668_100088271 3300005347 Bacteria 2441
21 Ga0070669_100083917 3300005353 Unclassified 2376
22 Ga0070675_100537574 3300005354 Bacteria 1056
23 Ga0070671_100316517 3300005355 Bacteria 1329
24 Ga0070674_100000103 3300005356 Bacteria 39432
25 Ga0070673_100004922 3300005364 Bacteria 8505
26 Ga0070673_100258040 3300005364 Bacteria 1522
27 Ga0070688_100000066 3300005365 Bacteria 52354
28 Ga0070688_100510961 3300005365 Bacteria 908
29 Ga0070659_100108720 3300005366 Bacteria 2237
30 Ga0070667_100005325 3300005367 Bacteria 10748
31 Ga0070667_100519580 3300005367 Bacteria 1092
32 Ga0070703_10100680 3300005406 Bacteria 1018
33 Ga0070714_100006378 3300005435 Bacteria 9104
34 Ga0070714_100084621 3300005435 Bacteria 2768
35 Ga0070713_100219723 3300005436 Bacteria 1723
36 Ga0070713_100585599 3300005436 Bacteria 1059
37 Ga0070713_101127541 3300005436 Unclassified 758
38 Ga0070710_10031426 3300005437 Bacteria 2867
39 Ga0070710_10036661 3300005437 Bacteria 2681
40 Ga0070710_10463120 3300005437 Bacteria 861
41 Ga0070711_100009684 3300005439 Bacteria 5937
42 Ga0070711_100077921 3300005439 Bacteria 2354
43 Ga0070711_100359320 3300005439 Bacteria 1173
44 Ga0070711_100405463 3300005439 Bacteria 1107
45 Ga0070711_100518573 3300005439 Bacteria 985
46 Ga0070711_101702086 3300005439 Bacteria 552
47 Ga0070705_100028799 3300005440 Bacteria 3046
48 Ga0070700_100118233 3300005441 Bacteria 1772
49 Ga0070694_100070536 3300005444 Bacteria 2406
50 Ga0070708_101052325 3300005445 Bacteria 762
51 Ga0070663_100022299 3300005455 Bacteria 4231
52 Ga0070678_100001532 3300005456 Bacteria 12353
53 Ga0070678_100036225 3300005456 Bacteria 3452
54 Ga0070678_100102271 3300005456 Bacteria 2223
55 Ga0070662_100000005 3300005457 Bacteria 183056
56 Ga0070662_100498273 3300005457 Bacteria 1016
57 Ga0070681_10033752 3300005458 Bacteria 5137
58 Ga0070681_10226916 3300005458 Bacteria 1782
59 Ga0068867_100349587 3300005459 Bacteria 1233
60 Ga0070685_10000955 3300005466 Bacteria 15510
61 Ga0070685_10011144 3300005466 Bacteria 4699
62 Ga0070706_100077044 3300005467 Bacteria 3086
63 Ga0070706_101150135 3300005467 Bacteria 714
64 Ga0070707_100951701 3300005468 Bacteria 824
65 Ga0070699_100918770 3300005518 Bacteria 802
66 Ga0070679_100000487 3300005530 Bacteria 33946
67 Ga0070679_100190776 3300005530 Bacteria 2018
68 Ga0070684_100017747 3300005535 Bacteria 5848
69 Ga0070684_100024975 3300005535 Bacteria 5018
70 Ga0070684_100031509 3300005535 Bacteria 4515
71 Ga0070684_100097591 3300005535 Bacteria 2620
72 Ga0070684_100361174 3300005535 Bacteria 1336
73 Ga0070697_101096504 3300005536 Bacteria 708
74 Ga0068853_100004202 3300005539 Bacteria 11107
75 Ga0068853_100077288 3300005539 Bacteria 2908
76 Ga0068853_100609040 3300005539 Bacteria 1038
77 Ga0070672_100008239 3300005543 Bacteria 7123
78 Ga0070672_100242672 3300005543 Bacteria 1516
79 Ga0070695_100291686 3300005545 Bacteria 1203
80 Ga0070696_100338892 3300005546 Bacteria 1162
81 Ga0070693_100571527 3300005547 Bacteria 812
82 Ga0070665_100000341 3300005548 Bacteria 70565
83 Ga0070665_100000846 3300005548 Bacteria 39881
84 Ga0070665_100818201 3300005548 Bacteria 944
85 Ga0070665_100844792 3300005548 Bacteria 929
86 Ga0070704_101341486 3300005549 Unclassified 655
87 Ga0068855_100172973 3300005563 Bacteria 2445
88 Ga0068855_100540796 3300005563 Bacteria 1262
89 Ga0070664_100178909 3300005564 Bacteria 1884
90 Ga0068857_100449435 3300005577 Bacteria 1204
91 Ga0068854_100104593 3300005578 Bacteria 2127
92 Ga0068856_100100573 3300005614 Bacteria 2883
93 Ga0068852_100288460 3300005616 Bacteria 1584
94 Ga0068859_102542277 3300005617 Bacteria 564
95 Ga0068864_100066951 3300005618 Bacteria 3118
96 Ga0068866_10000014 3300005718 Bacteria 72482
97 Ga0068861_100714156 3300005719 Bacteria 933
98 Ga0068861_100825515 3300005719 Bacteria 872
99 Ga0068851_10421200 3300005834 Bacteria 789
100 Ga0068870_10450577 3300005840 Bacteria 848
101 Ga0068863_100362351 3300005841 Bacteria 1413
102 Ga0068858_100000251 3300005842 Bacteria 57269
103 Ga0068858_100477195 3300005842 Bacteria 1203
104 Ga0068860_100020985 3300005843 Bacteria 6329
105 Ga0068860_100164413 3300005843 Bacteria 2141
106 Ga0068860_100607494 3300005843 Bacteria 1099
107 Ga0068862_100002273 3300005844 Bacteria 17193
108 Ga0068862_100898506 3300005844 Bacteria 871
109 Ga0081455_10055679 3300005937 Bacteria 3363
110 Ga0081455_10333705 3300005937 Bacteria 1076
111 Ga0081455_10377741 3300005937 Bacteria 991
112 Ga0081538_10000161 3300005981 Bacteria 70862
113 Ga0081540_1000356 3300005983 Bacteria 46150
114 Ga0081539_10028694 3300005985 Bacteria 3495
115 Ga0070717_10058960 3300006028 Bacteria 3175
116 Ga0070717_11509271 3300006028 Bacteria 610
117 Ga0075365_10376712 3300006038 Bacteria 1001
118 Ga0070715_10000011 3300006163 Bacteria 183857
119 Ga0070715_10035997 3300006163 Bacteria 2039
120 Ga0070716_100052239 3300006173 Bacteria 2326
121 Ga0070716_100079824 3300006173 Bacteria 1949
122 Ga0070716_100337748 3300006173 Bacteria 1061
123 Ga0070712_100000339 3300006175 Bacteria 26368
124 Ga0070712_100071782 3300006175 Bacteria 2478
125 Ga0070712_100082256 3300006175 Bacteria 2335
126 Ga0070712_100105228 3300006175 Bacteria 2095
127 Ga0070712_100230376 3300006175 Bacteria 1471
128 Ga0097621_101783773 3300006237 Bacteria 586
129 Ga0068871_100290108 3300006358 Bacteria 1433
130 Ga0075428_102379117 3300006844 Bacteria 544
131 Ga0075433_10845704 3300006852 Bacteria 799
132 Ga0075434_101100388 3300006871 Bacteria 808
133 Ga0075429_101107960 3300006880 Unclassified 691
134 Ga0068865_100469222 3300006881 Bacteria 1044
135 Ga0097620_102542218 3300006931 Bacteria 564
136 Ga0075435_100978295 3300007076 Bacteria 739
137 Ga0105251_10048426 3300009011 Bacteria 2037
138 Ga0105240_11044676 3300009093 Bacteria 872
139 Ga0105245_10012189 3300009098 Bacteria 7477
140 Ga0105245_10303354 3300009098 Bacteria 1568
141 Ga0105245_11667752 3300009098 Bacteria 689
142 Ga0105247_10062743 3300009101 Bacteria 2306
143 Ga0105247_10804901 3300009101 Bacteria 717
144 Ga0114129_10688098 3300009147 Bacteria 1316
145 Ga0105243_10070154 3300009148 Bacteria 2829
146 Ga0105241_10096385 3300009174 Bacteria 2343
147 Ga0105242_10125075 3300009176 Bacteria 2212
148 Ga0105242_10130238 3300009176 Bacteria 2170
149 Ga0105248_10489930 3300009177 Bacteria 1386
150 Ga0105237_10807746 3300009545 Bacteria 945
151 Ga0105238_10000172 3300009551 Bacteria 70799
152 Ga0105249_10018681 3300009553 Bacteria 6174
153 Ga0105249_11112478 3300009553 Bacteria 860
154 Ga0099796_10250690 3300010159 Bacteria 735
155 Ga0105239_10530362 3300010375 Bacteria 1340
156 Ga0105246_10064265 3300011119 Bacteria 2563
157 Ga0157345_1003021 3300012498 Bacteria 1212
158 Ga0157314_1036047 3300012500 Bacteria 578
159 Ga0157342_1007423 3300012507 Bacteria 1063
160 Ga0157342_1024673 3300012507 Bacteria 722
161 Ga0157315_1073212 3300012508 Bacteria 508
162 Ga0157370_10156968 3300013104 Bacteria 2117
163 Ga0157370_10953235 3300013104 Bacteria 778
164 Ga0157370_11757674 3300013104 Bacteria 557
165 Ga0157374_10019367 3300013296 Bacteria 6023
166 Ga0157374_10815645 3300013296 Bacteria 949
167 Ga0157378_10042780 3300013297 Bacteria 4020
168 Ga0157378_10085791 3300013297 Bacteria 2853
169 Ga0157378_10696432 3300013297 Unclassified 1035
170 Ga0157378_11075812 3300013297 Bacteria 841
171 Ga0157372_10856363 3300013307 Bacteria 1055
172 Ga0157375_10030821 3300013308 Bacteria 5062
173 Ga0157375_10050868 3300013308 Bacteria 4066
174 Ga0163163_10904037 3300014325 Bacteria 946
175 Ga0157380_10046566 3300014326 Bacteria 3407
176 Ga0157380_10380563 3300014326 Bacteria 1332
177 Ga0182008_10135672 3300014497 Bacteria 1229
178 Ga0157377_10053980 3300014745 Bacteria 2274
179 Ga0157379_10235748 3300014968 Bacteria 1659
180 Ga0157379_11949186 3300014968 Bacteria 580
181 Ga0157376_10242278 3300014969 Bacteria 1680
182 Ga0163161_11016193 3300017792 Bacteria 708
183 Ga0163161_11052038 3300017792 Bacteria 697
184 Ga0206356_11773816 3300020070 Bacteria 590
185 Ga0206352_10175609 3300020078 Bacteria 709
186 Ga0206354_10187246 3300020081 Bacteria 1101
187 Ga0206353_10074122 3300020082 Bacteria 953
188 Ga0224712_10364733 3300022467 Bacteria 684
189 Ga0207692_10024713 3300025898 Bacteria 2796
190 Ga0207692_10075156 3300025898 Bacteria 1792
191 Ga0207692_10098347 3300025898 Bacteria 1601
192 Ga0207692_10105930 3300025898 Bacteria 1552
193 Ga0207642_10000001 3300025899 Bacteria 714030
194 Ga0207642_10655166 3300025899 Bacteria 658
195 Ga0207688_10012267 3300025901 Bacteria 4662
196 Ga0207680_10021869 3300025903 Bacteria 3469
197 Ga0207647_10118273 3300025904 Bacteria 1564
198 Ga0207685_10000001 3300025905 Bacteria 604473
199 Ga0207699_10042349 3300025906 Bacteria 2637
200 Ga0207699_10253904 3300025906 Bacteria 1213
201 Ga0207699_10266750 3300025906 Bacteria 1185
202 Ga0207643_10460312 3300025908 Bacteria 810
203 Ga0207705_11161348 3300025909 Bacteria 593
204 Ga0207654_10079431 3300025911 Bacteria 1971
205 Ga0207707_10023070 3300025912 Bacteria 5444
206 Ga0207707_10428513 3300025912 Bacteria 1133
207 Ga0207695_10721445 3300025913 Bacteria 877
208 Ga0207671_10153377 3300025914 Bacteria 1781
209 Ga0207693_10002524 3300025915 Bacteria 15898
210 Ga0207693_10021840 3300025915 Bacteria 5088
211 Ga0207693_10118221 3300025915 Bacteria 2081
212 Ga0207663_10039966 3300025916 Bacteria 2847
213 Ga0207663_10063605 3300025916 Bacteria 2350
214 Ga0207663_10066291 3300025916 Bacteria 2311
215 Ga0207662_10024546 3300025918 Bacteria 3468
216 Ga0207657_10024135 3300025919 Bacteria 5644
217 Ga0207649_10000005 3300025920 Bacteria 356179
218 Ga0207649_10210597 3300025920 Bacteria 1379
219 Ga0207652_10000658 3300025921 Bacteria 33940
220 Ga0207681_10230643 3300025923 Bacteria 1437
221 Ga0207694_10000004 3300025924 Bacteria 967075
222 Ga0207650_10940583 3300025925 Bacteria 734
223 Ga0207659_10038303 3300025926 Bacteria 3334
224 Ga0207687_10000167 3300025927 Bacteria 44044
225 Ga0207687_10677800 3300025927 Bacteria 874
226 Ga0207700_10060908 3300025928 Bacteria 2860
227 Ga0207700_10278015 3300025928 Bacteria 1439
228 Ga0207700_11093500 3300025928 Bacteria 713
229 Ga0207664_10012445 3300025929 Bacteria 6083
230 Ga0207664_10067022 3300025929 Bacteria 2879
231 Ga0207664_10408873 3300025929 Bacteria 1208
232 Ga0207690_10350217 3300025932 Bacteria 1168
233 Ga0207706_10000006 3300025933 Bacteria 216994
234 Ga0207686_10145931 3300025934 Bacteria 1641
235 Ga0207686_10193864 3300025934 Bacteria 1450
236 Ga0207670_10074259 3300025936 Bacteria 2360
237 Ga0207670_10238103 3300025936 Bacteria 1401
238 Ga0207669_10000115 3300025937 Bacteria 40041
239 Ga0207704_10217259 3300025938 Bacteria 1412
240 Ga0207704_10482154 3300025938 Bacteria 996
241 Ga0207665_10016388 3300025939 Bacteria 4865
242 Ga0207665_10108265 3300025939 Bacteria 1950
243 Ga0207665_10454076 3300025939 Bacteria 984
244 Ga0207691_10030597 3300025940 Bacteria 5029
245 Ga0207691_10043696 3300025940 Bacteria 4128
246 Ga0207711_10672081 3300025941 Bacteria 966
247 Ga0207711_11703842 3300025941 Bacteria 574
248 Ga0207689_10007492 3300025942 Bacteria 9567
249 Ga0207661_10003140 3300025944 Bacteria 11451
250 Ga0207661_10004159 3300025944 Bacteria 10122
251 Ga0207661_10248459 3300025944 Bacteria 1580
252 Ga0207679_10305716 3300025945 Bacteria 1372
253 Ga0207667_10180179 3300025949 Bacteria 2170
254 Ga0207667_10432576 3300025949 Bacteria 1338
255 Ga0207651_10002681 3300025960 Bacteria 8520
256 Ga0207651_10372894 3300025960 Bacteria 1208
257 Ga0207712_10009056 3300025961 Bacteria 6298
258 Ga0207712_10120849 3300025961 Bacteria 1982
259 Ga0207712_10845599 3300025961 Bacteria 806
260 Ga0207668_10002148 3300025972 Bacteria 11501
261 Ga0207668_10073083 3300025972 Bacteria 2456
262 Ga0207640_10197106 3300025981 Bacteria 1523
263 Ga0207640_10266778 3300025981 Bacteria 1337
264 Ga0207658_10004877 3300025986 Bacteria 9256
265 Ga0207677_10000677 3300026023 Bacteria 20194
266 Ga0207677_10712925 3300026023 Bacteria 891
267 Ga0207703_10000128 3300026035 Bacteria 91359
268 Ga0207703_10000237 3300026035 Bacteria 62874
269 Ga0207703_11958240 3300026035 Bacteria 562
270 Ga0207639_10031439 3300026041 Bacteria 3902
271 Ga0207639_10109156 3300026041 Bacteria 2251
272 Ga0207639_10539149 3300026041 Bacteria 1070
273 Ga0207708_10078873 3300026075 Bacteria 2529
274 Ga0207708_10249001 3300026075 Bacteria 1431
275 Ga0207702_10004618 3300026078 Bacteria 12202
276 Ga0207702_10353734 3300026078 Bacteria 1406
277 Ga0207641_10203088 3300026088 Bacteria 1828
278 Ga0207648_10088984 3300026089 Bacteria 2696
279 Ga0207674_10031889 3300026116 Bacteria 5531
280 Ga0207675_100036495 3300026118 Bacteria 4584
281 Ga0207675_100473988 3300026118 Bacteria 1243
282 Ga0207683_10004432 3300026121 Bacteria 12132
283 Ga0207683_10004976 3300026121 Bacteria 11427
284 Ga0207683_10065884 3300026121 Bacteria 3194
285 Ga0207698_11366606 3300026142 Bacteria 723
286 Ga0268266_10000020 3300028379 Bacteria 527065
287 Ga0268266_10001882 3300028379 Bacteria 23710
288 Ga0268266_10219916 3300028379 Bacteria 1745
289 Ga0268265_10000938 3300028380 Bacteria 26823
290 Ga0268265_10401582 3300028380 Bacteria 1267
291 Ga0268264_10025968 3300028381 Bacteria 4782
292 Ga0268264_12073480 3300028381 Bacteria 577
293 Ga0265760_10022196 3300031090 Bacteria 1839
294 Ga0307408_100937645 3300031548 Bacteria 794
295 Ga0307405_10028881 3300031731 Bacteria 3235
296 Ga0307413_10167488 3300031824 Bacteria 1551
297 Ga0307407_10692652 3300031903 Unclassified 767
298 Ga0307412_10300005 3300031911 Bacteria 1269
299 Ga0307409_100032522 3300031995 Bacteria 3783
300 Ga0307409_100907227 3300031995 Unclassified 895
301 Ga0307416_100041116 3300032002 Bacteria 3598
302 Ga0307415_100025731 3300032126 Bacteria 3699
303 Ga0373948_0103450 3300034817 Bacteria 673
304 Ga0373958_0137908 3300034819 Bacteria 602
305 Ga0373928_0025906 3300035084 Bacteria 1268
306 Ga0373929_0028315 3300035085 Bacteria 1183
307 Ga0373940_0057740 3300035088 Bacteria 1103
308 Ga0373951_0058398 3300035091 Bacteria 962
309 Ga0373952_0110935 3300035092 Bacteria 734
310 Ga0373939_0004303 3300035114 Bacteria 3363
311 Ga0373941_0034735 3300035115 Bacteria 1523
312 Ga0373953_0233731 3300035117 Bacteria 797
313 Ga0373943_0408541 3300035170 Bacteria 785
314 Ga0373943_0782931 3300035170 Bacteria 567
315 Ga0373955_0117970 3300035172 Bacteria 1540
316 Ga0373942_0024561 3300035207 Bacteria 1546
317 Ga0373962_0118504 3300035242 Bacteria 842
318 Ga0373924_0193683 3300035410 Bacteria 896
319 Ga0373931_0229304 3300035691 Bacteria 1121
320 Ga0373935_0874719 3300035692 Bacteria 665
321 Ga0373933_0516184 3300035724 Bacteria 783
322 Ga0373947_0676260 3300035725 Bacteria 704
323 Ga0373937_0034652 3300036401 Bacteria 4592
324 Ga0373937_1795637 3300036401 Bacteria 560
325 Ga0395900_0366070 3300037418 Bacteria 1412
326 Ga0395898_0593402 3300037466 Bacteria 1050
327 Ga0395901_0133468 3300038443 Bacteria 2609
328 Ga0395901_0812798 3300038443 Bacteria 923
329 Ga0395901_1366750 3300038443 Bacteria 668
330 Ga0439444_0057016 3300042437 Bacteria 807
331 Ga0466970_0328114 3300044765 Bacteria 866
332 Ga0466959_0478605 3300045049 Bacteria 843
333 Ga0451576_0134326 3300045051 Bacteria 2580
334 Ga0466967_0920682 3300045976 Bacteria 870
335 Ga0495592_0171595 3300046454 Bacteria 1485
336 Ga0495603_0357036 3300046455 Bacteria 838
337 Ga0495641_0000001 3300046461 Bacteria 485224
338 Ga0495651_0203395 3300046462 Bacteria 1384
339 Ga0495653_0370261 3300046463 Bacteria 917
340 Ga0495580_0427041 3300046472 Bacteria 891
341 Ga0495582_0000013 3300046473 Bacteria 110372
342 Ga0495639_0018984 3300046475 Bacteria 2998
343 Ga0495664_0419395 3300046477 Bacteria 803
344 Ga0495594_0357465 3300046499 Bacteria 832
345 Ga0495608_0468584 3300046511 Bacteria 765
346 Ga0495620_0000747 3300046515 Bacteria 19970
347 Ga0495628_0607180 3300046516 Bacteria 781
348 Ga0495644_0000499 3300046523 Bacteria 16748
349 Ga0495663_0133473 3300046525 Bacteria 839
350 Ga0495652_1016114 3300046529 Bacteria 542
351 Ga0495665_0377097 3300046531 Bacteria 721
352 Ga0495586_0000537 3300046535 Bacteria 22120
353 Ga0495587_0011847 3300046536 Bacteria 5512
354 Ga0495598_0004358 3300046537 Bacteria 3059
355 Ga0495645_0054401 3300046543 Bacteria 2908
356 Ga0495667_0095106 3300046559 Bacteria 1929
357 Ga0495634_0001221 3300046642 Bacteria 23712
358 Ga0495634_0208160 3300046642 Bacteria 1212
359 Ga0495634_0238493 3300046642 Bacteria 1116
360 Ga0495635_0453559 3300046663 Bacteria 847
361 Ga0495588_0738052 3300046674 Bacteria 515
362 Ga0495657_0305821 3300046675 Bacteria 947
363 Ga0495599_0110646 3300046678 Bacteria 1711
364 Ga0495623_0413748 3300046679 Bacteria 723
365 Ga0495646_0636083 3300046680 Bacteria 540
366 Ga0495647_0000046 3300046681 Bacteria 35269
367 Ga0495647_0113957 3300046681 Bacteria 1131
368 Ga0495658_0000009 3300046683 Bacteria 110421
369 Ga0495669_0000083 3300046684 Bacteria 62876
370 Ga0495624_0000307 3300046690 Bacteria 38620
371 Ga0495670_0009994 3300046691 Bacteria 4666
372 Ga0495649_0032859 3300046694 Bacteria 2857
373 Ga0495589_0367898 3300046794 Bacteria 661
374 Ga0495600_0283951 3300046809 Bacteria 1047
375 Ga0495600_0759632 3300046809 Bacteria 580
376 Ga0495660_0319120 3300046810 Bacteria 699
377 Ga0495604_0047397 3300047317 Bacteria 3347
378 Ga0495674_0253029 3300047319 Bacteria 1449
379 Ga0495676_0001446 3300047321 Bacteria 20500
380 Ga0495680_0000599 3300047322 Bacteria 40585
381 Ga0495680_0282580 3300047322 Bacteria 1169
382 Ga0495673_0089273 3300047469 Bacteria 1262
383 Ga0495684_0074725 3300047471 Bacteria 2575
384 Ga0495602_0020203 3300048088 Bacteria 6586
385 Ga0496100_0000007 3300048903 Bacteria 261266
386 Ga0496100_0215563 3300048903 Bacteria 1406
387 Ga0496101_0000013 3300048904 Bacteria 261266
388 Ga0496101_0643877 3300048904 Bacteria 837
389 Ga0496102_0474200 3300048905 Bacteria 1172
390 Ga0496103_0021372 3300048906 Bacteria 3892
391 Ga0496104_0000013 3300048907 Bacteria 397163
392 Ga0496104_0037090 3300048907 Bacteria 4558
393 Ga0496105_0000006 3300048908 Bacteria 393578
394 Ga0496105_0199255 3300048908 Bacteria 1634
395 Ga0496106_0000006 3300048909 Bacteria 251855
396 Ga0496106_0138115 3300048909 Bacteria 1916
397 Ga0496106_0372489 3300048909 Bacteria 1147
398 Ga0496106_0684485 3300048909 Bacteria 818
399 Ga0496107_0000007 3300048910 Bacteria 257113
400 Ga0496107_0150648 3300048910 Bacteria 1720
401 Ga0496107_0667202 3300048910 Bacteria 766
402 Ga0496108_0026177 3300048911 Bacteria 4811
403 Ga0496108_0456966 3300048911 Bacteria 1115
404 Ga0496109_0000248 3300048912 Bacteria 51780
405 Ga0496109_1073106 3300048912 Bacteria 742
406 Ga0496110_0010361 3300048913 Bacteria 7579
407 Ga0496110_0131603 3300048913 Bacteria 2259
408 Ga0496110_1201915 3300048913 Bacteria 667
409 Ga0496111_0062304 3300048914 Bacteria 2704
410 Ga0496112_0000003 3300048915 Bacteria 660147
411 Ga0496112_0540391 3300048915 Bacteria 1099
412 Ga0496113_0028160 3300048916 Bacteria 4038
413 Ga0496113_0077235 3300048916 Bacteria 2545
414 Ga0496114_0041577 3300048917 Bacteria 3810
415 Ga0496114_0116555 3300048917 Bacteria 2293
416 Ga0496126_1022389 3300048929 Bacteria 619
417 Ga0501042_0117175 3300049578 Bacteria 1918
418 Ga0501042_0266646 3300049578 Bacteria 1236
419 Ga0501042_0670176 3300049578 Bacteria 754
420 Ga0501070_0156839 3300049586 Bacteria 1877
421 Ga0501072_0049010 3300049588 Bacteria 3325
422 Ga0501076_1674091 3300049592 Bacteria 522
423 Ga0501079_1394823 3300049741 Bacteria 551
424 Ga0501081_0254146 3300049743 Bacteria 1283
425 Ga0501045_1365460 3300049824 Bacteria 515
426 nmdc:mga05p37_457175_c1 3300050507 Bacteria 1123
427 nmdc:mga08y16_911817_c1 3300050511 Bacteria 864
428 nmdc:mga08x19_668668_c1 3300050514 Bacteria 737
429 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
430 nmdc:mga0a205_762162_c1 3300050515 Bacteria 816
431 Ga0495601_0000581 3300053077 Bacteria 19434
432 Ga0495612_0001629 3300053078 Bacteria 9237
433 Ga0495619_0002122 3300053085 Bacteria 13142
434 Ga0500614_022982 3300053123 Bacteria 1461
435 Ga0500573_0076612 3300053140 Bacteria 1904
436 Ga0500577_0001913 3300053142 Bacteria 5338
437 Ga0500577_0174288 3300053142 Bacteria 921
438 Ga0501084_1111040 3300054114 Bacteria 664
439 Ga0501082_0230736 3300060353 Bacteria 1611
440 Ga0530510_0056768 3300061734 Bacteria 2829
441 Ga0530510_0098628 3300061734 Bacteria 2136
442 Ga0530510_0672181 3300061734 Bacteria 789

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053142 Ga0500577_0174288 Ga0500577_0174288_144_521 108
2 3300005435 Ga0070714_100084621 Ga0070714_1000846213 120
3 3300005436 Ga0070713_101127541 Ga0070713_1011275412 120
4 3300005937 Ga0081455_10333705 Ga0081455_103337052 121
5 3300031548 Ga0307408_100937645 Ga0307408_1009376452 122
6 3300031731 Ga0307405_10028881 Ga0307405_100288814 122
7 3300031911 Ga0307412_10300005 Ga0307412_103000052 122
8 3300031995 Ga0307409_100032522 Ga0307409_1000325222 122
9 3300032002 Ga0307416_100041116 Ga0307416_1000411162 122
10 3300032126 Ga0307415_100025731 Ga0307415_1000257314 122
11 3300042437 Ga0439444_0057016 Ga0439444_0057016_15_383 122
12 3300005329 Ga0070683_100035577 Ga0070683_1000355772 123
13 3300005331 Ga0070670_100648624 Ga0070670_1006486242 123
14 3300005334 Ga0068869_100035411 Ga0068869_1000354114 123
15 3300005335 Ga0070666_10229780 Ga0070666_102297801 123
16 3300005336 Ga0070680_100734715 Ga0070680_1007347151 123
17 3300005337 Ga0070682_100037652 Ga0070682_1000376524 123
18 3300005340 Ga0070689_100302104 Ga0070689_1003021041 123
19 3300005341 Ga0070691_10031087 Ga0070691_100310872 123
20 3300005344 Ga0070661_100103860 Ga0070661_1001038602 123
21 3300005354 Ga0070675_100537574 Ga0070675_1005375742 123
22 3300005355 Ga0070671_100316517 Ga0070671_1003165171 123
23 3300005364 Ga0070673_100258040 Ga0070673_1002580402 123
24 3300005365 Ga0070688_100510961 Ga0070688_1005109611 123
25 3300005367 Ga0070667_100519580 Ga0070667_1005195801 123
26 3300005406 Ga0070703_10100680 Ga0070703_101006802 123
27 3300005435 Ga0070714_100006378 Ga0070714_1000063782 123
28 3300005436 Ga0070713_100219723 Ga0070713_1002197232 123
29 3300005436 Ga0070713_100585599 Ga0070713_1005855992 123
30 3300005437 Ga0070710_10031426 Ga0070710_100314264 123
31 3300005437 Ga0070710_10036661 Ga0070710_100366613 123
32 3300005437 Ga0070710_10463120 Ga0070710_104631202 123
33 3300005439 Ga0070711_100009684 Ga0070711_1000096846 123
34 3300005439 Ga0070711_100077921 Ga0070711_1000779213 123
35 3300005439 Ga0070711_100359320 Ga0070711_1003593202 123
36 3300005439 Ga0070711_100405463 Ga0070711_1004054632 123
37 3300005439 Ga0070711_101702086 Ga0070711_1017020861 123
38 3300005440 Ga0070705_100028799 Ga0070705_1000287992 123
39 3300005444 Ga0070694_100070536 Ga0070694_1000705361 123
40 3300005445 Ga0070708_101052325 Ga0070708_1010523251 123
41 3300005455 Ga0070663_100022299 Ga0070663_1000222994 123
42 3300005456 Ga0070678_100102271 Ga0070678_1001022713 123
43 3300005457 Ga0070662_100498273 Ga0070662_1004982731 123
44 3300005458 Ga0070681_10226916 Ga0070681_102269163 123
45 3300005466 Ga0070685_10011144 Ga0070685_100111442 123
46 3300005467 Ga0070706_100077044 Ga0070706_1000770444 123
47 3300005467 Ga0070706_101150135 Ga0070706_1011501352 123
48 3300005468 Ga0070707_100951701 Ga0070707_1009517011 123
49 3300005518 Ga0070699_100918770 Ga0070699_1009187701 123
50 3300005530 Ga0070679_100190776 Ga0070679_1001907762 123
51 3300005535 Ga0070684_100361174 Ga0070684_1003611742 123
52 3300005536 Ga0070697_101096504 Ga0070697_1010965041 123
53 3300005539 Ga0068853_100609040 Ga0068853_1006090402 123
54 3300005543 Ga0070672_100242672 Ga0070672_1002426722 123
55 3300005545 Ga0070695_100291686 Ga0070695_1002916861 123
56 3300005546 Ga0070696_100338892 Ga0070696_1003388921 123
57 3300005548 Ga0070665_100818201 Ga0070665_1008182011 123
58 3300005564 Ga0070664_100178909 Ga0070664_1001789094 123
59 3300005577 Ga0068857_100449435 Ga0068857_1004494352 123
60 3300005616 Ga0068852_100288460 Ga0068852_1002884601 123
61 3300005617 Ga0068859_102542277 Ga0068859_1025422772 123
62 3300005618 Ga0068864_100066951 Ga0068864_1000669512 123
63 3300005719 Ga0068861_100714156 Ga0068861_1007141562 123
64 3300005834 Ga0068851_10421200 Ga0068851_104212002 123
65 3300005840 Ga0068870_10450577 Ga0068870_104505771 123
66 3300005841 Ga0068863_100362351 Ga0068863_1003623512 123
67 3300005842 Ga0068858_100477195 Ga0068858_1004771951 123
68 3300005843 Ga0068860_100164413 Ga0068860_1001644133 123
69 3300005844 Ga0068862_100898506 Ga0068862_1008985062 123
70 3300005983 Ga0081540_1000356 Ga0081540_100035636 123
71 3300005985 Ga0081539_10028694 Ga0081539_100286947 123
72 3300006028 Ga0070717_10058960 Ga0070717_100589604 123
73 3300006028 Ga0070717_11509271 Ga0070717_115092711 123
74 3300006163 Ga0070715_10035997 Ga0070715_100359973 123
75 3300006173 Ga0070716_100052239 Ga0070716_1000522392 123
76 3300006173 Ga0070716_100079824 Ga0070716_1000798242 123
77 3300006173 Ga0070716_100337748 Ga0070716_1003377481 123
78 3300006175 Ga0070712_100071782 Ga0070712_1000717823 123
79 3300006175 Ga0070712_100082256 Ga0070712_1000822562 123
80 3300006175 Ga0070712_100105228 Ga0070712_1001052282 123
81 3300006175 Ga0070712_100230376 Ga0070712_1002303761 123
82 3300006237 Ga0097621_101783773 Ga0097621_1017837731 123
83 3300006358 Ga0068871_100290108 Ga0068871_1002901082 123
84 3300006871 Ga0075434_101100388 Ga0075434_1011003882 123
85 3300006880 Ga0075429_101107960 Ga0075429_1011079601 123
86 3300006881 Ga0068865_100469222 Ga0068865_1004692222 123
87 3300006931 Ga0097620_102542218 Ga0097620_1025422182 123
88 3300007076 Ga0075435_100978295 Ga0075435_1009782952 123
89 3300009011 Ga0105251_10048426 Ga0105251_100484263 123
90 3300009098 Ga0105245_10303354 Ga0105245_103033541 123
91 3300009098 Ga0105245_11667752 Ga0105245_116677521 123
92 3300009101 Ga0105247_10062743 Ga0105247_100627432 123
93 3300009148 Ga0105243_10070154 Ga0105243_100701542 123
94 3300009174 Ga0105241_10096385 Ga0105241_100963853 123
95 3300009176 Ga0105242_10125075 Ga0105242_101250752 123
96 3300009177 Ga0105248_10489930 Ga0105248_104899302 123
97 3300009545 Ga0105237_10807746 Ga0105237_108077462 123
98 3300009553 Ga0105249_11112478 Ga0105249_111124781 123
99 3300010159 Ga0099796_10250690 Ga0099796_102506901 123
100 3300010375 Ga0105239_10530362 Ga0105239_105303621 123
101 3300011119 Ga0105246_10064265 Ga0105246_100642652 123
102 3300012498 Ga0157345_1003021 Ga0157345_10030212 123
103 3300012500 Ga0157314_1036047 Ga0157314_10360471 123
104 3300012507 Ga0157342_1007423 Ga0157342_10074231 123
105 3300012508 Ga0157315_1073212 Ga0157315_10732121 123
106 3300013104 Ga0157370_10156968 Ga0157370_101569682 123
107 3300013104 Ga0157370_11757674 Ga0157370_117576741 123
108 3300013296 Ga0157374_10815645 Ga0157374_108156451 123
109 3300013297 Ga0157378_10085791 Ga0157378_100857911 123
110 3300013307 Ga0157372_10856363 Ga0157372_108563631 123
111 3300013308 Ga0157375_10050868 Ga0157375_100508685 123
112 3300014325 Ga0163163_10904037 Ga0163163_109040371 123
113 3300014497 Ga0182008_10135672 Ga0182008_101356723 123
114 3300014745 Ga0157377_10053980 Ga0157377_100539803 123
115 3300014968 Ga0157379_11949186 Ga0157379_119491861 123
116 3300020070 Ga0206356_11773816 Ga0206356_117738161 123
117 3300020081 Ga0206354_10187246 Ga0206354_101872462 123
118 3300020082 Ga0206353_10074122 Ga0206353_100741222 123
119 3300022467 Ga0224712_10364733 Ga0224712_103647332 123
120 3300025898 Ga0207692_10024713 Ga0207692_100247134 123
121 3300025898 Ga0207692_10075156 Ga0207692_100751561 123
122 3300025898 Ga0207692_10098347 Ga0207692_100983471 123
123 3300025898 Ga0207692_10105930 Ga0207692_101059302 123
124 3300025899 Ga0207642_10655166 Ga0207642_106551661 123
125 3300025901 Ga0207688_10012267 Ga0207688_100122672 123
126 3300025904 Ga0207647_10118273 Ga0207647_101182733 123
127 3300025906 Ga0207699_10042349 Ga0207699_100423492 123
128 3300025906 Ga0207699_10253904 Ga0207699_102539042 123
129 3300025906 Ga0207699_10266750 Ga0207699_102667502 123
130 3300025908 Ga0207643_10460312 Ga0207643_104603122 123
131 3300025909 Ga0207705_11161348 Ga0207705_111613481 123
132 3300025911 Ga0207654_10079431 Ga0207654_100794312 123
133 3300025912 Ga0207707_10428513 Ga0207707_104285132 123
134 3300025914 Ga0207671_10153377 Ga0207671_101533773 123
135 3300025915 Ga0207693_10021840 Ga0207693_100218405 123
136 3300025915 Ga0207693_10118221 Ga0207693_101182212 123
137 3300025916 Ga0207663_10063605 Ga0207663_100636053 123
138 3300025916 Ga0207663_10066291 Ga0207663_100662913 123
139 3300025918 Ga0207662_10024546 Ga0207662_100245466 123
140 3300025919 Ga0207657_10024135 Ga0207657_100241351 123
141 3300025920 Ga0207649_10210597 Ga0207649_102105971 123
142 3300025925 Ga0207650_10940583 Ga0207650_109405831 123
143 3300025926 Ga0207659_10038303 Ga0207659_100383034 123
144 3300025927 Ga0207687_10677800 Ga0207687_106778002 123
145 3300025928 Ga0207700_10060908 Ga0207700_100609083 123
146 3300025928 Ga0207700_10278015 Ga0207700_102780151 123
147 3300025928 Ga0207700_11093500 Ga0207700_110935001 123
148 3300025929 Ga0207664_10012445 Ga0207664_100124452 123
149 3300025929 Ga0207664_10067022 Ga0207664_100670222 123
150 3300025929 Ga0207664_10408873 Ga0207664_104088733 123
151 3300025934 Ga0207686_10193864 Ga0207686_101938643 123
152 3300025936 Ga0207670_10074259 Ga0207670_100742593 123
153 3300025938 Ga0207704_10217259 Ga0207704_102172591 123
154 3300025939 Ga0207665_10016388 Ga0207665_100163884 123
155 3300025939 Ga0207665_10108265 Ga0207665_101082652 123
156 3300025939 Ga0207665_10454076 Ga0207665_104540762 123
157 3300025940 Ga0207691_10030597 Ga0207691_100305972 123
158 3300025941 Ga0207711_10672081 Ga0207711_106720811 123
159 3300025942 Ga0207689_10007492 Ga0207689_100074925 123
160 3300025945 Ga0207679_10305716 Ga0207679_103057162 123
161 3300025949 Ga0207667_10432576 Ga0207667_104325762 123
162 3300025960 Ga0207651_10372894 Ga0207651_103728942 123
163 3300025961 Ga0207712_10120849 Ga0207712_101208492 123
164 3300025981 Ga0207640_10266778 Ga0207640_102667782 123
165 3300026023 Ga0207677_10712925 Ga0207677_107129251 123
166 3300026035 Ga0207703_11958240 Ga0207703_119582401 123
167 3300026041 Ga0207639_10539149 Ga0207639_105391491 123
168 3300026075 Ga0207708_10078873 Ga0207708_100788732 123
169 3300026078 Ga0207702_10353734 Ga0207702_103537342 123
170 3300026088 Ga0207641_10203088 Ga0207641_102030882 123
171 3300026116 Ga0207674_10031889 Ga0207674_100318897 123
172 3300026118 Ga0207675_100036495 Ga0207675_1000364951 123
173 3300026121 Ga0207683_10004432 Ga0207683_100044327 123
174 3300026142 Ga0207698_11366606 Ga0207698_113666062 123
175 3300028379 Ga0268266_10219916 Ga0268266_102199162 123
176 3300028380 Ga0268265_10401582 Ga0268265_104015822 123
177 3300031090 Ga0265760_10022196 Ga0265760_100221963 123
178 3300031824 Ga0307413_10167488 Ga0307413_101674881 123
179 3300031903 Ga0307407_10692652 Ga0307407_106926522 123
180 3300031995 Ga0307409_100907227 Ga0307409_1009072272 123
181 3300034817 Ga0373948_0103450 Ga0373948_0103450_67_438 123
182 3300034819 Ga0373958_0137908 Ga0373958_0137908_113_484 123
183 3300035084 Ga0373928_0025906 Ga0373928_0025906_679_1050 123
184 3300035085 Ga0373929_0028315 Ga0373929_0028315_283_654 123
185 3300035088 Ga0373940_0057740 Ga0373940_0057740_659_1030 123
186 3300035091 Ga0373951_0058398 Ga0373951_0058398_315_686 123
187 3300035092 Ga0373952_0110935 Ga0373952_0110935_120_491 123
188 3300035114 Ga0373939_0004303 Ga0373939_0004303_1656_2027 123
189 3300035115 Ga0373941_0034735 Ga0373941_0034735_1086_1457 123
190 3300035170 Ga0373943_0408541 Ga0373943_0408541_88_459 123
191 3300035207 Ga0373942_0024561 Ga0373942_0024561_997_1368 123
192 3300035242 Ga0373962_0118504 Ga0373962_0118504_274_645 123
193 3300035410 Ga0373924_0193683 Ga0373924_0193683_161_532 123
194 3300035691 Ga0373931_0229304 Ga0373931_0229304_460_831 123
195 3300035692 Ga0373935_0874719 Ga0373935_0874719_272_643 123
196 3300035724 Ga0373933_0516184 Ga0373933_0516184_88_459 123
197 3300035725 Ga0373947_0676260 Ga0373947_0676260_43_414 123
198 3300036401 Ga0373937_1795637 Ga0373937_1795637_53_424 123
199 3300044765 Ga0466970_0328114 Ga0466970_0328114_334_723 123
200 3300045049 Ga0466959_0478605 Ga0466959_0478605_329_700 123
201 3300045976 Ga0466967_0920682 Ga0466967_0920682_349_720 123
202 3300046455 Ga0495603_0357036 Ga0495603_0357036_306_677 123
203 3300046462 Ga0495651_0203395 Ga0495651_0203395_822_1193 123
204 3300046463 Ga0495653_0370261 Ga0495653_0370261_11_382 123
205 3300046472 Ga0495580_0427041 Ga0495580_0427041_42_413 123
206 3300046477 Ga0495664_0419395 Ga0495664_0419395_183_554 123
207 3300046499 Ga0495594_0357465 Ga0495594_0357465_161_532 123
208 3300046511 Ga0495608_0468584 Ga0495608_0468584_44_415 123
209 3300046516 Ga0495628_0607180 Ga0495628_0607180_243_614 123
210 3300046529 Ga0495652_1016114 Ga0495652_1016114_70_441 123
211 3300046531 Ga0495665_0377097 Ga0495665_0377097_66_437 123
212 3300046559 Ga0495667_0095106 Ga0495667_0095106_513_884 123
213 3300046663 Ga0495635_0453559 Ga0495635_0453559_129_500 123
214 3300046674 Ga0495588_0738052 Ga0495588_0738052_106_477 123
215 3300046675 Ga0495657_0305821 Ga0495657_0305821_488_859 123
216 3300046680 Ga0495646_0636083 Ga0495646_0636083_27_398 123
217 3300046809 Ga0495600_0283951 Ga0495600_0283951_339_710 123
218 3300047319 Ga0495674_0253029 Ga0495674_0253029_736_1107 123
219 3300047322 Ga0495680_0282580 Ga0495680_0282580_479_850 123
220 3300047471 Ga0495684_0074725 Ga0495684_0074725_1119_1490 123
221 3300048903 Ga0496100_0215563 Ga0496100_0215563_753_1124 123
222 3300048904 Ga0496101_0643877 Ga0496101_0643877_172_543 123
223 3300048905 Ga0496102_0474200 Ga0496102_0474200_52_423 123
224 3300048906 Ga0496103_0021372 Ga0496103_0021372_2437_2808 123
225 3300048907 Ga0496104_0037090 Ga0496104_0037090_4026_4397 123
226 3300048908 Ga0496105_0199255 Ga0496105_0199255_179_550 123
227 3300048909 Ga0496106_0372489 Ga0496106_0372489_728_1099 123
228 3300048910 Ga0496107_0150648 Ga0496107_0150648_1154_1525 123
229 3300048911 Ga0496108_0456966 Ga0496108_0456966_575_946 123
230 3300048912 Ga0496109_1073106 Ga0496109_1073106_81_452 123
231 3300048913 Ga0496110_0131603 Ga0496110_0131603_707_1078 123
232 3300048914 Ga0496111_0062304 Ga0496111_0062304_820_1191 123
233 3300048915 Ga0496112_0540391 Ga0496112_0540391_463_834 123
234 3300048916 Ga0496113_0077235 Ga0496113_0077235_1712_2083 123
235 3300048917 Ga0496114_0041577 Ga0496114_0041577_3268_3639 123
236 3300048929 Ga0496126_1022389 Ga0496126_1022389_225_596 123
237 3300050514 nmdc:mga08x19_668668_c1 nmdc:mga08x19_668668_c1_94_465 123
238 3300050515 nmdc:mga0a205_762162_c1 nmdc:mga0a205_762162_c1_169_540 123
239 3300053140 Ga0500573_0076612 Ga0500573_0076612_598_975 123
240 3300053142 Ga0500577_0001913 Ga0500577_0001913_721_1098 123
241 3300061734 Ga0530510_0056768 Ga0530510_0056768_2222_2593 123
242 3300061734 Ga0530510_0098628 Ga0530510_0098628_790_1167 123
243 3300005535 Ga0070684_100097591 Ga0070684_1000975913 124
244 3300006844 Ga0075428_102379117 Ga0075428_1023791171 124
245 3300006852 Ga0075433_10845704 Ga0075433_108457042 124
246 3300009147 Ga0114129_10688098 Ga0114129_106880982 124
247 3300046525 Ga0495663_0133473 Ga0495663_0133473_286_669 124
248 3300046794 Ga0495589_0367898 Ga0495589_0367898_196_579 124
249 3300046810 Ga0495660_0319120 Ga0495660_0319120_120_503 124
250 3300049578 Ga0501042_0670176 Ga0501042_0670176_340_714 124
251 3300049743 Ga0501081_0254146 Ga0501081_0254146_61_435 124
252 3300050507 nmdc:mga05p37_457175_c1 nmdc:mga05p37_457175_c1_455_838 124
253 3300050511 nmdc:mga08y16_911817_c1 nmdc:mga08y16_911817_c1_200_583 124
254 3300061734 Ga0530510_0672181 Ga0530510_0672181_262_636 124
255 3300005329 Ga0070683_100265673 Ga0070683_1002656732 125
256 3300005335 Ga0070666_10013002 Ga0070666_100130026 125
257 3300005344 Ga0070661_100000116 Ga0070661_10000011630 125
258 3300005347 Ga0070668_100088271 Ga0070668_1000882713 125
259 3300005365 Ga0070688_100000066 Ga0070688_10000006612 125
260 3300005466 Ga0070685_10000955 Ga0070685_1000095512 125
261 3300005535 Ga0070684_100024975 Ga0070684_1000249755 125
262 3300005548 Ga0070665_100000846 Ga0070665_10000084642 125
263 3300005981 Ga0081538_10000161 Ga0081538_100001617 125
264 3300014969 Ga0157376_10242278 Ga0157376_102422783 125
265 3300025903 Ga0207680_10021869 Ga0207680_100218691 125
266 3300025920 Ga0207649_10000005 Ga0207649_10000005119 125
267 3300025944 Ga0207661_10248459 Ga0207661_102484592 125
268 3300025972 Ga0207668_10073083 Ga0207668_100730833 125
269 3300028379 Ga0268266_10001882 Ga0268266_1000188223 125
270 3300038443 Ga0395901_0812798 Ga0395901_0812798_462_851 125
271 3300005329 Ga0070683_100017829 Ga0070683_1000178297 126
272 3300005353 Ga0070669_100083917 Ga0070669_1000839172 126
273 3300005356 Ga0070674_100000103 Ga0070674_10000010321 126
274 3300005364 Ga0070673_100004922 Ga0070673_1000049222 126
275 3300005456 Ga0070678_100001532 Ga0070678_10000153211 126
276 3300005456 Ga0070678_100036225 Ga0070678_1000362252 126
277 3300005459 Ga0068867_100349587 Ga0068867_1003495871 126
278 3300005535 Ga0070684_100017747 Ga0070684_1000177474 126
279 3300005535 Ga0070684_100031509 Ga0070684_1000315094 126
280 3300005543 Ga0070672_100008239 Ga0070672_1000082393 126
281 3300005563 Ga0068855_100540796 Ga0068855_1005407962 126
282 3300005718 Ga0068866_10000014 Ga0068866_1000001459 126
283 3300005843 Ga0068860_100020985 Ga0068860_1000209857 126
284 3300005937 Ga0081455_10377741 Ga0081455_103777412 126
285 3300006038 Ga0075365_10376712 Ga0075365_103767122 126
286 3300006163 Ga0070715_10000011 Ga0070715_1000001160 126
287 3300006175 Ga0070712_100000339 Ga0070712_10000033917 126
288 3300012507 Ga0157342_1024673 Ga0157342_10246732 126
289 3300013296 Ga0157374_10019367 Ga0157374_100193676 126
290 3300013297 Ga0157378_10042780 Ga0157378_100427802 126
291 3300013297 Ga0157378_10696432 Ga0157378_106964321 126
292 3300013308 Ga0157375_10030821 Ga0157375_100308213 126
293 3300014326 Ga0157380_10380563 Ga0157380_103805631 126
294 3300014968 Ga0157379_10235748 Ga0157379_102357482 126
295 3300017792 Ga0163161_11052038 Ga0163161_110520382 126
296 3300025899 Ga0207642_10000001 Ga0207642_10000001739 126
297 3300025905 Ga0207685_10000001 Ga0207685_10000001127 126
298 3300025915 Ga0207693_10002524 Ga0207693_1000252414 126
299 3300025923 Ga0207681_10230643 Ga0207681_102306432 126
300 3300025937 Ga0207669_10000115 Ga0207669_1000011521 126
301 3300025940 Ga0207691_10043696 Ga0207691_100436963 126
302 3300025941 Ga0207711_11703842 Ga0207711_117038422 126
303 3300025944 Ga0207661_10003140 Ga0207661_1000314012 126
304 3300025944 Ga0207661_10004159 Ga0207661_100041596 126
305 3300025960 Ga0207651_10002681 Ga0207651_1000268110 126
306 3300026035 Ga0207703_10000237 Ga0207703_1000023759 126
307 3300026089 Ga0207648_10088984 Ga0207648_100889844 126
308 3300026121 Ga0207683_10004976 Ga0207683_1000497613 126
309 3300026121 Ga0207683_10065884 Ga0207683_100658842 126
310 3300028381 Ga0268264_10025968 Ga0268264_100259684 126
311 3300037418 Ga0395900_0366070 Ga0395900_0366070_112_492 126
312 3300037466 Ga0395898_0593402 Ga0395898_0593402_541_921 126
313 3300038443 Ga0395901_0133468 Ga0395901_0133468_866_1246 126
314 3300038443 Ga0395901_1366750 Ga0395901_1366750_205_585 126
315 3300045051 Ga0451576_0134326 Ga0451576_0134326_614_994 126
316 3300046473 Ga0495582_0000013 Ga0495582_0000013_10916_11296 126
317 3300046475 Ga0495639_0018984 Ga0495639_0018984_2254_2634 126
318 3300046642 Ga0495634_0001221 Ga0495634_0001221_7694_8074 126
319 3300046642 Ga0495634_0208160 Ga0495634_0208160_614_994 126
320 3300046681 Ga0495647_0000046 Ga0495647_0000046_15264_15644 126
321 3300046683 Ga0495658_0000009 Ga0495658_0000009_99086_99466 126
322 3300046691 Ga0495670_0009994 Ga0495670_0009994_3689_4069 126
323 3300046809 Ga0495600_0759632 Ga0495600_0759632_133_513 126
324 3300047469 Ga0495673_0089273 Ga0495673_0089273_130_510 126
325 3300048088 Ga0495602_0020203 Ga0495602_0020203_5374_5754 126
326 3300048909 Ga0496106_0138115 Ga0496106_0138115_1230_1610 126
327 3300048909 Ga0496106_0684485 Ga0496106_0684485_120_500 126
328 3300048910 Ga0496107_0667202 Ga0496107_0667202_321_701 126
329 3300048911 Ga0496108_0026177 Ga0496108_0026177_1624_2004 126
330 3300048912 Ga0496109_0000248 Ga0496109_0000248_21909_22289 126
331 3300048916 Ga0496113_0028160 Ga0496113_0028160_1788_2168 126
332 3300049578 Ga0501042_0117175 Ga0501042_0117175_795_1175 126
333 3300049578 Ga0501042_0266646 Ga0501042_0266646_46_426 126
334 3300049586 Ga0501070_0156839 Ga0501070_0156839_1206_1586 126
335 3300049588 Ga0501072_0049010 Ga0501072_0049010_1301_1681 126
336 3300049741 Ga0501079_1394823 Ga0501079_1394823_59_439 126
337 3300049824 Ga0501045_1365460 Ga0501045_1365460_106_486 126
338 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_129487_129867 126
339 3300054114 Ga0501084_1111040 Ga0501084_1111040_124_504 126
340 3300060353 Ga0501082_0230736 Ga0501082_0230736_1217_1597 126
341 3300005328 Ga0070676_10443795 Ga0070676_104437952 127
342 3300005335 Ga0070666_11100951 Ga0070666_111009511 127
343 3300005337 Ga0070682_100000077 Ga0070682_10000007724 127
344 3300005338 Ga0068868_100002341 Ga0068868_10000234112 127
345 3300005340 Ga0070689_100075918 Ga0070689_1000759182 127
346 3300005347 Ga0070668_100001597 Ga0070668_1000015977 127
347 3300005366 Ga0070659_100108720 Ga0070659_1001087204 127
348 3300005367 Ga0070667_100005325 Ga0070667_1000053255 127
349 3300005439 Ga0070711_100518573 Ga0070711_1005185731 127
350 3300005441 Ga0070700_100118233 Ga0070700_1001182332 127
351 3300005457 Ga0070662_100000005 Ga0070662_10000000512 127
352 3300005458 Ga0070681_10033752 Ga0070681_100337523 127
353 3300005530 Ga0070679_100000487 Ga0070679_10000048724 127
354 3300005539 Ga0068853_100004202 Ga0068853_10000420211 127
355 3300005539 Ga0068853_100077288 Ga0068853_1000772883 127
356 3300005547 Ga0070693_100571527 Ga0070693_1005715272 127
357 3300005548 Ga0070665_100000341 Ga0070665_10000034145 127
358 3300005548 Ga0070665_100844792 Ga0070665_1008447922 127
359 3300005549 Ga0070704_101341486 Ga0070704_1013414861 127
360 3300005563 Ga0068855_100172973 Ga0068855_1001729732 127
361 3300005578 Ga0068854_100104593 Ga0068854_1001045933 127
362 3300005614 Ga0068856_100100573 Ga0068856_1001005734 127
363 3300005719 Ga0068861_100825515 Ga0068861_1008255152 127
364 3300005842 Ga0068858_100000251 Ga0068858_10000025113 127
365 3300005843 Ga0068860_100607494 Ga0068860_1006074942 127
366 3300005844 Ga0068862_100002273 Ga0068862_1000022732 127
367 3300005937 Ga0081455_10055679 Ga0081455_100556792 127
368 3300009093 Ga0105240_11044676 Ga0105240_110446762 127
369 3300009098 Ga0105245_10012189 Ga0105245_100121893 127
370 3300009101 Ga0105247_10804901 Ga0105247_108049012 127
371 3300009176 Ga0105242_10130238 Ga0105242_101302383 127
372 3300009551 Ga0105238_10000172 Ga0105238_1000017250 127
373 3300009553 Ga0105249_10018681 Ga0105249_100186817 127
374 3300013104 Ga0157370_10953235 Ga0157370_109532352 127
375 3300013297 Ga0157378_11075812 Ga0157378_110758121 127
376 3300014326 Ga0157380_10046566 Ga0157380_100465662 127
377 3300017792 Ga0163161_11016193 Ga0163161_110161932 127
378 3300020078 Ga0206352_10175609 Ga0206352_101756092 127
379 3300025912 Ga0207707_10023070 Ga0207707_100230703 127
380 3300025913 Ga0207695_10721445 Ga0207695_107214452 127
381 3300025916 Ga0207663_10039966 Ga0207663_100399664 127
382 3300025921 Ga0207652_10000658 Ga0207652_1000065824 127
383 3300025924 Ga0207694_10000004 Ga0207694_10000004934 127
384 3300025927 Ga0207687_10000167 Ga0207687_1000016745 127
385 3300025932 Ga0207690_10350217 Ga0207690_103502172 127
386 3300025933 Ga0207706_10000006 Ga0207706_10000006227 127
387 3300025934 Ga0207686_10145931 Ga0207686_101459312 127
388 3300025936 Ga0207670_10238103 Ga0207670_102381032 127
389 3300025938 Ga0207704_10482154 Ga0207704_104821542 127
390 3300025949 Ga0207667_10180179 Ga0207667_101801792 127
391 3300025961 Ga0207712_10009056 Ga0207712_100090562 127
392 3300025961 Ga0207712_10845599 Ga0207712_108455992 127
393 3300025972 Ga0207668_10002148 Ga0207668_1000214812 127
394 3300025981 Ga0207640_10197106 Ga0207640_101971063 127
395 3300025986 Ga0207658_10004877 Ga0207658_100048778 127
396 3300026023 Ga0207677_10000677 Ga0207677_100006776 127
397 3300026035 Ga0207703_10000128 Ga0207703_1000012840 127
398 3300026041 Ga0207639_10031439 Ga0207639_100314393 127
399 3300026041 Ga0207639_10109156 Ga0207639_101091563 127
400 3300026075 Ga0207708_10249001 Ga0207708_102490012 127
401 3300026078 Ga0207702_10004618 Ga0207702_1000461812 127
402 3300026118 Ga0207675_100473988 Ga0207675_1004739883 127
403 3300028379 Ga0268266_10000020 Ga0268266_10000020420 127
404 3300028380 Ga0268265_10000938 Ga0268265_1000093817 127
405 3300028381 Ga0268264_12073480 Ga0268264_120734802 127
406 3300035117 Ga0373953_0233731 Ga0373953_0233731_139_528 127
407 3300035170 Ga0373943_0782931 Ga0373943_0782931_68_451 127
408 3300035172 Ga0373955_0117970 Ga0373955_0117970_348_737 127
409 3300036401 Ga0373937_0034652 Ga0373937_0034652_2578_2967 127
410 3300046454 Ga0495592_0171595 Ga0495592_0171595_975_1358 127
411 3300046461 Ga0495641_0000001 Ga0495641_0000001_479283_479666 127
412 3300046515 Ga0495620_0000747 Ga0495620_0000747_11922_12308 127
413 3300046523 Ga0495644_0000499 Ga0495644_0000499_12547_12930 127
414 3300046535 Ga0495586_0000537 Ga0495586_0000537_15948_16334 127
415 3300046536 Ga0495587_0011847 Ga0495587_0011847_1831_2217 127
416 3300046537 Ga0495598_0004358 Ga0495598_0004358_1506_1892 127
417 3300046543 Ga0495645_0054401 Ga0495645_0054401_460_843 127
418 3300046642 Ga0495634_0238493 Ga0495634_0238493_614_997 127
419 3300046678 Ga0495599_0110646 Ga0495599_0110646_150_533 127
420 3300046679 Ga0495623_0413748 Ga0495623_0413748_155_541 127
421 3300046681 Ga0495647_0113957 Ga0495647_0113957_595_978 127
422 3300046684 Ga0495669_0000083 Ga0495669_0000083_39687_40073 127
423 3300046690 Ga0495624_0000307 Ga0495624_0000307_19034_19417 127
424 3300046694 Ga0495649_0032859 Ga0495649_0032859_684_1067 127
425 3300047317 Ga0495604_0047397 Ga0495604_0047397_773_1156 127
426 3300047321 Ga0495676_0001446 Ga0495676_0001446_18069_18452 127
427 3300047322 Ga0495680_0000599 Ga0495680_0000599_22559_22942 127
428 3300048903 Ga0496100_0000007 Ga0496100_0000007_234371_234754 127
429 3300048904 Ga0496101_0000013 Ga0496101_0000013_234371_234754 127
430 3300048907 Ga0496104_0000013 Ga0496104_0000013_26634_27023 127
431 3300048908 Ga0496105_0000006 Ga0496105_0000006_370141_370530 127
432 3300048909 Ga0496106_0000006 Ga0496106_0000006_228510_228893 127
433 3300048910 Ga0496107_0000007 Ga0496107_0000007_228512_228895 127
434 3300048913 Ga0496110_0010361 Ga0496110_0010361_5863_6246 127
435 3300048913 Ga0496110_1201915 Ga0496110_1201915_199_612 127
436 3300048915 Ga0496112_0000003 Ga0496112_0000003_411289_411678 127
437 3300048917 Ga0496114_0116555 Ga0496114_0116555_1224_1610 127
438 3300049592 Ga0501076_1674091 Ga0501076_1674091_46_435 127
439 3300053077 Ga0495601_0000581 Ga0495601_0000581_16477_16860 127
440 3300053078 Ga0495612_0001629 Ga0495612_0001629_3908_4291 127
441 3300053085 Ga0495619_0002122 Ga0495619_0002122_6366_6752 127
442 3300053123 Ga0500614_022982 Ga0500614_022982_313_696 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

144

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lvc-assembly1.cif.gz_A crystal structure of s-adenosyl-l-homocysteine hydrolase from bradyrhizobium elkanii in complex with adenosine 0.8181 28 54
7zd8-assembly1.cif.gz_A crystal structure of the r24e mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations 0.7968 30 54
7zd9-assembly1.cif.gz_A crystal structure of the e352t mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations 0.7961 30 54
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7884 4 126
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.7811 3 124
ID Description Score Start End Superfamily
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7956 7 127 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7888 4 126 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7875 7 126 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7811 7 126 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7773 7 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A445ND58-F1-model_v4 deleted 0.9729 1 126
AF-A0A853BS13-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9711 1 126 GO:0016829
AF-A0A852U876-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9702 1 106 GO:0016829
AF-A0A2N7T1R3-F1-model_v4 deleted 0.9655 1 125
AF-C1A0R7-F1-model_v4 VOC domain-containing protein 0.9648 1 126

Feature Viewer

pLDDT pTM Quality
94.95 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map