F444867

General Info

Members Datasets Scaffolds Average Seq Length
442 177 884 343

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10386379|Ga0105248_103863792
Length 364
Sequence MLADCSFERHLAERYAAPAKEGAMSRTFWIAASAGLLMTTGCNRAQQEPQGPPASYFDNKAHADAWSGGARKITISTPKGPHQLWIKRVGNNPKLKLLLLTGGPGFSHAYLEVMDSFLPAEGVEYYHYDQLETGESDKPNDPDLWTLPRYVDEVDQVRKAIGGTKDNFCVFGHSWGGVLAIEYALAHQDQLKCLVISNMMASIPAYNAYADKVLKPQMNQAALKEILAMEAAGQTEQPHYMEVLMPNWYEQHILRRPAADWPEPLTRDFPKINRRFYVTMQGPSEMGASGRLVNWDRFADLKRIEVPTLVISGKYDTMDPAYMAKMAKQLPHGELAATNGGHMDMYDDQPTYFAKLTAFLRKFR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.75
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10386379 3300009177 Bacteria 1576
2 JGI24741J21665_1000971 3300001915 Bacteria 8621
3 JGI24740J21852_10011701 3300001979 Bacteria 3333
4 JGI24739J22299_10004034 3300001989 Bacteria 5616
5 JGI24739J22299_10024418 3300001989 Bacteria 2131
6 JGI24737J22298_10001744 3300001990 Bacteria 7767
7 JGI24737J22298_10014289 3300001990 Bacteria 2578
8 JGI24735J21928_10005687 3300002067 Bacteria 4122
9 Ga0065712_10071525 3300005290 Bacteria 5210
10 Ga0065715_10002122 3300005293 Bacteria 11891
11 Ga0065715_10112892 3300005293 Bacteria 2511
12 Ga0070658_10062637 3300005327 Bacteria 3031
13 Ga0070658_10074888 3300005327 Bacteria 2776
14 Ga0070658_10166328 3300005327 Bacteria 1851
15 Ga0070676_10045250 3300005328 Unclassified 2563
16 Ga0070683_100019349 3300005329 Bacteria 6046
17 Ga0070690_100037295 3300005330 Bacteria 3062
18 Ga0070670_100000879 3300005331 Bacteria 23645
19 Ga0070670_100055608 3300005331 Unclassified 3397
20 Ga0070670_100080735 3300005331 Bacteria 2795
21 Ga0070670_100173128 3300005331 Bacteria 1873
22 Ga0070677_10011148 3300005333 Bacteria 3092
23 Ga0070666_10001145 3300005335 Bacteria 16129
24 Ga0070680_100016068 3300005336 Bacteria 5881
25 Ga0070682_100029658 3300005337 Bacteria 3295
26 Ga0068868_100002310 3300005338 Bacteria 13190
27 Ga0068868_100039567 3300005338 Bacteria 3664
28 Ga0068868_100058018 3300005338 Bacteria 3059
29 Ga0070660_100001805 3300005339 Bacteria 14689
30 Ga0070660_100012018 3300005339 Bacteria 6178
31 Ga0070660_100012886 3300005339 Bacteria 5982
32 Ga0070660_100119844 3300005339 Bacteria 2099
33 Ga0070660_100213628 3300005339 Bacteria 1566
34 Ga0070660_100317766 3300005339 Bacteria 1279
35 Ga0070661_100016989 3300005344 Bacteria 5155
36 Ga0070661_100022085 3300005344 Bacteria 4552
37 Ga0070661_100080617 3300005344 Bacteria 2402
38 Ga0070661_100096444 3300005344 Bacteria 2194
39 Ga0070661_100122788 3300005344 Bacteria 1946
40 Ga0070661_100226239 3300005344 Bacteria 1436
41 Ga0070692_10003962 3300005345 Bacteria 6110
42 Ga0070692_10100185 3300005345 Bacteria 1587
43 Ga0070668_100003000 3300005347 Bacteria 12473
44 Ga0070668_100198328 3300005347 Bacteria 1647
45 Ga0070668_100199734 3300005347 Bacteria 1641
46 Ga0070669_100019876 3300005353 Bacteria 4798
47 Ga0070669_100020745 3300005353 Bacteria 4694
48 Ga0070669_100028164 3300005353 Bacteria 4045
49 Ga0070669_100301610 3300005353 Bacteria 1289
50 Ga0070675_100001413 3300005354 Bacteria 17638
51 Ga0070675_100049318 3300005354 Bacteria 3456
52 Ga0070675_100085006 3300005354 Bacteria 2643
53 Ga0070675_100114191 3300005354 Bacteria 2288
54 Ga0070671_100000789 3300005355 Bacteria 22803
55 Ga0070671_100000933 3300005355 Bacteria 21395
56 Ga0070671_100028575 3300005355 Bacteria 4593
57 Ga0070671_100096280 3300005355 Bacteria 2482
58 Ga0070671_100169183 3300005355 Bacteria 1848
59 Ga0070674_100065816 3300005356 Bacteria 2545
60 Ga0070674_100065968 3300005356 Bacteria 2542
61 Ga0070673_100002680 3300005364 Bacteria 10900
62 Ga0070673_100124136 3300005364 Bacteria 2158
63 Ga0070673_100164151 3300005364 Bacteria 1891
64 Ga0070673_100290680 3300005364 Bacteria 1436
65 Ga0070659_100005450 3300005366 Bacteria 9141
66 Ga0070659_100060900 3300005366 Bacteria 2982
67 Ga0070659_100067689 3300005366 Bacteria 2832
68 Ga0070659_100097217 3300005366 Bacteria 2366
69 Ga0070659_100102305 3300005366 Bacteria 2306
70 Ga0070659_100214328 3300005366 Bacteria 1588
71 Ga0070659_100394753 3300005366 Bacteria 1167
72 Ga0070667_100002541 3300005367 Bacteria 15877
73 Ga0070667_100008838 3300005367 Bacteria 8341
74 Ga0070667_100015604 3300005367 Bacteria 6281
75 Ga0070667_100035532 3300005367 Bacteria 4175
76 Ga0070667_100448799 3300005367 Bacteria 1178
77 Ga0070714_100160759 3300005435 Bacteria 2032
78 Ga0070713_100063496 3300005436 Bacteria 3097
79 Ga0070694_100228602 3300005444 Bacteria 1398
80 Ga0070663_100004583 3300005455 Bacteria 8141
81 Ga0070663_100058364 3300005455 Bacteria 2771
82 Ga0070678_100004229 3300005456 Bacteria 8112
83 Ga0070662_100018574 3300005457 Bacteria 4705
84 Ga0070662_100056111 3300005457 Bacteria 2859
85 Ga0070662_100064438 3300005457 Bacteria 2683
86 Ga0070662_100077101 3300005457 Unclassified 2473
87 Ga0070681_10015743 3300005458 Bacteria 7539
88 Ga0070681_10230566 3300005458 Bacteria 1766
89 Ga0068867_100038512 3300005459 Bacteria 3480
90 Ga0068867_100052222 3300005459 Bacteria 3016
91 Ga0070679_100240816 3300005530 Bacteria 1766
92 Ga0070684_100034864 3300005535 Bacteria 4305
93 Ga0070684_100278238 3300005535 Bacteria 1533
94 Ga0068853_100006404 3300005539 Bacteria 9354
95 Ga0068853_100077902 3300005539 Bacteria 2896
96 Ga0068853_100092620 3300005539 Bacteria 2659
97 Ga0068853_100140621 3300005539 Bacteria 2167
98 Ga0068853_100270999 3300005539 Bacteria 1563
99 Ga0070672_100014362 3300005543 Bacteria 5612
100 Ga0070672_100056083 3300005543 Bacteria 3088
101 Ga0070672_100174839 3300005543 Bacteria 1787
102 Ga0070672_100223870 3300005543 Unclassified 1579
103 Ga0070695_100084329 3300005545 Bacteria 2107
104 Ga0070665_100015414 3300005548 Bacteria 7675
105 Ga0068855_100097661 3300005563 Bacteria 3383
106 Ga0068855_100379314 3300005563 Bacteria 1553
107 Ga0070664_100010890 3300005564 Bacteria 7375
108 Ga0070664_100012887 3300005564 Bacteria 6803
109 Ga0070664_100017256 3300005564 Bacteria 5929
110 Ga0070664_100021542 3300005564 Bacteria 5314
111 Ga0070664_100049263 3300005564 Bacteria 3562
112 Ga0070664_100079837 3300005564 Bacteria 2817
113 Ga0070664_100085211 3300005564 Bacteria 2728
114 Ga0068857_100037279 3300005577 Bacteria 4306
115 Ga0068857_100038183 3300005577 Bacteria 4253
116 Ga0068857_100047934 3300005577 Bacteria 3794
117 Ga0068857_100065705 3300005577 Bacteria 3226
118 Ga0068854_100023219 3300005578 Bacteria 4235
119 Ga0068854_100042256 3300005578 Bacteria 3226
120 Ga0068854_100079284 3300005578 Bacteria 2421
121 Ga0068854_100145387 3300005578 Bacteria 1823
122 Ga0068854_100188836 3300005578 Bacteria 1613
123 Ga0068856_100165521 3300005614 Bacteria 2222
124 Ga0068856_100224295 3300005614 Bacteria 1895
125 Ga0068856_100255426 3300005614 Bacteria 1767
126 Ga0068852_100078168 3300005616 Bacteria 2927
127 Ga0068852_100079790 3300005616 Bacteria 2900
128 Ga0068852_100133609 3300005616 Bacteria 2288
129 Ga0068852_100309416 3300005616 Bacteria 1531
130 Ga0068859_100007663 3300005617 Bacteria 10972
131 Ga0068859_100036854 3300005617 Bacteria 4910
132 Ga0068864_100000078 3300005618 Bacteria 103622
133 Ga0068864_100001531 3300005618 Bacteria 19037
134 Ga0068864_100028370 3300005618 Bacteria 4729
135 Ga0068864_100105073 3300005618 Bacteria 2510
136 Ga0068866_10028644 3300005718 Bacteria 2656
137 Ga0068851_10015563 3300005834 Bacteria 3626
138 Ga0068863_100012042 3300005841 Bacteria 8356
139 Ga0068863_100034130 3300005841 Bacteria 4846
140 Ga0068858_100000874 3300005842 Bacteria 31179
141 Ga0068858_100002699 3300005842 Bacteria 17885
142 Ga0068860_100002261 3300005843 Bacteria 20243
143 Ga0068860_100058453 3300005843 Bacteria 3665
144 Ga0068862_100001089 3300005844 Bacteria 25856
145 Ga0068862_100021255 3300005844 Bacteria 5423
146 Ga0068862_100028201 3300005844 Bacteria 4727
147 Ga0068862_100397624 3300005844 Bacteria 1288
148 Ga0097621_100069249 3300006237 Bacteria 2913
149 Ga0068871_100019688 3300006358 Bacteria 5156
150 Ga0068871_100138331 3300006358 Bacteria 2069
151 Ga0075433_10130717 3300006852 Bacteria 2230
152 Ga0068865_100121370 3300006881 Bacteria 1944
153 Ga0068865_100142617 3300006881 Bacteria 1808
154 Ga0097620_100007663 3300006931 Bacteria 10972
155 Ga0097620_100036855 3300006931 Bacteria 4910
156 Ga0105240_10128190 3300009093 Bacteria 3046
157 Ga0105240_10234217 3300009093 Bacteria 2132
158 Ga0105240_10425641 3300009093 Bacteria 1490
159 Ga0105245_10051485 3300009098 Bacteria 3691
160 Ga0105245_10082467 3300009098 Bacteria 2941
161 Ga0105245_10237462 3300009098 Bacteria 1765
162 Ga0105247_10010978 3300009101 Bacteria 5468
163 Ga0105241_10161171 3300009174 Bacteria 1844
164 Ga0105241_10228168 3300009174 Bacteria 1569
165 Ga0105242_10212365 3300009176 Bacteria 1725
166 Ga0105242_10375418 3300009176 Bacteria 1320
167 Ga0105248_10000413 3300009177 Bacteria 49136
168 Ga0105248_10001099 3300009177 Bacteria 29952
169 Ga0105248_10002719 3300009177 Bacteria 19642
170 Ga0105248_10107684 3300009177 Bacteria 3143
171 Ga0105248_10113719 3300009177 Bacteria 3053
172 Ga0105248_10147926 3300009177 Bacteria 2650
173 Ga0105237_10131044 3300009545 Bacteria 2502
174 Ga0105238_10354688 3300009551 Bacteria 1456
175 Ga0105249_10009708 3300009553 Bacteria 8433
176 Ga0105249_10098825 3300009553 Bacteria 2742
177 Ga0105249_10477908 3300009553 Bacteria 1288
178 Ga0157371_10033449 3300013102 Bacteria 3693
179 Ga0157370_10182886 3300013104 Bacteria 1947
180 Ga0157370_10464777 3300013104 Unclassified 1163
181 Ga0157369_10116014 3300013105 Bacteria 2844
182 Ga0157374_10039460 3300013296 Bacteria 4345
183 Ga0157378_10116721 3300013297 Bacteria 2454
184 Ga0163162_10055858 3300013306 Bacteria 3976
185 Ga0157372_10020166 3300013307 Bacteria 7187
186 Ga0157372_10054531 3300013307 Bacteria 4460
187 Ga0157375_10063908 3300013308 Bacteria 3663
188 Ga0157375_10070637 3300013308 Bacteria 3502
189 Ga0157375_10082503 3300013308 Bacteria 3257
190 Ga0157375_10089581 3300013308 Bacteria 3133
191 Ga0163163_10000355 3300014325 Bacteria 44183
192 Ga0163163_10351105 3300014325 Bacteria 1531
193 Ga0157380_10021939 3300014326 Bacteria 4796
194 Ga0157377_10037862 3300014745 Bacteria 2660
195 Ga0157379_10119335 3300014968 Bacteria 2372
196 Ga0157376_10106714 3300014969 Bacteria 2458
197 Ga0213876_10105754 3300021384 Bacteria 1493
198 Ga0207697_10066959 3300025315 Bacteria 1501
199 Ga0207682_10006345 3300025893 Bacteria 4771
200 Ga0207642_10121041 3300025899 Bacteria 1350
201 Ga0207688_10024825 3300025901 Bacteria 3288
202 Ga0207680_10000532 3300025903 Bacteria 18111
203 Ga0207647_10001281 3300025904 Bacteria 19328
204 Ga0207647_10006701 3300025904 Bacteria 8368
205 Ga0207647_10030107 3300025904 Bacteria 3506
206 Ga0207647_10153632 3300025904 Bacteria 1344
207 Ga0207705_10000475 3300025909 Bacteria 34403
208 Ga0207705_10056362 3300025909 Bacteria 2833
209 Ga0207705_10088311 3300025909 Bacteria 2268
210 Ga0207695_10087500 3300025913 Bacteria 3138
211 Ga0207660_10055785 3300025917 Bacteria 2825
212 Ga0207657_10000919 3300025919 Bacteria 31133
213 Ga0207657_10004665 3300025919 Bacteria 14475
214 Ga0207657_10006165 3300025919 Bacteria 12466
215 Ga0207657_10006333 3300025919 Bacteria 12295
216 Ga0207657_10007218 3300025919 Bacteria 11410
217 Ga0207657_10061849 3300025919 Bacteria 3208
218 Ga0207657_10169795 3300025919 Bacteria 1768
219 Ga0207649_10009751 3300025920 Bacteria 5259
220 Ga0207649_10034985 3300025920 Bacteria 3014
221 Ga0207649_10036553 3300025920 Bacteria 2959
222 Ga0207649_10062167 3300025920 Bacteria 2353
223 Ga0207652_10087693 3300025921 Bacteria 2729
224 Ga0207681_10001961 3300025923 Bacteria 13202
225 Ga0207681_10045158 3300025923 Bacteria 2957
226 Ga0207681_10256221 3300025923 Bacteria 1368
227 Ga0207681_10333678 3300025923 Bacteria 1209
228 Ga0207694_10065988 3300025924 Bacteria 2822
229 Ga0207694_10133066 3300025924 Bacteria 1995
230 Ga0207650_10001438 3300025925 Bacteria 17144
231 Ga0207650_10036185 3300025925 Bacteria 3589
232 Ga0207650_10078881 3300025925 Bacteria 2492
233 Ga0207650_10201496 3300025925 Unclassified 1595
234 Ga0207659_10004828 3300025926 Bacteria 8171
235 Ga0207659_10257450 3300025926 Bacteria 1418
236 Ga0207687_10128482 3300025927 Bacteria 1906
237 Ga0207664_10121010 3300025929 Bacteria 2190
238 Ga0207664_10133812 3300025929 Bacteria 2090
239 Ga0207644_10000135 3300025931 Bacteria 53131
240 Ga0207644_10000979 3300025931 Bacteria 18243
241 Ga0207644_10001348 3300025931 Bacteria 15785
242 Ga0207644_10002434 3300025931 Bacteria 11996
243 Ga0207644_10018238 3300025931 Bacteria 4745
244 Ga0207644_10026953 3300025931 Bacteria 3967
245 Ga0207644_10118589 3300025931 Bacteria 2011
246 Ga0207644_10242223 3300025931 Bacteria 1436
247 Ga0207690_10001514 3300025932 Bacteria 14537
248 Ga0207690_10003369 3300025932 Bacteria 9555
249 Ga0207690_10025740 3300025932 Bacteria 3698
250 Ga0207690_10180823 3300025932 Bacteria 1588
251 Ga0207706_10002674 3300025933 Bacteria 17365
252 Ga0207706_10005097 3300025933 Bacteria 12267
253 Ga0207706_10011300 3300025933 Bacteria 8136
254 Ga0207706_10012412 3300025933 Bacteria 7762
255 Ga0207706_10043597 3300025933 Bacteria 3975
256 Ga0207706_10053621 3300025933 Bacteria 3559
257 Ga0207706_10095339 3300025933 Bacteria 2617
258 Ga0207706_10165001 3300025933 Bacteria 1947
259 Ga0207686_10289736 3300025934 Bacteria 1212
260 Ga0207709_10081936 3300025935 Bacteria 2082
261 Ga0207669_10029967 3300025937 Bacteria 3017
262 Ga0207669_10052321 3300025937 Bacteria 2452
263 Ga0207669_10119521 3300025937 Bacteria 1785
264 Ga0207704_10067117 3300025938 Bacteria 2255
265 Ga0207704_10120369 3300025938 Bacteria 1795
266 Ga0207691_10009544 3300025940 Bacteria 9312
267 Ga0207691_10019957 3300025940 Bacteria 6340
268 Ga0207691_10039116 3300025940 Bacteria 4389
269 Ga0207691_10052628 3300025940 Bacteria 3719
270 Ga0207691_10109955 3300025940 Bacteria 2452
271 Ga0207691_10301629 3300025940 Unclassified 1376
272 Ga0207711_10000218 3300025941 Bacteria 61467
273 Ga0207711_10001105 3300025941 Bacteria 25760
274 Ga0207711_10004701 3300025941 Bacteria 11599
275 Ga0207711_10019026 3300025941 Bacteria 5714
276 Ga0207711_10031985 3300025941 Bacteria 4446
277 Ga0207711_10032227 3300025941 Bacteria 4431
278 Ga0207711_10066822 3300025941 Bacteria 3110
279 Ga0207711_10094132 3300025941 Bacteria 2640
280 Ga0207711_10347068 3300025941 Bacteria 1374
281 Ga0207689_10004458 3300025942 Bacteria 12697
282 Ga0207689_10096901 3300025942 Bacteria 2422
283 Ga0207661_10005261 3300025944 Bacteria 9104
284 Ga0207661_10350306 3300025944 Bacteria 1332
285 Ga0207679_10017312 3300025945 Bacteria 4804
286 Ga0207679_10018690 3300025945 Bacteria 4648
287 Ga0207679_10027518 3300025945 Bacteria 3933
288 Ga0207679_10036894 3300025945 Bacteria 3470
289 Ga0207667_10020343 3300025949 Bacteria 7386
290 Ga0207667_10098205 3300025949 Bacteria 3022
291 Ga0207651_10001403 3300025960 Bacteria 10938
292 Ga0207651_10004309 3300025960 Bacteria 7143
293 Ga0207651_10022423 3300025960 Bacteria 3860
294 Ga0207651_10077695 3300025960 Bacteria 2378
295 Ga0207651_10154727 3300025960 Bacteria 1789
296 Ga0207651_10182157 3300025960 Bacteria 1667
297 Ga0207712_10001363 3300025961 Bacteria 16740
298 Ga0207668_10003250 3300025972 Bacteria 9527
299 Ga0207668_10274260 3300025972 Bacteria 1380
300 Ga0207668_10365370 3300025972 Bacteria 1210
301 Ga0207640_10007586 3300025981 Bacteria 5991
302 Ga0207640_10039250 3300025981 Bacteria 2995
303 Ga0207658_10001945 3300025986 Bacteria 15425
304 Ga0207658_10005334 3300025986 Bacteria 8837
305 Ga0207658_10011303 3300025986 Bacteria 6078
306 Ga0207658_10022660 3300025986 Bacteria 4375
307 Ga0207658_10049259 3300025986 Bacteria 3095
308 Ga0207658_10049698 3300025986 Bacteria 3082
309 Ga0207658_10100887 3300025986 Bacteria 2260
310 Ga0207658_10336753 3300025986 Bacteria 1310
311 Ga0207677_10001741 3300026023 Bacteria 11535
312 Ga0207677_10054338 3300026023 Bacteria 2732
313 Ga0207677_10130155 3300026023 Bacteria 1909
314 Ga0207677_10166766 3300026023 Bacteria 1717
315 Ga0207703_10003898 3300026035 Bacteria 12389
316 Ga0207703_10005015 3300026035 Bacteria 10734
317 Ga0207703_10346205 3300026035 Bacteria 1367
318 Ga0207639_10000776 3300026041 Bacteria 21757
319 Ga0207639_10048765 3300026041 Bacteria 3207
320 Ga0207639_10064348 3300026041 Bacteria 2843
321 Ga0207639_10159626 3300026041 Bacteria 1899
322 Ga0207639_10168678 3300026041 Bacteria 1852
323 Ga0207639_10277323 3300026041 Bacteria 1473
324 Ga0207639_10292183 3300026041 Bacteria 1437
325 Ga0207678_10015616 3300026067 Bacteria 6676
326 Ga0207678_10022871 3300026067 Bacteria 5472
327 Ga0207641_10000573 3300026088 Bacteria 40695
328 Ga0207641_10018663 3300026088 Bacteria 5686
329 Ga0207641_10029035 3300026088 Bacteria 4573
330 Ga0207641_10069200 3300026088 Bacteria 3029
331 Ga0207641_10345289 3300026088 Bacteria 1417
332 Ga0207648_10003247 3300026089 Bacteria 17102
333 Ga0207648_10109309 3300026089 Bacteria 2427
334 Ga0207676_10060771 3300026095 Bacteria 2990
335 Ga0207674_10005438 3300026116 Bacteria 15125
336 Ga0207674_10008283 3300026116 Bacteria 12040
337 Ga0207675_100174950 3300026118 Bacteria 2053
338 Ga0207675_100326794 3300026118 Bacteria 1498
339 Ga0207683_10042402 3300026121 Bacteria 3975
340 Ga0207683_10048818 3300026121 Bacteria 3704
341 Ga0207683_10065613 3300026121 Bacteria 3201
342 Ga0207698_10045260 3300026142 Bacteria 3314
343 Ga0207698_10082311 3300026142 Bacteria 2601
344 Ga0207698_10543791 3300026142 Bacteria 1137
345 Ga0268266_10142708 3300028379 Bacteria 2150
346 Ga0268266_10364060 3300028379 Bacteria 1361
347 Ga0268265_10000877 3300028380 Bacteria 28171
348 Ga0268265_10011762 3300028380 Bacteria 5919
349 Ga0268265_10014926 3300028380 Bacteria 5303
350 Ga0268264_10001863 3300028381 Bacteria 19178
351 Ga0268264_10001963 3300028381 Bacteria 18480
352 Ga0268264_10002999 3300028381 Bacteria 14637
353 Ga0268264_10145469 3300028381 Bacteria 2119
354 Ga0307405_10044173 3300031731 Bacteria 2724
355 Ga0307413_10018357 3300031824 Bacteria 3668
356 Ga0307413_10050528 3300031824 Bacteria 2499
357 Ga0307410_10041407 3300031852 Bacteria 3038
358 Ga0307410_10058325 3300031852 Bacteria 2631
359 Ga0307407_10110416 3300031903 Bacteria 1725
360 Ga0307409_100040419 3300031995 Bacteria 3472
361 Ga0307416_100075987 3300032002 Bacteria 2813
362 Ga0307416_100126975 3300032002 Bacteria 2286
363 Ga0307414_10104250 3300032004 Bacteria 2142
364 Ga0307414_10135609 3300032004 Bacteria 1919
365 Ga0307411_10030936 3300032005 Bacteria 3287
366 Ga0307411_10076553 3300032005 Bacteria 2287
367 Ga0307415_100001311 3300032126 Bacteria 11766
368 Ga0307415_100299245 3300032126 Bacteria 1332
369 Ga0373925_0038681 3300037068 Bacteria 3528
370 Ga0395899_0007149 3300037312 Bacteria 8638
371 Ga0395899_0088969 3300037312 Bacteria 2240
372 Ga0395900_0001148 3300037418 Bacteria 33301
373 Ga0395900_0009752 3300037418 Bacteria 9837
374 Ga0395900_0011509 3300037418 Bacteria 9056
375 Ga0395900_0019788 3300037418 Bacteria 6861
376 Ga0395900_0030762 3300037418 Bacteria 5513
377 Ga0395900_0104213 3300037418 Bacteria 2914
378 Ga0395900_0164438 3300037418 Bacteria 2262
379 Ga0395900_0199864 3300037418 Bacteria 2023
380 Ga0395898_0064238 3300037466 Bacteria 3560
381 Ga0395905_0000649 3300037471 Bacteria 46291
382 Ga0395905_0000688 3300037471 Bacteria 44764
383 Ga0395905_0003854 3300037471 Bacteria 15814
384 Ga0395905_0014490 3300037471 Bacteria 7523
385 Ga0395905_0015441 3300037471 Bacteria 7260
386 Ga0395905_0060076 3300037471 Bacteria 3554
387 Ga0395905_0227029 3300037471 Bacteria 1746
388 Ga0395905_0252343 3300037471 Bacteria 1648
389 Ga0395901_0003117 3300038443 Bacteria 16656
390 Ga0395901_0016093 3300038443 Bacteria 7619
391 Ga0395901_0036744 3300038443 Bacteria 5063
392 Ga0395901_0052695 3300038443 Bacteria 4228
393 Ga0395901_0170757 3300038443 Bacteria 2282
394 Ga0436365_0091439 3300039437 Bacteria 2204
395 Ga0466961_0014324 3300044693 Bacteria 5090
396 Ga0466961_0100067 3300044693 Bacteria 1827
397 Ga0466961_0166080 3300044693 Bacteria 1374
398 Ga0466963_0023805 3300044694 Bacteria 3893
399 Ga0466963_0130271 3300044694 Bacteria 1737
400 Ga0466963_0206214 3300044694 Bacteria 1375
401 Ga0466971_0047045 3300044719 Bacteria 1939
402 Ga0466970_0072046 3300044765 Bacteria 1859
403 Ga0466959_0137871 3300045049 Bacteria 1726
404 Ga0466959_0200421 3300045049 Bacteria 1390
405 Ga0466967_0020235 3300045976 Bacteria 5373
406 Ga0466967_0044878 3300045976 Bacteria 3837
407 Ga0466967_0165756 3300045976 Bacteria 2076
408 Ga0466967_0253727 3300045976 Bacteria 1681
409 Ga0495598_0002075 3300046537 Bacteria 4088
410 Ga0495621_0001761 3300046539 Bacteria 5677
411 Ga0495621_0002840 3300046539 Bacteria 4710
412 Ga0495633_0001891 3300046558 Bacteria 15275
413 Ga0495633_0029167 3300046558 Bacteria 2685
414 Ga0495659_0095458 3300046664 Bacteria 1146
415 Ga0495669_0004464 3300046684 Bacteria 5781
416 Ga0495669_0006395 3300046684 Bacteria 4923
417 Ga0495670_0004419 3300046691 Bacteria 6900
418 Ga0495670_0007596 3300046691 Bacteria 5331
419 Ga0495677_0017550 3300047445 Bacteria 2594
420 Ga0496100_0029687 3300048903 Bacteria 3384
421 Ga0496101_0054673 3300048904 Bacteria 2882
422 Ga0496101_0178621 3300048904 Bacteria 1634
423 Ga0496102_0400337 3300048905 Bacteria 1291
424 Ga0496105_0040176 3300048908 Bacteria 3857
425 Ga0496107_0064023 3300048910 Bacteria 2665
426 Ga0496107_0332704 3300048910 Bacteria 1130
427 Ga0496108_0021027 3300048911 Bacteria 5364
428 Ga0496108_0026053 3300048911 Bacteria 4823
429 Ga0496108_0090272 3300048911 Bacteria 2605
430 Ga0496109_0047272 3300048912 Bacteria 3912
431 Ga0496109_0079286 3300048912 Bacteria 3025
432 Ga0496110_0014555 3300048913 Bacteria 6537
433 Ga0496111_0007186 3300048914 Bacteria 7278
434 Ga0496111_0235184 3300048914 Bacteria 1361
435 Ga0496112_0032149 3300048915 Bacteria 5094
436 Ga0496112_0075065 3300048915 Bacteria 3343
437 Ga0496112_0112085 3300048915 Bacteria 2697
438 Ga0496113_0235756 3300048916 Bacteria 1460
439 Ga0496114_0000023 3300048917 Bacteria 219092
440 Ga0496114_0084802 3300048917 Bacteria 2683
441 nmdc:mga06r32_497427_c1 3300050510 Bacteria 1196
442 nmdc:mga0a205_2631_c1 3300050515 Bacteria 15859
443 Ga0105248_10386379
444 JGI24741J21665_1000971
445 JGI24740J21852_10011701
446 JGI24739J22299_10004034
447 JGI24739J22299_10024418
448 JGI24737J22298_10001744
449 JGI24737J22298_10014289
450 JGI24735J21928_10005687
451 Ga0065712_10071525
452 Ga0065715_10002122
453 Ga0065715_10112892
454 Ga0070658_10062637
455 Ga0070658_10074888
456 Ga0070658_10166328
457 Ga0070676_10045250
458 Ga0070683_100019349
459 Ga0070690_100037295
460 Ga0070670_100000879
461 Ga0070670_100055608
462 Ga0070670_100080735
463 Ga0070670_100173128
464 Ga0070677_10011148
465 Ga0070666_10001145
466 Ga0070680_100016068
467 Ga0070682_100029658
468 Ga0068868_100002310
469 Ga0068868_100039567
470 Ga0068868_100058018
471 Ga0070660_100001805
472 Ga0070660_100012018
473 Ga0070660_100012886
474 Ga0070660_100119844
475 Ga0070660_100213628
476 Ga0070660_100317766
477 Ga0070661_100016989
478 Ga0070661_100022085
479 Ga0070661_100080617
480 Ga0070661_100096444
481 Ga0070661_100122788
482 Ga0070661_100226239
483 Ga0070692_10003962
484 Ga0070692_10100185
485 Ga0070668_100003000
486 Ga0070668_100198328
487 Ga0070668_100199734
488 Ga0070669_100019876
489 Ga0070669_100020745
490 Ga0070669_100028164
491 Ga0070669_100301610
492 Ga0070675_100001413
493 Ga0070675_100049318
494 Ga0070675_100085006
495 Ga0070675_100114191
496 Ga0070671_100000789
497 Ga0070671_100000933
498 Ga0070671_100028575
499 Ga0070671_100096280
500 Ga0070671_100169183
501 Ga0070674_100065816
502 Ga0070674_100065968
503 Ga0070673_100002680
504 Ga0070673_100124136
505 Ga0070673_100164151
506 Ga0070673_100290680
507 Ga0070659_100005450
508 Ga0070659_100060900
509 Ga0070659_100067689
510 Ga0070659_100097217
511 Ga0070659_100102305
512 Ga0070659_100214328
513 Ga0070659_100394753
514 Ga0070667_100002541
515 Ga0070667_100008838
516 Ga0070667_100015604
517 Ga0070667_100035532
518 Ga0070667_100448799
519 Ga0070714_100160759
520 Ga0070713_100063496
521 Ga0070694_100228602
522 Ga0070663_100004583
523 Ga0070663_100058364
524 Ga0070678_100004229
525 Ga0070662_100018574
526 Ga0070662_100056111
527 Ga0070662_100064438
528 Ga0070662_100077101
529 Ga0070681_10015743
530 Ga0070681_10230566
531 Ga0068867_100038512
532 Ga0068867_100052222
533 Ga0070679_100240816
534 Ga0070684_100034864
535 Ga0070684_100278238
536 Ga0068853_100006404
537 Ga0068853_100077902
538 Ga0068853_100092620
539 Ga0068853_100140621
540 Ga0068853_100270999
541 Ga0070672_100014362
542 Ga0070672_100056083
543 Ga0070672_100174839
544 Ga0070672_100223870
545 Ga0070695_100084329
546 Ga0070665_100015414
547 Ga0068855_100097661
548 Ga0068855_100379314
549 Ga0070664_100010890
550 Ga0070664_100012887
551 Ga0070664_100017256
552 Ga0070664_100021542
553 Ga0070664_100049263
554 Ga0070664_100079837
555 Ga0070664_100085211
556 Ga0068857_100037279
557 Ga0068857_100038183
558 Ga0068857_100047934
559 Ga0068857_100065705
560 Ga0068854_100023219
561 Ga0068854_100042256
562 Ga0068854_100079284
563 Ga0068854_100145387
564 Ga0068854_100188836
565 Ga0068856_100165521
566 Ga0068856_100224295
567 Ga0068856_100255426
568 Ga0068852_100078168
569 Ga0068852_100079790
570 Ga0068852_100133609
571 Ga0068852_100309416
572 Ga0068859_100007663
573 Ga0068859_100036854
574 Ga0068864_100000078
575 Ga0068864_100001531
576 Ga0068864_100028370
577 Ga0068864_100105073
578 Ga0068866_10028644
579 Ga0068851_10015563
580 Ga0068863_100012042
581 Ga0068863_100034130
582 Ga0068858_100000874
583 Ga0068858_100002699
584 Ga0068860_100002261
585 Ga0068860_100058453
586 Ga0068862_100001089
587 Ga0068862_100021255
588 Ga0068862_100028201
589 Ga0068862_100397624
590 Ga0097621_100069249
591 Ga0068871_100019688
592 Ga0068871_100138331
593 Ga0075433_10130717
594 Ga0068865_100121370
595 Ga0068865_100142617
596 Ga0097620_100007663
597 Ga0097620_100036855
598 Ga0105240_10128190
599 Ga0105240_10234217
600 Ga0105240_10425641
601 Ga0105245_10051485
602 Ga0105245_10082467
603 Ga0105245_10237462
604 Ga0105247_10010978
605 Ga0105241_10161171
606 Ga0105241_10228168
607 Ga0105242_10212365
608 Ga0105242_10375418
609 Ga0105248_10000413
610 Ga0105248_10001099
611 Ga0105248_10002719
612 Ga0105248_10107684
613 Ga0105248_10113719
614 Ga0105248_10147926
615 Ga0105237_10131044
616 Ga0105238_10354688
617 Ga0105249_10009708
618 Ga0105249_10098825
619 Ga0105249_10477908
620 Ga0157371_10033449
621 Ga0157370_10182886
622 Ga0157370_10464777
623 Ga0157369_10116014
624 Ga0157374_10039460
625 Ga0157378_10116721
626 Ga0163162_10055858
627 Ga0157372_10020166
628 Ga0157372_10054531
629 Ga0157375_10063908
630 Ga0157375_10070637
631 Ga0157375_10082503
632 Ga0157375_10089581
633 Ga0163163_10000355
634 Ga0163163_10351105
635 Ga0157380_10021939
636 Ga0157377_10037862
637 Ga0157379_10119335
638 Ga0157376_10106714
639 Ga0213876_10105754
640 Ga0207697_10066959
641 Ga0207682_10006345
642 Ga0207642_10121041
643 Ga0207688_10024825
644 Ga0207680_10000532
645 Ga0207647_10001281
646 Ga0207647_10006701
647 Ga0207647_10030107
648 Ga0207647_10153632
649 Ga0207705_10000475
650 Ga0207705_10056362
651 Ga0207705_10088311
652 Ga0207695_10087500
653 Ga0207660_10055785
654 Ga0207657_10000919
655 Ga0207657_10004665
656 Ga0207657_10006165
657 Ga0207657_10006333
658 Ga0207657_10007218
659 Ga0207657_10061849
660 Ga0207657_10169795
661 Ga0207649_10009751
662 Ga0207649_10034985
663 Ga0207649_10036553
664 Ga0207649_10062167
665 Ga0207652_10087693
666 Ga0207681_10001961
667 Ga0207681_10045158
668 Ga0207681_10256221
669 Ga0207681_10333678
670 Ga0207694_10065988
671 Ga0207694_10133066
672 Ga0207650_10001438
673 Ga0207650_10036185
674 Ga0207650_10078881
675 Ga0207650_10201496
676 Ga0207659_10004828
677 Ga0207659_10257450
678 Ga0207687_10128482
679 Ga0207664_10121010
680 Ga0207664_10133812
681 Ga0207644_10000135
682 Ga0207644_10000979
683 Ga0207644_10001348
684 Ga0207644_10002434
685 Ga0207644_10018238
686 Ga0207644_10026953
687 Ga0207644_10118589
688 Ga0207644_10242223
689 Ga0207690_10001514
690 Ga0207690_10003369
691 Ga0207690_10025740
692 Ga0207690_10180823
693 Ga0207706_10002674
694 Ga0207706_10005097
695 Ga0207706_10011300
696 Ga0207706_10012412
697 Ga0207706_10043597
698 Ga0207706_10053621
699 Ga0207706_10095339
700 Ga0207706_10165001
701 Ga0207686_10289736
702 Ga0207709_10081936
703 Ga0207669_10029967
704 Ga0207669_10052321
705 Ga0207669_10119521
706 Ga0207704_10067117
707 Ga0207704_10120369
708 Ga0207691_10009544
709 Ga0207691_10019957
710 Ga0207691_10039116
711 Ga0207691_10052628
712 Ga0207691_10109955
713 Ga0207691_10301629
714 Ga0207711_10000218
715 Ga0207711_10001105
716 Ga0207711_10004701
717 Ga0207711_10019026
718 Ga0207711_10031985
719 Ga0207711_10032227
720 Ga0207711_10066822
721 Ga0207711_10094132
722 Ga0207711_10347068
723 Ga0207689_10004458
724 Ga0207689_10096901
725 Ga0207661_10005261
726 Ga0207661_10350306
727 Ga0207679_10017312
728 Ga0207679_10018690
729 Ga0207679_10027518
730 Ga0207679_10036894
731 Ga0207667_10020343
732 Ga0207667_10098205
733 Ga0207651_10001403
734 Ga0207651_10004309
735 Ga0207651_10022423
736 Ga0207651_10077695
737 Ga0207651_10154727
738 Ga0207651_10182157
739 Ga0207712_10001363
740 Ga0207668_10003250
741 Ga0207668_10274260
742 Ga0207668_10365370
743 Ga0207640_10007586
744 Ga0207640_10039250
745 Ga0207658_10001945
746 Ga0207658_10005334
747 Ga0207658_10011303
748 Ga0207658_10022660
749 Ga0207658_10049259
750 Ga0207658_10049698
751 Ga0207658_10100887
752 Ga0207658_10336753
753 Ga0207677_10001741
754 Ga0207677_10054338
755 Ga0207677_10130155
756 Ga0207677_10166766
757 Ga0207703_10003898
758 Ga0207703_10005015
759 Ga0207703_10346205
760 Ga0207639_10000776
761 Ga0207639_10048765
762 Ga0207639_10064348
763 Ga0207639_10159626
764 Ga0207639_10168678
765 Ga0207639_10277323
766 Ga0207639_10292183
767 Ga0207678_10015616
768 Ga0207678_10022871
769 Ga0207641_10000573
770 Ga0207641_10018663
771 Ga0207641_10029035
772 Ga0207641_10069200
773 Ga0207641_10345289
774 Ga0207648_10003247
775 Ga0207648_10109309
776 Ga0207676_10060771
777 Ga0207674_10005438
778 Ga0207674_10008283
779 Ga0207675_100174950
780 Ga0207675_100326794
781 Ga0207683_10042402
782 Ga0207683_10048818
783 Ga0207683_10065613
784 Ga0207698_10045260
785 Ga0207698_10082311
786 Ga0207698_10543791
787 Ga0268266_10142708
788 Ga0268266_10364060
789 Ga0268265_10000877
790 Ga0268265_10011762
791 Ga0268265_10014926
792 Ga0268264_10001863
793 Ga0268264_10001963
794 Ga0268264_10002999
795 Ga0268264_10145469
796 Ga0307405_10044173
797 Ga0307413_10018357
798 Ga0307413_10050528
799 Ga0307410_10041407
800 Ga0307410_10058325
801 Ga0307407_10110416
802 Ga0307409_100040419
803 Ga0307416_100075987
804 Ga0307416_100126975
805 Ga0307414_10104250
806 Ga0307414_10135609
807 Ga0307411_10030936
808 Ga0307411_10076553
809 Ga0307415_100001311
810 Ga0307415_100299245
811 Ga0373925_0038681
812 Ga0395899_0007149
813 Ga0395899_0088969
814 Ga0395900_0001148
815 Ga0395900_0009752
816 Ga0395900_0011509
817 Ga0395900_0019788
818 Ga0395900_0030762
819 Ga0395900_0104213
820 Ga0395900_0164438
821 Ga0395900_0199864
822 Ga0395898_0064238
823 Ga0395905_0000649
824 Ga0395905_0000688
825 Ga0395905_0003854
826 Ga0395905_0014490
827 Ga0395905_0015441
828 Ga0395905_0060076
829 Ga0395905_0227029
830 Ga0395905_0252343
831 Ga0395901_0003117
832 Ga0395901_0016093
833 Ga0395901_0036744
834 Ga0395901_0052695
835 Ga0395901_0170757
836 Ga0436365_0091439
837 Ga0466961_0014324
838 Ga0466961_0100067
839 Ga0466961_0166080
840 Ga0466963_0023805
841 Ga0466963_0130271
842 Ga0466963_0206214
843 Ga0466971_0047045
844 Ga0466970_0072046
845 Ga0466959_0137871
846 Ga0466959_0200421
847 Ga0466967_0020235
848 Ga0466967_0044878
849 Ga0466967_0165756
850 Ga0466967_0253727
851 Ga0495598_0002075
852 Ga0495621_0001761
853 Ga0495621_0002840
854 Ga0495633_0001891
855 Ga0495633_0029167
856 Ga0495659_0095458
857 Ga0495669_0004464
858 Ga0495669_0006395
859 Ga0495670_0004419
860 Ga0495670_0007596
861 Ga0495677_0017550
862 Ga0496100_0029687
863 Ga0496101_0054673
864 Ga0496101_0178621
865 Ga0496102_0400337
866 Ga0496105_0040176
867 Ga0496107_0064023
868 Ga0496107_0332704
869 Ga0496108_0021027
870 Ga0496108_0026053
871 Ga0496108_0090272
872 Ga0496109_0047272
873 Ga0496109_0079286
874 Ga0496110_0014555
875 Ga0496111_0007186
876 Ga0496111_0235184
877 Ga0496112_0032149
878 Ga0496112_0075065
879 Ga0496112_0112085
880 Ga0496113_0235756
881 Ga0496114_0000023
882 Ga0496114_0084802
883 nmdc:mga06r32_497427_c1
884 nmdc:mga0a205_2631_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

91

268

0.84

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

97

349

0.82

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

97

356

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.906 59 354
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.9002 59 354
1xrr-assembly1.cif.gz_A crystal structure of active site f1-mutant e245q soaked with peptide pro-pro 0.8941 60 354
1xrr-assembly1.cif.gz_A crystal structure of active site f1-mutant e245q soaked with peptide pro-pro 0.8883 60 354
1xqx-assembly1.cif.gz_A crystal structure of f1-mutant s105a complex with pck 0.8845 60 354
ID Description Score Start End Superfamily
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9187 74 354 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.901 59 354 3.40.50.1820
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8998 74 354 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8953 59 354 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8834 60 354 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A358SMY2-F1-model_v4 Proline iminopeptidase 0.9859 117 353 GO:0006508
GO:0008233
GO:0016020
AF-A0A524BIX1-F1-model_v4 Proline iminopeptidase 0.9827 60 352 GO:0004177
GO:0006508
AF-A0A350BVS3-F1-model_v4 Proline iminopeptidase 0.9809 63 353 GO:0004177
GO:0006508
GO:0016020
AF-A0A6P0LQ24-F1-model_v4 Proline iminopeptidase-family hydrolase 0.9807 63 353 GO:0006508
GO:0008233
GO:0016020
AF-A0A7Y9L6W5-F1-model_v4 Proline iminopeptidase (EC 3.4.11.5) 0.9769 106 353 GO:0004177
GO:0006508
GO:0016020

Map