F444858
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 442 | 294 | 442 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_11044676|Ga0105240_110446762 |
| Length | 150 |
| Sequence | MVGGRGEETFGPDRVIRKRGANVFADTKATNGFAVNDIEAAKRFYGETLGLGFKVMSEEFGLASIQLAGGRDTLVYAKPDFVPATYTILNFEVDDVDAAVDELGAKGVEFERYEGFEQDEKGIARGPGPSIAWFKDPAGNILAVLQQPSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 99 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 100 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 101 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 290 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 291 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 1.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0 |
| Rhizoplane | 7.01 |
| Rhizosphere | 91.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10443795 | 3300005328 | Bacteria | 911 |
| 2 | Ga0070683_100017829 | 3300005329 | Bacteria | 6275 |
| 3 | Ga0070683_100035577 | 3300005329 | Bacteria | 4552 |
| 4 | Ga0070683_100265673 | 3300005329 | Bacteria | 1632 |
| 5 | Ga0070670_100648624 | 3300005331 | Bacteria | 947 |
| 6 | Ga0068869_100035411 | 3300005334 | Bacteria | 3537 |
| 7 | Ga0070666_10013002 | 3300005335 | Bacteria | 5270 |
| 8 | Ga0070666_10229780 | 3300005335 | Bacteria | 1310 |
| 9 | Ga0070666_11100951 | 3300005335 | Bacteria | 590 |
| 10 | Ga0070680_100734715 | 3300005336 | Bacteria | 850 |
| 11 | Ga0070682_100000077 | 3300005337 | Bacteria | 89055 |
| 12 | Ga0070682_100037652 | 3300005337 | Bacteria | 2963 |
| 13 | Ga0068868_100002341 | 3300005338 | Bacteria | 13109 |
| 14 | Ga0070689_100075918 | 3300005340 | Bacteria | 2632 |
| 15 | Ga0070689_100302104 | 3300005340 | Bacteria | 1332 |
| 16 | Ga0070691_10031087 | 3300005341 | Bacteria | 2503 |
| 17 | Ga0070661_100000116 | 3300005344 | Bacteria | 66712 |
| 18 | Ga0070661_100103860 | 3300005344 | Bacteria | 2117 |
| 19 | Ga0070668_100001597 | 3300005347 | Bacteria | 16399 |
| 20 | Ga0070668_100088271 | 3300005347 | Bacteria | 2441 |
| 21 | Ga0070669_100083917 | 3300005353 | Unclassified | 2376 |
| 22 | Ga0070675_100537574 | 3300005354 | Bacteria | 1056 |
| 23 | Ga0070671_100316517 | 3300005355 | Bacteria | 1329 |
| 24 | Ga0070674_100000103 | 3300005356 | Bacteria | 39432 |
| 25 | Ga0070673_100004922 | 3300005364 | Bacteria | 8505 |
| 26 | Ga0070673_100258040 | 3300005364 | Bacteria | 1522 |
| 27 | Ga0070688_100000066 | 3300005365 | Bacteria | 52354 |
| 28 | Ga0070688_100510961 | 3300005365 | Bacteria | 908 |
| 29 | Ga0070659_100108720 | 3300005366 | Bacteria | 2237 |
| 30 | Ga0070667_100005325 | 3300005367 | Bacteria | 10748 |
| 31 | Ga0070667_100519580 | 3300005367 | Bacteria | 1092 |
| 32 | Ga0070703_10100680 | 3300005406 | Bacteria | 1018 |
| 33 | Ga0070714_100006378 | 3300005435 | Bacteria | 9104 |
| 34 | Ga0070714_100084621 | 3300005435 | Bacteria | 2768 |
| 35 | Ga0070713_100219723 | 3300005436 | Bacteria | 1723 |
| 36 | Ga0070713_100585599 | 3300005436 | Bacteria | 1059 |
| 37 | Ga0070713_101127541 | 3300005436 | Unclassified | 758 |
| 38 | Ga0070710_10031426 | 3300005437 | Bacteria | 2867 |
| 39 | Ga0070710_10036661 | 3300005437 | Bacteria | 2681 |
| 40 | Ga0070710_10463120 | 3300005437 | Bacteria | 861 |
| 41 | Ga0070711_100009684 | 3300005439 | Bacteria | 5937 |
| 42 | Ga0070711_100077921 | 3300005439 | Bacteria | 2354 |
| 43 | Ga0070711_100359320 | 3300005439 | Bacteria | 1173 |
| 44 | Ga0070711_100405463 | 3300005439 | Bacteria | 1107 |
| 45 | Ga0070711_100518573 | 3300005439 | Bacteria | 985 |
| 46 | Ga0070711_101702086 | 3300005439 | Bacteria | 552 |
| 47 | Ga0070705_100028799 | 3300005440 | Bacteria | 3046 |
| 48 | Ga0070700_100118233 | 3300005441 | Bacteria | 1772 |
| 49 | Ga0070694_100070536 | 3300005444 | Bacteria | 2406 |
| 50 | Ga0070708_101052325 | 3300005445 | Bacteria | 762 |
| 51 | Ga0070663_100022299 | 3300005455 | Bacteria | 4231 |
| 52 | Ga0070678_100001532 | 3300005456 | Bacteria | 12353 |
| 53 | Ga0070678_100036225 | 3300005456 | Bacteria | 3452 |
| 54 | Ga0070678_100102271 | 3300005456 | Bacteria | 2223 |
| 55 | Ga0070662_100000005 | 3300005457 | Bacteria | 183056 |
| 56 | Ga0070662_100498273 | 3300005457 | Bacteria | 1016 |
| 57 | Ga0070681_10033752 | 3300005458 | Bacteria | 5137 |
| 58 | Ga0070681_10226916 | 3300005458 | Bacteria | 1782 |
| 59 | Ga0068867_100349587 | 3300005459 | Bacteria | 1233 |
| 60 | Ga0070685_10000955 | 3300005466 | Bacteria | 15510 |
| 61 | Ga0070685_10011144 | 3300005466 | Bacteria | 4699 |
| 62 | Ga0070706_100077044 | 3300005467 | Bacteria | 3086 |
| 63 | Ga0070706_101150135 | 3300005467 | Bacteria | 714 |
| 64 | Ga0070707_100951701 | 3300005468 | Bacteria | 824 |
| 65 | Ga0070699_100918770 | 3300005518 | Bacteria | 802 |
| 66 | Ga0070679_100000487 | 3300005530 | Bacteria | 33946 |
| 67 | Ga0070679_100190776 | 3300005530 | Bacteria | 2018 |
| 68 | Ga0070684_100017747 | 3300005535 | Bacteria | 5848 |
| 69 | Ga0070684_100024975 | 3300005535 | Bacteria | 5018 |
| 70 | Ga0070684_100031509 | 3300005535 | Bacteria | 4515 |
| 71 | Ga0070684_100097591 | 3300005535 | Bacteria | 2620 |
| 72 | Ga0070684_100361174 | 3300005535 | Bacteria | 1336 |
| 73 | Ga0070697_101096504 | 3300005536 | Bacteria | 708 |
| 74 | Ga0068853_100004202 | 3300005539 | Bacteria | 11107 |
| 75 | Ga0068853_100077288 | 3300005539 | Bacteria | 2908 |
| 76 | Ga0068853_100609040 | 3300005539 | Bacteria | 1038 |
| 77 | Ga0070672_100008239 | 3300005543 | Bacteria | 7123 |
| 78 | Ga0070672_100242672 | 3300005543 | Bacteria | 1516 |
| 79 | Ga0070695_100291686 | 3300005545 | Bacteria | 1203 |
| 80 | Ga0070696_100338892 | 3300005546 | Bacteria | 1162 |
| 81 | Ga0070693_100571527 | 3300005547 | Bacteria | 812 |
| 82 | Ga0070665_100000341 | 3300005548 | Bacteria | 70565 |
| 83 | Ga0070665_100000846 | 3300005548 | Bacteria | 39881 |
| 84 | Ga0070665_100818201 | 3300005548 | Bacteria | 944 |
| 85 | Ga0070665_100844792 | 3300005548 | Bacteria | 929 |
| 86 | Ga0070704_101341486 | 3300005549 | Unclassified | 655 |
| 87 | Ga0068855_100172973 | 3300005563 | Bacteria | 2445 |
| 88 | Ga0068855_100540796 | 3300005563 | Bacteria | 1262 |
| 89 | Ga0070664_100178909 | 3300005564 | Bacteria | 1884 |
| 90 | Ga0068857_100449435 | 3300005577 | Bacteria | 1204 |
| 91 | Ga0068854_100104593 | 3300005578 | Bacteria | 2127 |
| 92 | Ga0068856_100100573 | 3300005614 | Bacteria | 2883 |
| 93 | Ga0068852_100288460 | 3300005616 | Bacteria | 1584 |
| 94 | Ga0068859_102542277 | 3300005617 | Bacteria | 564 |
| 95 | Ga0068864_100066951 | 3300005618 | Bacteria | 3118 |
| 96 | Ga0068866_10000014 | 3300005718 | Bacteria | 72482 |
| 97 | Ga0068861_100714156 | 3300005719 | Bacteria | 933 |
| 98 | Ga0068861_100825515 | 3300005719 | Bacteria | 872 |
| 99 | Ga0068851_10421200 | 3300005834 | Bacteria | 789 |
| 100 | Ga0068870_10450577 | 3300005840 | Bacteria | 848 |
| 101 | Ga0068863_100362351 | 3300005841 | Bacteria | 1413 |
| 102 | Ga0068858_100000251 | 3300005842 | Bacteria | 57269 |
| 103 | Ga0068858_100477195 | 3300005842 | Bacteria | 1203 |
| 104 | Ga0068860_100020985 | 3300005843 | Bacteria | 6329 |
| 105 | Ga0068860_100164413 | 3300005843 | Bacteria | 2141 |
| 106 | Ga0068860_100607494 | 3300005843 | Bacteria | 1099 |
| 107 | Ga0068862_100002273 | 3300005844 | Bacteria | 17193 |
| 108 | Ga0068862_100898506 | 3300005844 | Bacteria | 871 |
| 109 | Ga0081455_10055679 | 3300005937 | Bacteria | 3363 |
| 110 | Ga0081455_10333705 | 3300005937 | Bacteria | 1076 |
| 111 | Ga0081455_10377741 | 3300005937 | Bacteria | 991 |
| 112 | Ga0081538_10000161 | 3300005981 | Bacteria | 70862 |
| 113 | Ga0081540_1000356 | 3300005983 | Bacteria | 46150 |
| 114 | Ga0081539_10028694 | 3300005985 | Bacteria | 3495 |
| 115 | Ga0070717_10058960 | 3300006028 | Bacteria | 3175 |
| 116 | Ga0070717_11509271 | 3300006028 | Bacteria | 610 |
| 117 | Ga0075365_10376712 | 3300006038 | Bacteria | 1001 |
| 118 | Ga0070715_10000011 | 3300006163 | Bacteria | 183857 |
| 119 | Ga0070715_10035997 | 3300006163 | Bacteria | 2039 |
| 120 | Ga0070716_100052239 | 3300006173 | Bacteria | 2326 |
| 121 | Ga0070716_100079824 | 3300006173 | Bacteria | 1949 |
| 122 | Ga0070716_100337748 | 3300006173 | Bacteria | 1061 |
| 123 | Ga0070712_100000339 | 3300006175 | Bacteria | 26368 |
| 124 | Ga0070712_100071782 | 3300006175 | Bacteria | 2478 |
| 125 | Ga0070712_100082256 | 3300006175 | Bacteria | 2335 |
| 126 | Ga0070712_100105228 | 3300006175 | Bacteria | 2095 |
| 127 | Ga0070712_100230376 | 3300006175 | Bacteria | 1471 |
| 128 | Ga0097621_101783773 | 3300006237 | Bacteria | 586 |
| 129 | Ga0068871_100290108 | 3300006358 | Bacteria | 1433 |
| 130 | Ga0075428_102379117 | 3300006844 | Bacteria | 544 |
| 131 | Ga0075433_10845704 | 3300006852 | Bacteria | 799 |
| 132 | Ga0075434_101100388 | 3300006871 | Bacteria | 808 |
| 133 | Ga0075429_101107960 | 3300006880 | Unclassified | 691 |
| 134 | Ga0068865_100469222 | 3300006881 | Bacteria | 1044 |
| 135 | Ga0097620_102542218 | 3300006931 | Bacteria | 564 |
| 136 | Ga0075435_100978295 | 3300007076 | Bacteria | 739 |
| 137 | Ga0105251_10048426 | 3300009011 | Bacteria | 2037 |
| 138 | Ga0105240_11044676 | 3300009093 | Bacteria | 872 |
| 139 | Ga0105245_10012189 | 3300009098 | Bacteria | 7477 |
| 140 | Ga0105245_10303354 | 3300009098 | Bacteria | 1568 |
| 141 | Ga0105245_11667752 | 3300009098 | Bacteria | 689 |
| 142 | Ga0105247_10062743 | 3300009101 | Bacteria | 2306 |
| 143 | Ga0105247_10804901 | 3300009101 | Bacteria | 717 |
| 144 | Ga0114129_10688098 | 3300009147 | Bacteria | 1316 |
| 145 | Ga0105243_10070154 | 3300009148 | Bacteria | 2829 |
| 146 | Ga0105241_10096385 | 3300009174 | Bacteria | 2343 |
| 147 | Ga0105242_10125075 | 3300009176 | Bacteria | 2212 |
| 148 | Ga0105242_10130238 | 3300009176 | Bacteria | 2170 |
| 149 | Ga0105248_10489930 | 3300009177 | Bacteria | 1386 |
| 150 | Ga0105237_10807746 | 3300009545 | Bacteria | 945 |
| 151 | Ga0105238_10000172 | 3300009551 | Bacteria | 70799 |
| 152 | Ga0105249_10018681 | 3300009553 | Bacteria | 6174 |
| 153 | Ga0105249_11112478 | 3300009553 | Bacteria | 860 |
| 154 | Ga0099796_10250690 | 3300010159 | Bacteria | 735 |
| 155 | Ga0105239_10530362 | 3300010375 | Bacteria | 1340 |
| 156 | Ga0105246_10064265 | 3300011119 | Bacteria | 2563 |
| 157 | Ga0157345_1003021 | 3300012498 | Bacteria | 1212 |
| 158 | Ga0157314_1036047 | 3300012500 | Bacteria | 578 |
| 159 | Ga0157342_1007423 | 3300012507 | Bacteria | 1063 |
| 160 | Ga0157342_1024673 | 3300012507 | Bacteria | 722 |
| 161 | Ga0157315_1073212 | 3300012508 | Bacteria | 508 |
| 162 | Ga0157370_10156968 | 3300013104 | Bacteria | 2117 |
| 163 | Ga0157370_10953235 | 3300013104 | Bacteria | 778 |
| 164 | Ga0157370_11757674 | 3300013104 | Bacteria | 557 |
| 165 | Ga0157374_10019367 | 3300013296 | Bacteria | 6023 |
| 166 | Ga0157374_10815645 | 3300013296 | Bacteria | 949 |
| 167 | Ga0157378_10042780 | 3300013297 | Bacteria | 4020 |
| 168 | Ga0157378_10085791 | 3300013297 | Bacteria | 2853 |
| 169 | Ga0157378_10696432 | 3300013297 | Unclassified | 1035 |
| 170 | Ga0157378_11075812 | 3300013297 | Bacteria | 841 |
| 171 | Ga0157372_10856363 | 3300013307 | Bacteria | 1055 |
| 172 | Ga0157375_10030821 | 3300013308 | Bacteria | 5062 |
| 173 | Ga0157375_10050868 | 3300013308 | Bacteria | 4066 |
| 174 | Ga0163163_10904037 | 3300014325 | Bacteria | 946 |
| 175 | Ga0157380_10046566 | 3300014326 | Bacteria | 3407 |
| 176 | Ga0157380_10380563 | 3300014326 | Bacteria | 1332 |
| 177 | Ga0182008_10135672 | 3300014497 | Bacteria | 1229 |
| 178 | Ga0157377_10053980 | 3300014745 | Bacteria | 2274 |
| 179 | Ga0157379_10235748 | 3300014968 | Bacteria | 1659 |
| 180 | Ga0157379_11949186 | 3300014968 | Bacteria | 580 |
| 181 | Ga0157376_10242278 | 3300014969 | Bacteria | 1680 |
| 182 | Ga0163161_11016193 | 3300017792 | Bacteria | 708 |
| 183 | Ga0163161_11052038 | 3300017792 | Bacteria | 697 |
| 184 | Ga0206356_11773816 | 3300020070 | Bacteria | 590 |
| 185 | Ga0206352_10175609 | 3300020078 | Bacteria | 709 |
| 186 | Ga0206354_10187246 | 3300020081 | Bacteria | 1101 |
| 187 | Ga0206353_10074122 | 3300020082 | Bacteria | 953 |
| 188 | Ga0224712_10364733 | 3300022467 | Bacteria | 684 |
| 189 | Ga0207692_10024713 | 3300025898 | Bacteria | 2796 |
| 190 | Ga0207692_10075156 | 3300025898 | Bacteria | 1792 |
| 191 | Ga0207692_10098347 | 3300025898 | Bacteria | 1601 |
| 192 | Ga0207692_10105930 | 3300025898 | Bacteria | 1552 |
| 193 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 194 | Ga0207642_10655166 | 3300025899 | Bacteria | 658 |
| 195 | Ga0207688_10012267 | 3300025901 | Bacteria | 4662 |
| 196 | Ga0207680_10021869 | 3300025903 | Bacteria | 3469 |
| 197 | Ga0207647_10118273 | 3300025904 | Bacteria | 1564 |
| 198 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 199 | Ga0207699_10042349 | 3300025906 | Bacteria | 2637 |
| 200 | Ga0207699_10253904 | 3300025906 | Bacteria | 1213 |
| 201 | Ga0207699_10266750 | 3300025906 | Bacteria | 1185 |
| 202 | Ga0207643_10460312 | 3300025908 | Bacteria | 810 |
| 203 | Ga0207705_11161348 | 3300025909 | Bacteria | 593 |
| 204 | Ga0207654_10079431 | 3300025911 | Bacteria | 1971 |
| 205 | Ga0207707_10023070 | 3300025912 | Bacteria | 5444 |
| 206 | Ga0207707_10428513 | 3300025912 | Bacteria | 1133 |
| 207 | Ga0207695_10721445 | 3300025913 | Bacteria | 877 |
| 208 | Ga0207671_10153377 | 3300025914 | Bacteria | 1781 |
| 209 | Ga0207693_10002524 | 3300025915 | Bacteria | 15898 |
| 210 | Ga0207693_10021840 | 3300025915 | Bacteria | 5088 |
| 211 | Ga0207693_10118221 | 3300025915 | Bacteria | 2081 |
| 212 | Ga0207663_10039966 | 3300025916 | Bacteria | 2847 |
| 213 | Ga0207663_10063605 | 3300025916 | Bacteria | 2350 |
| 214 | Ga0207663_10066291 | 3300025916 | Bacteria | 2311 |
| 215 | Ga0207662_10024546 | 3300025918 | Bacteria | 3468 |
| 216 | Ga0207657_10024135 | 3300025919 | Bacteria | 5644 |
| 217 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 218 | Ga0207649_10210597 | 3300025920 | Bacteria | 1379 |
| 219 | Ga0207652_10000658 | 3300025921 | Bacteria | 33940 |
| 220 | Ga0207681_10230643 | 3300025923 | Bacteria | 1437 |
| 221 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 222 | Ga0207650_10940583 | 3300025925 | Bacteria | 734 |
| 223 | Ga0207659_10038303 | 3300025926 | Bacteria | 3334 |
| 224 | Ga0207687_10000167 | 3300025927 | Bacteria | 44044 |
| 225 | Ga0207687_10677800 | 3300025927 | Bacteria | 874 |
| 226 | Ga0207700_10060908 | 3300025928 | Bacteria | 2860 |
| 227 | Ga0207700_10278015 | 3300025928 | Bacteria | 1439 |
| 228 | Ga0207700_11093500 | 3300025928 | Bacteria | 713 |
| 229 | Ga0207664_10012445 | 3300025929 | Bacteria | 6083 |
| 230 | Ga0207664_10067022 | 3300025929 | Bacteria | 2879 |
| 231 | Ga0207664_10408873 | 3300025929 | Bacteria | 1208 |
| 232 | Ga0207690_10350217 | 3300025932 | Bacteria | 1168 |
| 233 | Ga0207706_10000006 | 3300025933 | Bacteria | 216994 |
| 234 | Ga0207686_10145931 | 3300025934 | Bacteria | 1641 |
| 235 | Ga0207686_10193864 | 3300025934 | Bacteria | 1450 |
| 236 | Ga0207670_10074259 | 3300025936 | Bacteria | 2360 |
| 237 | Ga0207670_10238103 | 3300025936 | Bacteria | 1401 |
| 238 | Ga0207669_10000115 | 3300025937 | Bacteria | 40041 |
| 239 | Ga0207704_10217259 | 3300025938 | Bacteria | 1412 |
| 240 | Ga0207704_10482154 | 3300025938 | Bacteria | 996 |
| 241 | Ga0207665_10016388 | 3300025939 | Bacteria | 4865 |
| 242 | Ga0207665_10108265 | 3300025939 | Bacteria | 1950 |
| 243 | Ga0207665_10454076 | 3300025939 | Bacteria | 984 |
| 244 | Ga0207691_10030597 | 3300025940 | Bacteria | 5029 |
| 245 | Ga0207691_10043696 | 3300025940 | Bacteria | 4128 |
| 246 | Ga0207711_10672081 | 3300025941 | Bacteria | 966 |
| 247 | Ga0207711_11703842 | 3300025941 | Bacteria | 574 |
| 248 | Ga0207689_10007492 | 3300025942 | Bacteria | 9567 |
| 249 | Ga0207661_10003140 | 3300025944 | Bacteria | 11451 |
| 250 | Ga0207661_10004159 | 3300025944 | Bacteria | 10122 |
| 251 | Ga0207661_10248459 | 3300025944 | Bacteria | 1580 |
| 252 | Ga0207679_10305716 | 3300025945 | Bacteria | 1372 |
| 253 | Ga0207667_10180179 | 3300025949 | Bacteria | 2170 |
| 254 | Ga0207667_10432576 | 3300025949 | Bacteria | 1338 |
| 255 | Ga0207651_10002681 | 3300025960 | Bacteria | 8520 |
| 256 | Ga0207651_10372894 | 3300025960 | Bacteria | 1208 |
| 257 | Ga0207712_10009056 | 3300025961 | Bacteria | 6298 |
| 258 | Ga0207712_10120849 | 3300025961 | Bacteria | 1982 |
| 259 | Ga0207712_10845599 | 3300025961 | Bacteria | 806 |
| 260 | Ga0207668_10002148 | 3300025972 | Bacteria | 11501 |
| 261 | Ga0207668_10073083 | 3300025972 | Bacteria | 2456 |
| 262 | Ga0207640_10197106 | 3300025981 | Bacteria | 1523 |
| 263 | Ga0207640_10266778 | 3300025981 | Bacteria | 1337 |
| 264 | Ga0207658_10004877 | 3300025986 | Bacteria | 9256 |
| 265 | Ga0207677_10000677 | 3300026023 | Bacteria | 20194 |
| 266 | Ga0207677_10712925 | 3300026023 | Bacteria | 891 |
| 267 | Ga0207703_10000128 | 3300026035 | Bacteria | 91359 |
| 268 | Ga0207703_10000237 | 3300026035 | Bacteria | 62874 |
| 269 | Ga0207703_11958240 | 3300026035 | Bacteria | 562 |
| 270 | Ga0207639_10031439 | 3300026041 | Bacteria | 3902 |
| 271 | Ga0207639_10109156 | 3300026041 | Bacteria | 2251 |
| 272 | Ga0207639_10539149 | 3300026041 | Bacteria | 1070 |
| 273 | Ga0207708_10078873 | 3300026075 | Bacteria | 2529 |
| 274 | Ga0207708_10249001 | 3300026075 | Bacteria | 1431 |
| 275 | Ga0207702_10004618 | 3300026078 | Bacteria | 12202 |
| 276 | Ga0207702_10353734 | 3300026078 | Bacteria | 1406 |
| 277 | Ga0207641_10203088 | 3300026088 | Bacteria | 1828 |
| 278 | Ga0207648_10088984 | 3300026089 | Bacteria | 2696 |
| 279 | Ga0207674_10031889 | 3300026116 | Bacteria | 5531 |
| 280 | Ga0207675_100036495 | 3300026118 | Bacteria | 4584 |
| 281 | Ga0207675_100473988 | 3300026118 | Bacteria | 1243 |
| 282 | Ga0207683_10004432 | 3300026121 | Bacteria | 12132 |
| 283 | Ga0207683_10004976 | 3300026121 | Bacteria | 11427 |
| 284 | Ga0207683_10065884 | 3300026121 | Bacteria | 3194 |
| 285 | Ga0207698_11366606 | 3300026142 | Bacteria | 723 |
| 286 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 287 | Ga0268266_10001882 | 3300028379 | Bacteria | 23710 |
| 288 | Ga0268266_10219916 | 3300028379 | Bacteria | 1745 |
| 289 | Ga0268265_10000938 | 3300028380 | Bacteria | 26823 |
| 290 | Ga0268265_10401582 | 3300028380 | Bacteria | 1267 |
| 291 | Ga0268264_10025968 | 3300028381 | Bacteria | 4782 |
| 292 | Ga0268264_12073480 | 3300028381 | Bacteria | 577 |
| 293 | Ga0265760_10022196 | 3300031090 | Bacteria | 1839 |
| 294 | Ga0307408_100937645 | 3300031548 | Bacteria | 794 |
| 295 | Ga0307405_10028881 | 3300031731 | Bacteria | 3235 |
| 296 | Ga0307413_10167488 | 3300031824 | Bacteria | 1551 |
| 297 | Ga0307407_10692652 | 3300031903 | Unclassified | 767 |
| 298 | Ga0307412_10300005 | 3300031911 | Bacteria | 1269 |
| 299 | Ga0307409_100032522 | 3300031995 | Bacteria | 3783 |
| 300 | Ga0307409_100907227 | 3300031995 | Unclassified | 895 |
| 301 | Ga0307416_100041116 | 3300032002 | Bacteria | 3598 |
| 302 | Ga0307415_100025731 | 3300032126 | Bacteria | 3699 |
| 303 | Ga0373948_0103450 | 3300034817 | Bacteria | 673 |
| 304 | Ga0373958_0137908 | 3300034819 | Bacteria | 602 |
| 305 | Ga0373928_0025906 | 3300035084 | Bacteria | 1268 |
| 306 | Ga0373929_0028315 | 3300035085 | Bacteria | 1183 |
| 307 | Ga0373940_0057740 | 3300035088 | Bacteria | 1103 |
| 308 | Ga0373951_0058398 | 3300035091 | Bacteria | 962 |
| 309 | Ga0373952_0110935 | 3300035092 | Bacteria | 734 |
| 310 | Ga0373939_0004303 | 3300035114 | Bacteria | 3363 |
| 311 | Ga0373941_0034735 | 3300035115 | Bacteria | 1523 |
| 312 | Ga0373953_0233731 | 3300035117 | Bacteria | 797 |
| 313 | Ga0373943_0408541 | 3300035170 | Bacteria | 785 |
| 314 | Ga0373943_0782931 | 3300035170 | Bacteria | 567 |
| 315 | Ga0373955_0117970 | 3300035172 | Bacteria | 1540 |
| 316 | Ga0373942_0024561 | 3300035207 | Bacteria | 1546 |
| 317 | Ga0373962_0118504 | 3300035242 | Bacteria | 842 |
| 318 | Ga0373924_0193683 | 3300035410 | Bacteria | 896 |
| 319 | Ga0373931_0229304 | 3300035691 | Bacteria | 1121 |
| 320 | Ga0373935_0874719 | 3300035692 | Bacteria | 665 |
| 321 | Ga0373933_0516184 | 3300035724 | Bacteria | 783 |
| 322 | Ga0373947_0676260 | 3300035725 | Bacteria | 704 |
| 323 | Ga0373937_0034652 | 3300036401 | Bacteria | 4592 |
| 324 | Ga0373937_1795637 | 3300036401 | Bacteria | 560 |
| 325 | Ga0395900_0366070 | 3300037418 | Bacteria | 1412 |
| 326 | Ga0395898_0593402 | 3300037466 | Bacteria | 1050 |
| 327 | Ga0395901_0133468 | 3300038443 | Bacteria | 2609 |
| 328 | Ga0395901_0812798 | 3300038443 | Bacteria | 923 |
| 329 | Ga0395901_1366750 | 3300038443 | Bacteria | 668 |
| 330 | Ga0439444_0057016 | 3300042437 | Bacteria | 807 |
| 331 | Ga0466970_0328114 | 3300044765 | Bacteria | 866 |
| 332 | Ga0466959_0478605 | 3300045049 | Bacteria | 843 |
| 333 | Ga0451576_0134326 | 3300045051 | Bacteria | 2580 |
| 334 | Ga0466967_0920682 | 3300045976 | Bacteria | 870 |
| 335 | Ga0495592_0171595 | 3300046454 | Bacteria | 1485 |
| 336 | Ga0495603_0357036 | 3300046455 | Bacteria | 838 |
| 337 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 338 | Ga0495651_0203395 | 3300046462 | Bacteria | 1384 |
| 339 | Ga0495653_0370261 | 3300046463 | Bacteria | 917 |
| 340 | Ga0495580_0427041 | 3300046472 | Bacteria | 891 |
| 341 | Ga0495582_0000013 | 3300046473 | Bacteria | 110372 |
| 342 | Ga0495639_0018984 | 3300046475 | Bacteria | 2998 |
| 343 | Ga0495664_0419395 | 3300046477 | Bacteria | 803 |
| 344 | Ga0495594_0357465 | 3300046499 | Bacteria | 832 |
| 345 | Ga0495608_0468584 | 3300046511 | Bacteria | 765 |
| 346 | Ga0495620_0000747 | 3300046515 | Bacteria | 19970 |
| 347 | Ga0495628_0607180 | 3300046516 | Bacteria | 781 |
| 348 | Ga0495644_0000499 | 3300046523 | Bacteria | 16748 |
| 349 | Ga0495663_0133473 | 3300046525 | Bacteria | 839 |
| 350 | Ga0495652_1016114 | 3300046529 | Bacteria | 542 |
| 351 | Ga0495665_0377097 | 3300046531 | Bacteria | 721 |
| 352 | Ga0495586_0000537 | 3300046535 | Bacteria | 22120 |
| 353 | Ga0495587_0011847 | 3300046536 | Bacteria | 5512 |
| 354 | Ga0495598_0004358 | 3300046537 | Bacteria | 3059 |
| 355 | Ga0495645_0054401 | 3300046543 | Bacteria | 2908 |
| 356 | Ga0495667_0095106 | 3300046559 | Bacteria | 1929 |
| 357 | Ga0495634_0001221 | 3300046642 | Bacteria | 23712 |
| 358 | Ga0495634_0208160 | 3300046642 | Bacteria | 1212 |
| 359 | Ga0495634_0238493 | 3300046642 | Bacteria | 1116 |
| 360 | Ga0495635_0453559 | 3300046663 | Bacteria | 847 |
| 361 | Ga0495588_0738052 | 3300046674 | Bacteria | 515 |
| 362 | Ga0495657_0305821 | 3300046675 | Bacteria | 947 |
| 363 | Ga0495599_0110646 | 3300046678 | Bacteria | 1711 |
| 364 | Ga0495623_0413748 | 3300046679 | Bacteria | 723 |
| 365 | Ga0495646_0636083 | 3300046680 | Bacteria | 540 |
| 366 | Ga0495647_0000046 | 3300046681 | Bacteria | 35269 |
| 367 | Ga0495647_0113957 | 3300046681 | Bacteria | 1131 |
| 368 | Ga0495658_0000009 | 3300046683 | Bacteria | 110421 |
| 369 | Ga0495669_0000083 | 3300046684 | Bacteria | 62876 |
| 370 | Ga0495624_0000307 | 3300046690 | Bacteria | 38620 |
| 371 | Ga0495670_0009994 | 3300046691 | Bacteria | 4666 |
| 372 | Ga0495649_0032859 | 3300046694 | Bacteria | 2857 |
| 373 | Ga0495589_0367898 | 3300046794 | Bacteria | 661 |
| 374 | Ga0495600_0283951 | 3300046809 | Bacteria | 1047 |
| 375 | Ga0495600_0759632 | 3300046809 | Bacteria | 580 |
| 376 | Ga0495660_0319120 | 3300046810 | Bacteria | 699 |
| 377 | Ga0495604_0047397 | 3300047317 | Bacteria | 3347 |
| 378 | Ga0495674_0253029 | 3300047319 | Bacteria | 1449 |
| 379 | Ga0495676_0001446 | 3300047321 | Bacteria | 20500 |
| 380 | Ga0495680_0000599 | 3300047322 | Bacteria | 40585 |
| 381 | Ga0495680_0282580 | 3300047322 | Bacteria | 1169 |
| 382 | Ga0495673_0089273 | 3300047469 | Bacteria | 1262 |
| 383 | Ga0495684_0074725 | 3300047471 | Bacteria | 2575 |
| 384 | Ga0495602_0020203 | 3300048088 | Bacteria | 6586 |
| 385 | Ga0496100_0000007 | 3300048903 | Bacteria | 261266 |
| 386 | Ga0496100_0215563 | 3300048903 | Bacteria | 1406 |
| 387 | Ga0496101_0000013 | 3300048904 | Bacteria | 261266 |
| 388 | Ga0496101_0643877 | 3300048904 | Bacteria | 837 |
| 389 | Ga0496102_0474200 | 3300048905 | Bacteria | 1172 |
| 390 | Ga0496103_0021372 | 3300048906 | Bacteria | 3892 |
| 391 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 392 | Ga0496104_0037090 | 3300048907 | Bacteria | 4558 |
| 393 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 394 | Ga0496105_0199255 | 3300048908 | Bacteria | 1634 |
| 395 | Ga0496106_0000006 | 3300048909 | Bacteria | 251855 |
| 396 | Ga0496106_0138115 | 3300048909 | Bacteria | 1916 |
| 397 | Ga0496106_0372489 | 3300048909 | Bacteria | 1147 |
| 398 | Ga0496106_0684485 | 3300048909 | Bacteria | 818 |
| 399 | Ga0496107_0000007 | 3300048910 | Bacteria | 257113 |
| 400 | Ga0496107_0150648 | 3300048910 | Bacteria | 1720 |
| 401 | Ga0496107_0667202 | 3300048910 | Bacteria | 766 |
| 402 | Ga0496108_0026177 | 3300048911 | Bacteria | 4811 |
| 403 | Ga0496108_0456966 | 3300048911 | Bacteria | 1115 |
| 404 | Ga0496109_0000248 | 3300048912 | Bacteria | 51780 |
| 405 | Ga0496109_1073106 | 3300048912 | Bacteria | 742 |
| 406 | Ga0496110_0010361 | 3300048913 | Bacteria | 7579 |
| 407 | Ga0496110_0131603 | 3300048913 | Bacteria | 2259 |
| 408 | Ga0496110_1201915 | 3300048913 | Bacteria | 667 |
| 409 | Ga0496111_0062304 | 3300048914 | Bacteria | 2704 |
| 410 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 411 | Ga0496112_0540391 | 3300048915 | Bacteria | 1099 |
| 412 | Ga0496113_0028160 | 3300048916 | Bacteria | 4038 |
| 413 | Ga0496113_0077235 | 3300048916 | Bacteria | 2545 |
| 414 | Ga0496114_0041577 | 3300048917 | Bacteria | 3810 |
| 415 | Ga0496114_0116555 | 3300048917 | Bacteria | 2293 |
| 416 | Ga0496126_1022389 | 3300048929 | Bacteria | 619 |
| 417 | Ga0501042_0117175 | 3300049578 | Bacteria | 1918 |
| 418 | Ga0501042_0266646 | 3300049578 | Bacteria | 1236 |
| 419 | Ga0501042_0670176 | 3300049578 | Bacteria | 754 |
| 420 | Ga0501070_0156839 | 3300049586 | Bacteria | 1877 |
| 421 | Ga0501072_0049010 | 3300049588 | Bacteria | 3325 |
| 422 | Ga0501076_1674091 | 3300049592 | Bacteria | 522 |
| 423 | Ga0501079_1394823 | 3300049741 | Bacteria | 551 |
| 424 | Ga0501081_0254146 | 3300049743 | Bacteria | 1283 |
| 425 | Ga0501045_1365460 | 3300049824 | Bacteria | 515 |
| 426 | nmdc:mga05p37_457175_c1 | 3300050507 | Bacteria | 1123 |
| 427 | nmdc:mga08y16_911817_c1 | 3300050511 | Bacteria | 864 |
| 428 | nmdc:mga08x19_668668_c1 | 3300050514 | Bacteria | 737 |
| 429 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 430 | nmdc:mga0a205_762162_c1 | 3300050515 | Bacteria | 816 |
| 431 | Ga0495601_0000581 | 3300053077 | Bacteria | 19434 |
| 432 | Ga0495612_0001629 | 3300053078 | Bacteria | 9237 |
| 433 | Ga0495619_0002122 | 3300053085 | Bacteria | 13142 |
| 434 | Ga0500614_022982 | 3300053123 | Bacteria | 1461 |
| 435 | Ga0500573_0076612 | 3300053140 | Bacteria | 1904 |
| 436 | Ga0500577_0001913 | 3300053142 | Bacteria | 5338 |
| 437 | Ga0500577_0174288 | 3300053142 | Bacteria | 921 |
| 438 | Ga0501084_1111040 | 3300054114 | Bacteria | 664 |
| 439 | Ga0501082_0230736 | 3300060353 | Bacteria | 1611 |
| 440 | Ga0530510_0056768 | 3300061734 | Bacteria | 2829 |
| 441 | Ga0530510_0098628 | 3300061734 | Bacteria | 2136 |
| 442 | Ga0530510_0672181 | 3300061734 | Bacteria | 789 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053142 | Ga0500577_0174288 | Ga0500577_0174288_144_521 | 108 |
| 2 | 3300005435 | Ga0070714_100084621 | Ga0070714_1000846213 | 120 |
| 3 | 3300005436 | Ga0070713_101127541 | Ga0070713_1011275412 | 120 |
| 4 | 3300005937 | Ga0081455_10333705 | Ga0081455_103337052 | 121 |
| 5 | 3300031548 | Ga0307408_100937645 | Ga0307408_1009376452 | 122 |
| 6 | 3300031731 | Ga0307405_10028881 | Ga0307405_100288814 | 122 |
| 7 | 3300031911 | Ga0307412_10300005 | Ga0307412_103000052 | 122 |
| 8 | 3300031995 | Ga0307409_100032522 | Ga0307409_1000325222 | 122 |
| 9 | 3300032002 | Ga0307416_100041116 | Ga0307416_1000411162 | 122 |
| 10 | 3300032126 | Ga0307415_100025731 | Ga0307415_1000257314 | 122 |
| 11 | 3300042437 | Ga0439444_0057016 | Ga0439444_0057016_15_383 | 122 |
| 12 | 3300005329 | Ga0070683_100035577 | Ga0070683_1000355772 | 123 |
| 13 | 3300005331 | Ga0070670_100648624 | Ga0070670_1006486242 | 123 |
| 14 | 3300005334 | Ga0068869_100035411 | Ga0068869_1000354114 | 123 |
| 15 | 3300005335 | Ga0070666_10229780 | Ga0070666_102297801 | 123 |
| 16 | 3300005336 | Ga0070680_100734715 | Ga0070680_1007347151 | 123 |
| 17 | 3300005337 | Ga0070682_100037652 | Ga0070682_1000376524 | 123 |
| 18 | 3300005340 | Ga0070689_100302104 | Ga0070689_1003021041 | 123 |
| 19 | 3300005341 | Ga0070691_10031087 | Ga0070691_100310872 | 123 |
| 20 | 3300005344 | Ga0070661_100103860 | Ga0070661_1001038602 | 123 |
| 21 | 3300005354 | Ga0070675_100537574 | Ga0070675_1005375742 | 123 |
| 22 | 3300005355 | Ga0070671_100316517 | Ga0070671_1003165171 | 123 |
| 23 | 3300005364 | Ga0070673_100258040 | Ga0070673_1002580402 | 123 |
| 24 | 3300005365 | Ga0070688_100510961 | Ga0070688_1005109611 | 123 |
| 25 | 3300005367 | Ga0070667_100519580 | Ga0070667_1005195801 | 123 |
| 26 | 3300005406 | Ga0070703_10100680 | Ga0070703_101006802 | 123 |
| 27 | 3300005435 | Ga0070714_100006378 | Ga0070714_1000063782 | 123 |
| 28 | 3300005436 | Ga0070713_100219723 | Ga0070713_1002197232 | 123 |
| 29 | 3300005436 | Ga0070713_100585599 | Ga0070713_1005855992 | 123 |
| 30 | 3300005437 | Ga0070710_10031426 | Ga0070710_100314264 | 123 |
| 31 | 3300005437 | Ga0070710_10036661 | Ga0070710_100366613 | 123 |
| 32 | 3300005437 | Ga0070710_10463120 | Ga0070710_104631202 | 123 |
| 33 | 3300005439 | Ga0070711_100009684 | Ga0070711_1000096846 | 123 |
| 34 | 3300005439 | Ga0070711_100077921 | Ga0070711_1000779213 | 123 |
| 35 | 3300005439 | Ga0070711_100359320 | Ga0070711_1003593202 | 123 |
| 36 | 3300005439 | Ga0070711_100405463 | Ga0070711_1004054632 | 123 |
| 37 | 3300005439 | Ga0070711_101702086 | Ga0070711_1017020861 | 123 |
| 38 | 3300005440 | Ga0070705_100028799 | Ga0070705_1000287992 | 123 |
| 39 | 3300005444 | Ga0070694_100070536 | Ga0070694_1000705361 | 123 |
| 40 | 3300005445 | Ga0070708_101052325 | Ga0070708_1010523251 | 123 |
| 41 | 3300005455 | Ga0070663_100022299 | Ga0070663_1000222994 | 123 |
| 42 | 3300005456 | Ga0070678_100102271 | Ga0070678_1001022713 | 123 |
| 43 | 3300005457 | Ga0070662_100498273 | Ga0070662_1004982731 | 123 |
| 44 | 3300005458 | Ga0070681_10226916 | Ga0070681_102269163 | 123 |
| 45 | 3300005466 | Ga0070685_10011144 | Ga0070685_100111442 | 123 |
| 46 | 3300005467 | Ga0070706_100077044 | Ga0070706_1000770444 | 123 |
| 47 | 3300005467 | Ga0070706_101150135 | Ga0070706_1011501352 | 123 |
| 48 | 3300005468 | Ga0070707_100951701 | Ga0070707_1009517011 | 123 |
| 49 | 3300005518 | Ga0070699_100918770 | Ga0070699_1009187701 | 123 |
| 50 | 3300005530 | Ga0070679_100190776 | Ga0070679_1001907762 | 123 |
| 51 | 3300005535 | Ga0070684_100361174 | Ga0070684_1003611742 | 123 |
| 52 | 3300005536 | Ga0070697_101096504 | Ga0070697_1010965041 | 123 |
| 53 | 3300005539 | Ga0068853_100609040 | Ga0068853_1006090402 | 123 |
| 54 | 3300005543 | Ga0070672_100242672 | Ga0070672_1002426722 | 123 |
| 55 | 3300005545 | Ga0070695_100291686 | Ga0070695_1002916861 | 123 |
| 56 | 3300005546 | Ga0070696_100338892 | Ga0070696_1003388921 | 123 |
| 57 | 3300005548 | Ga0070665_100818201 | Ga0070665_1008182011 | 123 |
| 58 | 3300005564 | Ga0070664_100178909 | Ga0070664_1001789094 | 123 |
| 59 | 3300005577 | Ga0068857_100449435 | Ga0068857_1004494352 | 123 |
| 60 | 3300005616 | Ga0068852_100288460 | Ga0068852_1002884601 | 123 |
| 61 | 3300005617 | Ga0068859_102542277 | Ga0068859_1025422772 | 123 |
| 62 | 3300005618 | Ga0068864_100066951 | Ga0068864_1000669512 | 123 |
| 63 | 3300005719 | Ga0068861_100714156 | Ga0068861_1007141562 | 123 |
| 64 | 3300005834 | Ga0068851_10421200 | Ga0068851_104212002 | 123 |
| 65 | 3300005840 | Ga0068870_10450577 | Ga0068870_104505771 | 123 |
| 66 | 3300005841 | Ga0068863_100362351 | Ga0068863_1003623512 | 123 |
| 67 | 3300005842 | Ga0068858_100477195 | Ga0068858_1004771951 | 123 |
| 68 | 3300005843 | Ga0068860_100164413 | Ga0068860_1001644133 | 123 |
| 69 | 3300005844 | Ga0068862_100898506 | Ga0068862_1008985062 | 123 |
| 70 | 3300005983 | Ga0081540_1000356 | Ga0081540_100035636 | 123 |
| 71 | 3300005985 | Ga0081539_10028694 | Ga0081539_100286947 | 123 |
| 72 | 3300006028 | Ga0070717_10058960 | Ga0070717_100589604 | 123 |
| 73 | 3300006028 | Ga0070717_11509271 | Ga0070717_115092711 | 123 |
| 74 | 3300006163 | Ga0070715_10035997 | Ga0070715_100359973 | 123 |
| 75 | 3300006173 | Ga0070716_100052239 | Ga0070716_1000522392 | 123 |
| 76 | 3300006173 | Ga0070716_100079824 | Ga0070716_1000798242 | 123 |
| 77 | 3300006173 | Ga0070716_100337748 | Ga0070716_1003377481 | 123 |
| 78 | 3300006175 | Ga0070712_100071782 | Ga0070712_1000717823 | 123 |
| 79 | 3300006175 | Ga0070712_100082256 | Ga0070712_1000822562 | 123 |
| 80 | 3300006175 | Ga0070712_100105228 | Ga0070712_1001052282 | 123 |
| 81 | 3300006175 | Ga0070712_100230376 | Ga0070712_1002303761 | 123 |
| 82 | 3300006237 | Ga0097621_101783773 | Ga0097621_1017837731 | 123 |
| 83 | 3300006358 | Ga0068871_100290108 | Ga0068871_1002901082 | 123 |
| 84 | 3300006871 | Ga0075434_101100388 | Ga0075434_1011003882 | 123 |
| 85 | 3300006880 | Ga0075429_101107960 | Ga0075429_1011079601 | 123 |
| 86 | 3300006881 | Ga0068865_100469222 | Ga0068865_1004692222 | 123 |
| 87 | 3300006931 | Ga0097620_102542218 | Ga0097620_1025422182 | 123 |
| 88 | 3300007076 | Ga0075435_100978295 | Ga0075435_1009782952 | 123 |
| 89 | 3300009011 | Ga0105251_10048426 | Ga0105251_100484263 | 123 |
| 90 | 3300009098 | Ga0105245_10303354 | Ga0105245_103033541 | 123 |
| 91 | 3300009098 | Ga0105245_11667752 | Ga0105245_116677521 | 123 |
| 92 | 3300009101 | Ga0105247_10062743 | Ga0105247_100627432 | 123 |
| 93 | 3300009148 | Ga0105243_10070154 | Ga0105243_100701542 | 123 |
| 94 | 3300009174 | Ga0105241_10096385 | Ga0105241_100963853 | 123 |
| 95 | 3300009176 | Ga0105242_10125075 | Ga0105242_101250752 | 123 |
| 96 | 3300009177 | Ga0105248_10489930 | Ga0105248_104899302 | 123 |
| 97 | 3300009545 | Ga0105237_10807746 | Ga0105237_108077462 | 123 |
| 98 | 3300009553 | Ga0105249_11112478 | Ga0105249_111124781 | 123 |
| 99 | 3300010159 | Ga0099796_10250690 | Ga0099796_102506901 | 123 |
| 100 | 3300010375 | Ga0105239_10530362 | Ga0105239_105303621 | 123 |
| 101 | 3300011119 | Ga0105246_10064265 | Ga0105246_100642652 | 123 |
| 102 | 3300012498 | Ga0157345_1003021 | Ga0157345_10030212 | 123 |
| 103 | 3300012500 | Ga0157314_1036047 | Ga0157314_10360471 | 123 |
| 104 | 3300012507 | Ga0157342_1007423 | Ga0157342_10074231 | 123 |
| 105 | 3300012508 | Ga0157315_1073212 | Ga0157315_10732121 | 123 |
| 106 | 3300013104 | Ga0157370_10156968 | Ga0157370_101569682 | 123 |
| 107 | 3300013104 | Ga0157370_11757674 | Ga0157370_117576741 | 123 |
| 108 | 3300013296 | Ga0157374_10815645 | Ga0157374_108156451 | 123 |
| 109 | 3300013297 | Ga0157378_10085791 | Ga0157378_100857911 | 123 |
| 110 | 3300013307 | Ga0157372_10856363 | Ga0157372_108563631 | 123 |
| 111 | 3300013308 | Ga0157375_10050868 | Ga0157375_100508685 | 123 |
| 112 | 3300014325 | Ga0163163_10904037 | Ga0163163_109040371 | 123 |
| 113 | 3300014497 | Ga0182008_10135672 | Ga0182008_101356723 | 123 |
| 114 | 3300014745 | Ga0157377_10053980 | Ga0157377_100539803 | 123 |
| 115 | 3300014968 | Ga0157379_11949186 | Ga0157379_119491861 | 123 |
| 116 | 3300020070 | Ga0206356_11773816 | Ga0206356_117738161 | 123 |
| 117 | 3300020081 | Ga0206354_10187246 | Ga0206354_101872462 | 123 |
| 118 | 3300020082 | Ga0206353_10074122 | Ga0206353_100741222 | 123 |
| 119 | 3300022467 | Ga0224712_10364733 | Ga0224712_103647332 | 123 |
| 120 | 3300025898 | Ga0207692_10024713 | Ga0207692_100247134 | 123 |
| 121 | 3300025898 | Ga0207692_10075156 | Ga0207692_100751561 | 123 |
| 122 | 3300025898 | Ga0207692_10098347 | Ga0207692_100983471 | 123 |
| 123 | 3300025898 | Ga0207692_10105930 | Ga0207692_101059302 | 123 |
| 124 | 3300025899 | Ga0207642_10655166 | Ga0207642_106551661 | 123 |
| 125 | 3300025901 | Ga0207688_10012267 | Ga0207688_100122672 | 123 |
| 126 | 3300025904 | Ga0207647_10118273 | Ga0207647_101182733 | 123 |
| 127 | 3300025906 | Ga0207699_10042349 | Ga0207699_100423492 | 123 |
| 128 | 3300025906 | Ga0207699_10253904 | Ga0207699_102539042 | 123 |
| 129 | 3300025906 | Ga0207699_10266750 | Ga0207699_102667502 | 123 |
| 130 | 3300025908 | Ga0207643_10460312 | Ga0207643_104603122 | 123 |
| 131 | 3300025909 | Ga0207705_11161348 | Ga0207705_111613481 | 123 |
| 132 | 3300025911 | Ga0207654_10079431 | Ga0207654_100794312 | 123 |
| 133 | 3300025912 | Ga0207707_10428513 | Ga0207707_104285132 | 123 |
| 134 | 3300025914 | Ga0207671_10153377 | Ga0207671_101533773 | 123 |
| 135 | 3300025915 | Ga0207693_10021840 | Ga0207693_100218405 | 123 |
| 136 | 3300025915 | Ga0207693_10118221 | Ga0207693_101182212 | 123 |
| 137 | 3300025916 | Ga0207663_10063605 | Ga0207663_100636053 | 123 |
| 138 | 3300025916 | Ga0207663_10066291 | Ga0207663_100662913 | 123 |
| 139 | 3300025918 | Ga0207662_10024546 | Ga0207662_100245466 | 123 |
| 140 | 3300025919 | Ga0207657_10024135 | Ga0207657_100241351 | 123 |
| 141 | 3300025920 | Ga0207649_10210597 | Ga0207649_102105971 | 123 |
| 142 | 3300025925 | Ga0207650_10940583 | Ga0207650_109405831 | 123 |
| 143 | 3300025926 | Ga0207659_10038303 | Ga0207659_100383034 | 123 |
| 144 | 3300025927 | Ga0207687_10677800 | Ga0207687_106778002 | 123 |
| 145 | 3300025928 | Ga0207700_10060908 | Ga0207700_100609083 | 123 |
| 146 | 3300025928 | Ga0207700_10278015 | Ga0207700_102780151 | 123 |
| 147 | 3300025928 | Ga0207700_11093500 | Ga0207700_110935001 | 123 |
| 148 | 3300025929 | Ga0207664_10012445 | Ga0207664_100124452 | 123 |
| 149 | 3300025929 | Ga0207664_10067022 | Ga0207664_100670222 | 123 |
| 150 | 3300025929 | Ga0207664_10408873 | Ga0207664_104088733 | 123 |
| 151 | 3300025934 | Ga0207686_10193864 | Ga0207686_101938643 | 123 |
| 152 | 3300025936 | Ga0207670_10074259 | Ga0207670_100742593 | 123 |
| 153 | 3300025938 | Ga0207704_10217259 | Ga0207704_102172591 | 123 |
| 154 | 3300025939 | Ga0207665_10016388 | Ga0207665_100163884 | 123 |
| 155 | 3300025939 | Ga0207665_10108265 | Ga0207665_101082652 | 123 |
| 156 | 3300025939 | Ga0207665_10454076 | Ga0207665_104540762 | 123 |
| 157 | 3300025940 | Ga0207691_10030597 | Ga0207691_100305972 | 123 |
| 158 | 3300025941 | Ga0207711_10672081 | Ga0207711_106720811 | 123 |
| 159 | 3300025942 | Ga0207689_10007492 | Ga0207689_100074925 | 123 |
| 160 | 3300025945 | Ga0207679_10305716 | Ga0207679_103057162 | 123 |
| 161 | 3300025949 | Ga0207667_10432576 | Ga0207667_104325762 | 123 |
| 162 | 3300025960 | Ga0207651_10372894 | Ga0207651_103728942 | 123 |
| 163 | 3300025961 | Ga0207712_10120849 | Ga0207712_101208492 | 123 |
| 164 | 3300025981 | Ga0207640_10266778 | Ga0207640_102667782 | 123 |
| 165 | 3300026023 | Ga0207677_10712925 | Ga0207677_107129251 | 123 |
| 166 | 3300026035 | Ga0207703_11958240 | Ga0207703_119582401 | 123 |
| 167 | 3300026041 | Ga0207639_10539149 | Ga0207639_105391491 | 123 |
| 168 | 3300026075 | Ga0207708_10078873 | Ga0207708_100788732 | 123 |
| 169 | 3300026078 | Ga0207702_10353734 | Ga0207702_103537342 | 123 |
| 170 | 3300026088 | Ga0207641_10203088 | Ga0207641_102030882 | 123 |
| 171 | 3300026116 | Ga0207674_10031889 | Ga0207674_100318897 | 123 |
| 172 | 3300026118 | Ga0207675_100036495 | Ga0207675_1000364951 | 123 |
| 173 | 3300026121 | Ga0207683_10004432 | Ga0207683_100044327 | 123 |
| 174 | 3300026142 | Ga0207698_11366606 | Ga0207698_113666062 | 123 |
| 175 | 3300028379 | Ga0268266_10219916 | Ga0268266_102199162 | 123 |
| 176 | 3300028380 | Ga0268265_10401582 | Ga0268265_104015822 | 123 |
| 177 | 3300031090 | Ga0265760_10022196 | Ga0265760_100221963 | 123 |
| 178 | 3300031824 | Ga0307413_10167488 | Ga0307413_101674881 | 123 |
| 179 | 3300031903 | Ga0307407_10692652 | Ga0307407_106926522 | 123 |
| 180 | 3300031995 | Ga0307409_100907227 | Ga0307409_1009072272 | 123 |
| 181 | 3300034817 | Ga0373948_0103450 | Ga0373948_0103450_67_438 | 123 |
| 182 | 3300034819 | Ga0373958_0137908 | Ga0373958_0137908_113_484 | 123 |
| 183 | 3300035084 | Ga0373928_0025906 | Ga0373928_0025906_679_1050 | 123 |
| 184 | 3300035085 | Ga0373929_0028315 | Ga0373929_0028315_283_654 | 123 |
| 185 | 3300035088 | Ga0373940_0057740 | Ga0373940_0057740_659_1030 | 123 |
| 186 | 3300035091 | Ga0373951_0058398 | Ga0373951_0058398_315_686 | 123 |
| 187 | 3300035092 | Ga0373952_0110935 | Ga0373952_0110935_120_491 | 123 |
| 188 | 3300035114 | Ga0373939_0004303 | Ga0373939_0004303_1656_2027 | 123 |
| 189 | 3300035115 | Ga0373941_0034735 | Ga0373941_0034735_1086_1457 | 123 |
| 190 | 3300035170 | Ga0373943_0408541 | Ga0373943_0408541_88_459 | 123 |
| 191 | 3300035207 | Ga0373942_0024561 | Ga0373942_0024561_997_1368 | 123 |
| 192 | 3300035242 | Ga0373962_0118504 | Ga0373962_0118504_274_645 | 123 |
| 193 | 3300035410 | Ga0373924_0193683 | Ga0373924_0193683_161_532 | 123 |
| 194 | 3300035691 | Ga0373931_0229304 | Ga0373931_0229304_460_831 | 123 |
| 195 | 3300035692 | Ga0373935_0874719 | Ga0373935_0874719_272_643 | 123 |
| 196 | 3300035724 | Ga0373933_0516184 | Ga0373933_0516184_88_459 | 123 |
| 197 | 3300035725 | Ga0373947_0676260 | Ga0373947_0676260_43_414 | 123 |
| 198 | 3300036401 | Ga0373937_1795637 | Ga0373937_1795637_53_424 | 123 |
| 199 | 3300044765 | Ga0466970_0328114 | Ga0466970_0328114_334_723 | 123 |
| 200 | 3300045049 | Ga0466959_0478605 | Ga0466959_0478605_329_700 | 123 |
| 201 | 3300045976 | Ga0466967_0920682 | Ga0466967_0920682_349_720 | 123 |
| 202 | 3300046455 | Ga0495603_0357036 | Ga0495603_0357036_306_677 | 123 |
| 203 | 3300046462 | Ga0495651_0203395 | Ga0495651_0203395_822_1193 | 123 |
| 204 | 3300046463 | Ga0495653_0370261 | Ga0495653_0370261_11_382 | 123 |
| 205 | 3300046472 | Ga0495580_0427041 | Ga0495580_0427041_42_413 | 123 |
| 206 | 3300046477 | Ga0495664_0419395 | Ga0495664_0419395_183_554 | 123 |
| 207 | 3300046499 | Ga0495594_0357465 | Ga0495594_0357465_161_532 | 123 |
| 208 | 3300046511 | Ga0495608_0468584 | Ga0495608_0468584_44_415 | 123 |
| 209 | 3300046516 | Ga0495628_0607180 | Ga0495628_0607180_243_614 | 123 |
| 210 | 3300046529 | Ga0495652_1016114 | Ga0495652_1016114_70_441 | 123 |
| 211 | 3300046531 | Ga0495665_0377097 | Ga0495665_0377097_66_437 | 123 |
| 212 | 3300046559 | Ga0495667_0095106 | Ga0495667_0095106_513_884 | 123 |
| 213 | 3300046663 | Ga0495635_0453559 | Ga0495635_0453559_129_500 | 123 |
| 214 | 3300046674 | Ga0495588_0738052 | Ga0495588_0738052_106_477 | 123 |
| 215 | 3300046675 | Ga0495657_0305821 | Ga0495657_0305821_488_859 | 123 |
| 216 | 3300046680 | Ga0495646_0636083 | Ga0495646_0636083_27_398 | 123 |
| 217 | 3300046809 | Ga0495600_0283951 | Ga0495600_0283951_339_710 | 123 |
| 218 | 3300047319 | Ga0495674_0253029 | Ga0495674_0253029_736_1107 | 123 |
| 219 | 3300047322 | Ga0495680_0282580 | Ga0495680_0282580_479_850 | 123 |
| 220 | 3300047471 | Ga0495684_0074725 | Ga0495684_0074725_1119_1490 | 123 |
| 221 | 3300048903 | Ga0496100_0215563 | Ga0496100_0215563_753_1124 | 123 |
| 222 | 3300048904 | Ga0496101_0643877 | Ga0496101_0643877_172_543 | 123 |
| 223 | 3300048905 | Ga0496102_0474200 | Ga0496102_0474200_52_423 | 123 |
| 224 | 3300048906 | Ga0496103_0021372 | Ga0496103_0021372_2437_2808 | 123 |
| 225 | 3300048907 | Ga0496104_0037090 | Ga0496104_0037090_4026_4397 | 123 |
| 226 | 3300048908 | Ga0496105_0199255 | Ga0496105_0199255_179_550 | 123 |
| 227 | 3300048909 | Ga0496106_0372489 | Ga0496106_0372489_728_1099 | 123 |
| 228 | 3300048910 | Ga0496107_0150648 | Ga0496107_0150648_1154_1525 | 123 |
| 229 | 3300048911 | Ga0496108_0456966 | Ga0496108_0456966_575_946 | 123 |
| 230 | 3300048912 | Ga0496109_1073106 | Ga0496109_1073106_81_452 | 123 |
| 231 | 3300048913 | Ga0496110_0131603 | Ga0496110_0131603_707_1078 | 123 |
| 232 | 3300048914 | Ga0496111_0062304 | Ga0496111_0062304_820_1191 | 123 |
| 233 | 3300048915 | Ga0496112_0540391 | Ga0496112_0540391_463_834 | 123 |
| 234 | 3300048916 | Ga0496113_0077235 | Ga0496113_0077235_1712_2083 | 123 |
| 235 | 3300048917 | Ga0496114_0041577 | Ga0496114_0041577_3268_3639 | 123 |
| 236 | 3300048929 | Ga0496126_1022389 | Ga0496126_1022389_225_596 | 123 |
| 237 | 3300050514 | nmdc:mga08x19_668668_c1 | nmdc:mga08x19_668668_c1_94_465 | 123 |
| 238 | 3300050515 | nmdc:mga0a205_762162_c1 | nmdc:mga0a205_762162_c1_169_540 | 123 |
| 239 | 3300053140 | Ga0500573_0076612 | Ga0500573_0076612_598_975 | 123 |
| 240 | 3300053142 | Ga0500577_0001913 | Ga0500577_0001913_721_1098 | 123 |
| 241 | 3300061734 | Ga0530510_0056768 | Ga0530510_0056768_2222_2593 | 123 |
| 242 | 3300061734 | Ga0530510_0098628 | Ga0530510_0098628_790_1167 | 123 |
| 243 | 3300005535 | Ga0070684_100097591 | Ga0070684_1000975913 | 124 |
| 244 | 3300006844 | Ga0075428_102379117 | Ga0075428_1023791171 | 124 |
| 245 | 3300006852 | Ga0075433_10845704 | Ga0075433_108457042 | 124 |
| 246 | 3300009147 | Ga0114129_10688098 | Ga0114129_106880982 | 124 |
| 247 | 3300046525 | Ga0495663_0133473 | Ga0495663_0133473_286_669 | 124 |
| 248 | 3300046794 | Ga0495589_0367898 | Ga0495589_0367898_196_579 | 124 |
| 249 | 3300046810 | Ga0495660_0319120 | Ga0495660_0319120_120_503 | 124 |
| 250 | 3300049578 | Ga0501042_0670176 | Ga0501042_0670176_340_714 | 124 |
| 251 | 3300049743 | Ga0501081_0254146 | Ga0501081_0254146_61_435 | 124 |
| 252 | 3300050507 | nmdc:mga05p37_457175_c1 | nmdc:mga05p37_457175_c1_455_838 | 124 |
| 253 | 3300050511 | nmdc:mga08y16_911817_c1 | nmdc:mga08y16_911817_c1_200_583 | 124 |
| 254 | 3300061734 | Ga0530510_0672181 | Ga0530510_0672181_262_636 | 124 |
| 255 | 3300005329 | Ga0070683_100265673 | Ga0070683_1002656732 | 125 |
| 256 | 3300005335 | Ga0070666_10013002 | Ga0070666_100130026 | 125 |
| 257 | 3300005344 | Ga0070661_100000116 | Ga0070661_10000011630 | 125 |
| 258 | 3300005347 | Ga0070668_100088271 | Ga0070668_1000882713 | 125 |
| 259 | 3300005365 | Ga0070688_100000066 | Ga0070688_10000006612 | 125 |
| 260 | 3300005466 | Ga0070685_10000955 | Ga0070685_1000095512 | 125 |
| 261 | 3300005535 | Ga0070684_100024975 | Ga0070684_1000249755 | 125 |
| 262 | 3300005548 | Ga0070665_100000846 | Ga0070665_10000084642 | 125 |
| 263 | 3300005981 | Ga0081538_10000161 | Ga0081538_100001617 | 125 |
| 264 | 3300014969 | Ga0157376_10242278 | Ga0157376_102422783 | 125 |
| 265 | 3300025903 | Ga0207680_10021869 | Ga0207680_100218691 | 125 |
| 266 | 3300025920 | Ga0207649_10000005 | Ga0207649_10000005119 | 125 |
| 267 | 3300025944 | Ga0207661_10248459 | Ga0207661_102484592 | 125 |
| 268 | 3300025972 | Ga0207668_10073083 | Ga0207668_100730833 | 125 |
| 269 | 3300028379 | Ga0268266_10001882 | Ga0268266_1000188223 | 125 |
| 270 | 3300038443 | Ga0395901_0812798 | Ga0395901_0812798_462_851 | 125 |
| 271 | 3300005329 | Ga0070683_100017829 | Ga0070683_1000178297 | 126 |
| 272 | 3300005353 | Ga0070669_100083917 | Ga0070669_1000839172 | 126 |
| 273 | 3300005356 | Ga0070674_100000103 | Ga0070674_10000010321 | 126 |
| 274 | 3300005364 | Ga0070673_100004922 | Ga0070673_1000049222 | 126 |
| 275 | 3300005456 | Ga0070678_100001532 | Ga0070678_10000153211 | 126 |
| 276 | 3300005456 | Ga0070678_100036225 | Ga0070678_1000362252 | 126 |
| 277 | 3300005459 | Ga0068867_100349587 | Ga0068867_1003495871 | 126 |
| 278 | 3300005535 | Ga0070684_100017747 | Ga0070684_1000177474 | 126 |
| 279 | 3300005535 | Ga0070684_100031509 | Ga0070684_1000315094 | 126 |
| 280 | 3300005543 | Ga0070672_100008239 | Ga0070672_1000082393 | 126 |
| 281 | 3300005563 | Ga0068855_100540796 | Ga0068855_1005407962 | 126 |
| 282 | 3300005718 | Ga0068866_10000014 | Ga0068866_1000001459 | 126 |
| 283 | 3300005843 | Ga0068860_100020985 | Ga0068860_1000209857 | 126 |
| 284 | 3300005937 | Ga0081455_10377741 | Ga0081455_103777412 | 126 |
| 285 | 3300006038 | Ga0075365_10376712 | Ga0075365_103767122 | 126 |
| 286 | 3300006163 | Ga0070715_10000011 | Ga0070715_1000001160 | 126 |
| 287 | 3300006175 | Ga0070712_100000339 | Ga0070712_10000033917 | 126 |
| 288 | 3300012507 | Ga0157342_1024673 | Ga0157342_10246732 | 126 |
| 289 | 3300013296 | Ga0157374_10019367 | Ga0157374_100193676 | 126 |
| 290 | 3300013297 | Ga0157378_10042780 | Ga0157378_100427802 | 126 |
| 291 | 3300013297 | Ga0157378_10696432 | Ga0157378_106964321 | 126 |
| 292 | 3300013308 | Ga0157375_10030821 | Ga0157375_100308213 | 126 |
| 293 | 3300014326 | Ga0157380_10380563 | Ga0157380_103805631 | 126 |
| 294 | 3300014968 | Ga0157379_10235748 | Ga0157379_102357482 | 126 |
| 295 | 3300017792 | Ga0163161_11052038 | Ga0163161_110520382 | 126 |
| 296 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001739 | 126 |
| 297 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001127 | 126 |
| 298 | 3300025915 | Ga0207693_10002524 | Ga0207693_1000252414 | 126 |
| 299 | 3300025923 | Ga0207681_10230643 | Ga0207681_102306432 | 126 |
| 300 | 3300025937 | Ga0207669_10000115 | Ga0207669_1000011521 | 126 |
| 301 | 3300025940 | Ga0207691_10043696 | Ga0207691_100436963 | 126 |
| 302 | 3300025941 | Ga0207711_11703842 | Ga0207711_117038422 | 126 |
| 303 | 3300025944 | Ga0207661_10003140 | Ga0207661_1000314012 | 126 |
| 304 | 3300025944 | Ga0207661_10004159 | Ga0207661_100041596 | 126 |
| 305 | 3300025960 | Ga0207651_10002681 | Ga0207651_1000268110 | 126 |
| 306 | 3300026035 | Ga0207703_10000237 | Ga0207703_1000023759 | 126 |
| 307 | 3300026089 | Ga0207648_10088984 | Ga0207648_100889844 | 126 |
| 308 | 3300026121 | Ga0207683_10004976 | Ga0207683_1000497613 | 126 |
| 309 | 3300026121 | Ga0207683_10065884 | Ga0207683_100658842 | 126 |
| 310 | 3300028381 | Ga0268264_10025968 | Ga0268264_100259684 | 126 |
| 311 | 3300037418 | Ga0395900_0366070 | Ga0395900_0366070_112_492 | 126 |
| 312 | 3300037466 | Ga0395898_0593402 | Ga0395898_0593402_541_921 | 126 |
| 313 | 3300038443 | Ga0395901_0133468 | Ga0395901_0133468_866_1246 | 126 |
| 314 | 3300038443 | Ga0395901_1366750 | Ga0395901_1366750_205_585 | 126 |
| 315 | 3300045051 | Ga0451576_0134326 | Ga0451576_0134326_614_994 | 126 |
| 316 | 3300046473 | Ga0495582_0000013 | Ga0495582_0000013_10916_11296 | 126 |
| 317 | 3300046475 | Ga0495639_0018984 | Ga0495639_0018984_2254_2634 | 126 |
| 318 | 3300046642 | Ga0495634_0001221 | Ga0495634_0001221_7694_8074 | 126 |
| 319 | 3300046642 | Ga0495634_0208160 | Ga0495634_0208160_614_994 | 126 |
| 320 | 3300046681 | Ga0495647_0000046 | Ga0495647_0000046_15264_15644 | 126 |
| 321 | 3300046683 | Ga0495658_0000009 | Ga0495658_0000009_99086_99466 | 126 |
| 322 | 3300046691 | Ga0495670_0009994 | Ga0495670_0009994_3689_4069 | 126 |
| 323 | 3300046809 | Ga0495600_0759632 | Ga0495600_0759632_133_513 | 126 |
| 324 | 3300047469 | Ga0495673_0089273 | Ga0495673_0089273_130_510 | 126 |
| 325 | 3300048088 | Ga0495602_0020203 | Ga0495602_0020203_5374_5754 | 126 |
| 326 | 3300048909 | Ga0496106_0138115 | Ga0496106_0138115_1230_1610 | 126 |
| 327 | 3300048909 | Ga0496106_0684485 | Ga0496106_0684485_120_500 | 126 |
| 328 | 3300048910 | Ga0496107_0667202 | Ga0496107_0667202_321_701 | 126 |
| 329 | 3300048911 | Ga0496108_0026177 | Ga0496108_0026177_1624_2004 | 126 |
| 330 | 3300048912 | Ga0496109_0000248 | Ga0496109_0000248_21909_22289 | 126 |
| 331 | 3300048916 | Ga0496113_0028160 | Ga0496113_0028160_1788_2168 | 126 |
| 332 | 3300049578 | Ga0501042_0117175 | Ga0501042_0117175_795_1175 | 126 |
| 333 | 3300049578 | Ga0501042_0266646 | Ga0501042_0266646_46_426 | 126 |
| 334 | 3300049586 | Ga0501070_0156839 | Ga0501070_0156839_1206_1586 | 126 |
| 335 | 3300049588 | Ga0501072_0049010 | Ga0501072_0049010_1301_1681 | 126 |
| 336 | 3300049741 | Ga0501079_1394823 | Ga0501079_1394823_59_439 | 126 |
| 337 | 3300049824 | Ga0501045_1365460 | Ga0501045_1365460_106_486 | 126 |
| 338 | 3300050515 | nmdc:mga0a205_1_c2 | nmdc:mga0a205_1_c2_129487_129867 | 126 |
| 339 | 3300054114 | Ga0501084_1111040 | Ga0501084_1111040_124_504 | 126 |
| 340 | 3300060353 | Ga0501082_0230736 | Ga0501082_0230736_1217_1597 | 126 |
| 341 | 3300005328 | Ga0070676_10443795 | Ga0070676_104437952 | 127 |
| 342 | 3300005335 | Ga0070666_11100951 | Ga0070666_111009511 | 127 |
| 343 | 3300005337 | Ga0070682_100000077 | Ga0070682_10000007724 | 127 |
| 344 | 3300005338 | Ga0068868_100002341 | Ga0068868_10000234112 | 127 |
| 345 | 3300005340 | Ga0070689_100075918 | Ga0070689_1000759182 | 127 |
| 346 | 3300005347 | Ga0070668_100001597 | Ga0070668_1000015977 | 127 |
| 347 | 3300005366 | Ga0070659_100108720 | Ga0070659_1001087204 | 127 |
| 348 | 3300005367 | Ga0070667_100005325 | Ga0070667_1000053255 | 127 |
| 349 | 3300005439 | Ga0070711_100518573 | Ga0070711_1005185731 | 127 |
| 350 | 3300005441 | Ga0070700_100118233 | Ga0070700_1001182332 | 127 |
| 351 | 3300005457 | Ga0070662_100000005 | Ga0070662_10000000512 | 127 |
| 352 | 3300005458 | Ga0070681_10033752 | Ga0070681_100337523 | 127 |
| 353 | 3300005530 | Ga0070679_100000487 | Ga0070679_10000048724 | 127 |
| 354 | 3300005539 | Ga0068853_100004202 | Ga0068853_10000420211 | 127 |
| 355 | 3300005539 | Ga0068853_100077288 | Ga0068853_1000772883 | 127 |
| 356 | 3300005547 | Ga0070693_100571527 | Ga0070693_1005715272 | 127 |
| 357 | 3300005548 | Ga0070665_100000341 | Ga0070665_10000034145 | 127 |
| 358 | 3300005548 | Ga0070665_100844792 | Ga0070665_1008447922 | 127 |
| 359 | 3300005549 | Ga0070704_101341486 | Ga0070704_1013414861 | 127 |
| 360 | 3300005563 | Ga0068855_100172973 | Ga0068855_1001729732 | 127 |
| 361 | 3300005578 | Ga0068854_100104593 | Ga0068854_1001045933 | 127 |
| 362 | 3300005614 | Ga0068856_100100573 | Ga0068856_1001005734 | 127 |
| 363 | 3300005719 | Ga0068861_100825515 | Ga0068861_1008255152 | 127 |
| 364 | 3300005842 | Ga0068858_100000251 | Ga0068858_10000025113 | 127 |
| 365 | 3300005843 | Ga0068860_100607494 | Ga0068860_1006074942 | 127 |
| 366 | 3300005844 | Ga0068862_100002273 | Ga0068862_1000022732 | 127 |
| 367 | 3300005937 | Ga0081455_10055679 | Ga0081455_100556792 | 127 |
| 368 | 3300009093 | Ga0105240_11044676 | Ga0105240_110446762 | 127 |
| 369 | 3300009098 | Ga0105245_10012189 | Ga0105245_100121893 | 127 |
| 370 | 3300009101 | Ga0105247_10804901 | Ga0105247_108049012 | 127 |
| 371 | 3300009176 | Ga0105242_10130238 | Ga0105242_101302383 | 127 |
| 372 | 3300009551 | Ga0105238_10000172 | Ga0105238_1000017250 | 127 |
| 373 | 3300009553 | Ga0105249_10018681 | Ga0105249_100186817 | 127 |
| 374 | 3300013104 | Ga0157370_10953235 | Ga0157370_109532352 | 127 |
| 375 | 3300013297 | Ga0157378_11075812 | Ga0157378_110758121 | 127 |
| 376 | 3300014326 | Ga0157380_10046566 | Ga0157380_100465662 | 127 |
| 377 | 3300017792 | Ga0163161_11016193 | Ga0163161_110161932 | 127 |
| 378 | 3300020078 | Ga0206352_10175609 | Ga0206352_101756092 | 127 |
| 379 | 3300025912 | Ga0207707_10023070 | Ga0207707_100230703 | 127 |
| 380 | 3300025913 | Ga0207695_10721445 | Ga0207695_107214452 | 127 |
| 381 | 3300025916 | Ga0207663_10039966 | Ga0207663_100399664 | 127 |
| 382 | 3300025921 | Ga0207652_10000658 | Ga0207652_1000065824 | 127 |
| 383 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004934 | 127 |
| 384 | 3300025927 | Ga0207687_10000167 | Ga0207687_1000016745 | 127 |
| 385 | 3300025932 | Ga0207690_10350217 | Ga0207690_103502172 | 127 |
| 386 | 3300025933 | Ga0207706_10000006 | Ga0207706_10000006227 | 127 |
| 387 | 3300025934 | Ga0207686_10145931 | Ga0207686_101459312 | 127 |
| 388 | 3300025936 | Ga0207670_10238103 | Ga0207670_102381032 | 127 |
| 389 | 3300025938 | Ga0207704_10482154 | Ga0207704_104821542 | 127 |
| 390 | 3300025949 | Ga0207667_10180179 | Ga0207667_101801792 | 127 |
| 391 | 3300025961 | Ga0207712_10009056 | Ga0207712_100090562 | 127 |
| 392 | 3300025961 | Ga0207712_10845599 | Ga0207712_108455992 | 127 |
| 393 | 3300025972 | Ga0207668_10002148 | Ga0207668_1000214812 | 127 |
| 394 | 3300025981 | Ga0207640_10197106 | Ga0207640_101971063 | 127 |
| 395 | 3300025986 | Ga0207658_10004877 | Ga0207658_100048778 | 127 |
| 396 | 3300026023 | Ga0207677_10000677 | Ga0207677_100006776 | 127 |
| 397 | 3300026035 | Ga0207703_10000128 | Ga0207703_1000012840 | 127 |
| 398 | 3300026041 | Ga0207639_10031439 | Ga0207639_100314393 | 127 |
| 399 | 3300026041 | Ga0207639_10109156 | Ga0207639_101091563 | 127 |
| 400 | 3300026075 | Ga0207708_10249001 | Ga0207708_102490012 | 127 |
| 401 | 3300026078 | Ga0207702_10004618 | Ga0207702_1000461812 | 127 |
| 402 | 3300026118 | Ga0207675_100473988 | Ga0207675_1004739883 | 127 |
| 403 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020420 | 127 |
| 404 | 3300028380 | Ga0268265_10000938 | Ga0268265_1000093817 | 127 |
| 405 | 3300028381 | Ga0268264_12073480 | Ga0268264_120734802 | 127 |
| 406 | 3300035117 | Ga0373953_0233731 | Ga0373953_0233731_139_528 | 127 |
| 407 | 3300035170 | Ga0373943_0782931 | Ga0373943_0782931_68_451 | 127 |
| 408 | 3300035172 | Ga0373955_0117970 | Ga0373955_0117970_348_737 | 127 |
| 409 | 3300036401 | Ga0373937_0034652 | Ga0373937_0034652_2578_2967 | 127 |
| 410 | 3300046454 | Ga0495592_0171595 | Ga0495592_0171595_975_1358 | 127 |
| 411 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_479283_479666 | 127 |
| 412 | 3300046515 | Ga0495620_0000747 | Ga0495620_0000747_11922_12308 | 127 |
| 413 | 3300046523 | Ga0495644_0000499 | Ga0495644_0000499_12547_12930 | 127 |
| 414 | 3300046535 | Ga0495586_0000537 | Ga0495586_0000537_15948_16334 | 127 |
| 415 | 3300046536 | Ga0495587_0011847 | Ga0495587_0011847_1831_2217 | 127 |
| 416 | 3300046537 | Ga0495598_0004358 | Ga0495598_0004358_1506_1892 | 127 |
| 417 | 3300046543 | Ga0495645_0054401 | Ga0495645_0054401_460_843 | 127 |
| 418 | 3300046642 | Ga0495634_0238493 | Ga0495634_0238493_614_997 | 127 |
| 419 | 3300046678 | Ga0495599_0110646 | Ga0495599_0110646_150_533 | 127 |
| 420 | 3300046679 | Ga0495623_0413748 | Ga0495623_0413748_155_541 | 127 |
| 421 | 3300046681 | Ga0495647_0113957 | Ga0495647_0113957_595_978 | 127 |
| 422 | 3300046684 | Ga0495669_0000083 | Ga0495669_0000083_39687_40073 | 127 |
| 423 | 3300046690 | Ga0495624_0000307 | Ga0495624_0000307_19034_19417 | 127 |
| 424 | 3300046694 | Ga0495649_0032859 | Ga0495649_0032859_684_1067 | 127 |
| 425 | 3300047317 | Ga0495604_0047397 | Ga0495604_0047397_773_1156 | 127 |
| 426 | 3300047321 | Ga0495676_0001446 | Ga0495676_0001446_18069_18452 | 127 |
| 427 | 3300047322 | Ga0495680_0000599 | Ga0495680_0000599_22559_22942 | 127 |
| 428 | 3300048903 | Ga0496100_0000007 | Ga0496100_0000007_234371_234754 | 127 |
| 429 | 3300048904 | Ga0496101_0000013 | Ga0496101_0000013_234371_234754 | 127 |
| 430 | 3300048907 | Ga0496104_0000013 | Ga0496104_0000013_26634_27023 | 127 |
| 431 | 3300048908 | Ga0496105_0000006 | Ga0496105_0000006_370141_370530 | 127 |
| 432 | 3300048909 | Ga0496106_0000006 | Ga0496106_0000006_228510_228893 | 127 |
| 433 | 3300048910 | Ga0496107_0000007 | Ga0496107_0000007_228512_228895 | 127 |
| 434 | 3300048913 | Ga0496110_0010361 | Ga0496110_0010361_5863_6246 | 127 |
| 435 | 3300048913 | Ga0496110_1201915 | Ga0496110_1201915_199_612 | 127 |
| 436 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_411289_411678 | 127 |
| 437 | 3300048917 | Ga0496114_0116555 | Ga0496114_0116555_1224_1610 | 127 |
| 438 | 3300049592 | Ga0501076_1674091 | Ga0501076_1674091_46_435 | 127 |
| 439 | 3300053077 | Ga0495601_0000581 | Ga0495601_0000581_16477_16860 | 127 |
| 440 | 3300053078 | Ga0495612_0001629 | Ga0495612_0001629_3908_4291 | 127 |
| 441 | 3300053085 | Ga0495619_0002122 | Ga0495619_0002122_6366_6752 | 127 |
| 442 | 3300053123 | Ga0500614_022982 | Ga0500614_022982_313_696 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lvc-assembly1.cif.gz_A | crystal structure of s-adenosyl-l-homocysteine hydrolase from bradyrhizobium elkanii in complex with adenosine | 0.8181 | 28 | 54 |
| 7zd8-assembly1.cif.gz_A | crystal structure of the r24e mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations | 0.7968 | 30 | 54 |
| 7zd9-assembly1.cif.gz_A | crystal structure of the e352t mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations | 0.7961 | 30 | 54 |
| 2p7k-assembly1.cif.gz_B | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) | 0.7884 | 4 | 126 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.7811 | 3 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06412_6_120_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7956 | 7 | 127 | 3.10.180.10 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7888 | 4 | 126 | 3.10.180.10 |
| 2qqzB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7875 | 7 | 126 | 3.10.180.10 |
| 2qqzB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7811 | 7 | 126 | 3.10.180.10 |
| af_O06412_6_120_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7773 | 7 | 127 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A445ND58-F1-model_v4 | deleted | 0.9729 | 1 | 126 |
|
| AF-A0A853BS13-F1-model_v4 | Putative enzyme related to lactoylglutathione lyase | 0.9711 | 1 | 126 |
GO:0016829
|
| AF-A0A852U876-F1-model_v4 | Putative enzyme related to lactoylglutathione lyase | 0.9702 | 1 | 106 |
GO:0016829
|
| AF-A0A2N7T1R3-F1-model_v4 | deleted | 0.9655 | 1 | 125 |
|
| AF-C1A0R7-F1-model_v4 | VOC domain-containing protein | 0.9648 | 1 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar