F444883

General Info

Members Datasets Scaffolds Average Seq Length
442 316 884 345

Family's Representative Sequence

Representative Sequence 3300023557|Ga0247521_102428|Ga0247521_1024282
Length 412
Sequence MARASYLPAGSCLARDSNSKPRISFLTGEISGTAVSVSLKVSATRSVYKGVRCAVAEGFRETLGVSNSARPPRRVVGRGSKLIGSGSAVPKLVVSNHDLSKLVDTSDEWISSRTGIHNRRILSGDETLTGLAVESSRKALEMAKVKPEDVDLVLMCTSTPDDLFGSAPQVQREVGCIKALAFDITAACSGFVLGLVTATRFIKGGGFENVLVIGADALSRYVDWTDRGSCILFGDAAGAVLLQAAKGDQDGLLGFDLQSDGHGQKHLSVPAMGEGAVKDLGSSNGAALKPPKPPSPSCIQMNGKEVFRFAVSRVPQVIEAAMEEAGMTGSHLDWLLLHQANQRIISAVADRLQIQPDRVITNLADYGNTSAASIPLALDEAVRSGRVQSGHVIATAGFGAGVTWGSAIVRWG

Samples

Sample ID Description Type Environment
1 3300023557 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300023558 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
104 3300023559 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
105 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
107 3300023664 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
108 3300023666 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
109 3300023686 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
110 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
111 3300023690 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
178 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
179 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
180 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
181 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
182 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
183 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
184 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
185 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
186 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
187 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
202 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
203 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
204 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
205 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
206 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
210 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
214 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
215 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
285 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
286 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
287 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
288 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
289 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
290 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
291 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
292 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
297 2643221559 Lysobacter sp. Root559 Isolate Unclassified
298 2643221586 Lysobacter sp. Root667 Isolate Unclassified
299 2643221612 Lysobacter sp. Root76 Isolate Unclassified
300 2643221727 Lysobacter sp. Root96 Isolate Unclassified
301 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
302 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
303 2831426010 Nostoc sp. 106C Isolate Unclassified
304 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
305 2849660919 Nostoc sp. T09 Isolate Unclassified
306 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
307 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
308 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
309 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
310 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
311 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
312 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
313 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
314 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
315 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
316 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.97
Metatranscriptomes 9.28
Isolates 4.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.05
Nodule 0
Rhizoplane 2.71
Rhizosphere 77.38
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0247521_102428 3300023557 Eukaryota 1807
2 CNXas_1000044 3300000545 Bacteria 25498
3 Ga0006556J51387_1008026 3300003479 Eukaryota 2055
4 Ga0006557J51388_1009583 3300003556 Eukaryota 1907
5 Ga0006558J51389_1009412 3300003558 Eukaryota 1902
6 Ga0006559J51393_1008410 3300003560 Eukaryota 1793
7 Ga0006553J51392_1008836 3300003561 Eukaryota 2012
8 Ga0006555J51386_1007989 3300003564 Eukaryota 1989
9 Ga0006560J51390_1007647 3300003565 Eukaryota 1984
10 Ga0006554J51385_1009443 3300003567 Eukaryota 1989
11 Ga0055526_1000139 3300003771 Bacteria 63930
12 Ga0055537_1000323 3300003773 Bacteria 32553
13 Ga0055524_1000206 3300003775 Bacteria 63929
14 Ga0055536_1010500 3300003781 Bacteria 3664
15 Ga0055536_1024279 3300003781 Bacteria 1759
16 Ga0055534_1000164 3300003784 Bacteria 49529
17 Ga0055528_1000027 3300003790 Bacteria 126420
18 Ga0055530_10002126 3300003791 Bacteria 13171
19 Ga0055531_10027513 3300003794 Bacteria 1992
20 Ga0065704_10093059 3300005289 Bacteria 2619
21 Ga0065712_10002445 3300005290 Bacteria 14340
22 Ga0065712_10008386 3300005290 Bacteria 4566
23 Ga0065712_10073891 3300005290 Bacteria 4240
24 Ga0065715_10093300 3300005293 Bacteria 4722
25 Ga0065715_10095718 3300005293 Bacteria 4020
26 Ga0070676_10001086 3300005328 Bacteria 13565
27 Ga0070683_100051689 3300005329 Unclassified 3805
28 Ga0070690_100002450 3300005330 Bacteria 9970
29 Ga0070670_100003606 3300005331 Bacteria 12883
30 Ga0070677_10036264 3300005333 Bacteria 1917
31 Ga0068869_100001581 3300005334 Bacteria 13529
32 Ga0068869_100121006 3300005334 Bacteria 2002
33 Ga0070687_100003779 3300005343 Bacteria 5935
34 Ga0070668_100007403 3300005347 Bacteria 8148
35 Ga0070668_100017122 3300005347 Bacteria 5424
36 Ga0070668_100106596 3300005347 Bacteria 2227
37 Ga0070675_100012863 3300005354 Bacteria 6567
38 Ga0070675_100050966 3300005354 Bacteria 3400
39 Ga0070671_100012120 3300005355 Bacteria 6938
40 Ga0070671_100027910 3300005355 Bacteria 4647
41 Ga0070674_100118598 3300005356 Bacteria 1956
42 Ga0070688_100020612 3300005365 Bacteria 3835
43 Ga0070688_100023805 3300005365 Bacteria 3607
44 Ga0070688_100045655 3300005365 Unclassified 2708
45 Ga0070667_100079715 3300005367 Bacteria 2800
46 Ga0070667_100150292 3300005367 Bacteria 2045
47 Ga0070705_100035863 3300005440 Bacteria 2783
48 Ga0070700_100045207 3300005441 Bacteria 2716
49 Ga0070700_100062722 3300005441 Bacteria 2349
50 Ga0070708_100360859 3300005445 Bacteria 1369
51 Ga0070663_100042850 3300005455 Unclassified 3182
52 Ga0070678_100001954 3300005456 Bacteria 11123
53 Ga0070662_100003178 3300005457 Bacteria 10209
54 Ga0070662_100272463 3300005457 Bacteria 1367
55 Ga0070681_10004545 3300005458 Bacteria 13231
56 Ga0070685_10174288 3300005466 Unclassified 1380
57 Ga0070707_100000171 3300005468 Bacteria 63131
58 Ga0070698_100042279 3300005471 Bacteria 4674
59 Ga0070699_100000001 3300005518 Bacteria 910751
60 Ga0070699_100003796 3300005518 Bacteria 13351
61 Ga0070684_100041405 3300005535 Unclassified 3971
62 Ga0070684_100124091 3300005535 Bacteria 2325
63 Ga0070697_100003525 3300005536 Bacteria 12025
64 Ga0070697_100136996 3300005536 Bacteria 2056
65 Ga0068853_100001596 3300005539 Bacteria 16510
66 Ga0068853_100004286 3300005539 Bacteria 11028
67 Ga0068853_100012186 3300005539 Bacteria 6993
68 Ga0068853_100038105 3300005539 Bacteria 4093
69 Ga0070672_100004775 3300005543 Bacteria 8895
70 Ga0070686_100004267 3300005544 Bacteria 7876
71 Ga0070695_100000847 3300005545 Bacteria 16475
72 Ga0070695_100105698 3300005545 Bacteria 1903
73 Ga0070665_100006223 3300005548 Bacteria 12210
74 Ga0070665_100013925 3300005548 Bacteria 8089
75 Ga0070665_100019004 3300005548 Bacteria 6893
76 Ga0068855_100007250 3300005563 Bacteria 13444
77 Ga0068855_100008679 3300005563 Bacteria 12283
78 Ga0068855_100019508 3300005563 Bacteria 8148
79 Ga0070664_100002579 3300005564 Bacteria 14610
80 Ga0070664_100230895 3300005564 Bacteria 1658
81 Ga0068857_100011412 3300005577 Bacteria 7729
82 Ga0068857_100021794 3300005577 Bacteria 5639
83 Ga0068857_100127513 3300005577 Bacteria 2293
84 Ga0068854_100001843 3300005578 Bacteria 12908
85 Ga0068856_100405079 3300005614 Bacteria 1384
86 Ga0070702_100007441 3300005615 Bacteria 5243
87 Ga0068852_100193989 3300005616 Bacteria 1918
88 Ga0068859_100001385 3300005617 Bacteria 24659
89 Ga0068859_100130355 3300005617 Bacteria 2586
90 Ga0068864_100002706 3300005618 Bacteria 14596
91 Ga0068861_100003967 3300005719 Bacteria 9910
92 Ga0068861_100007395 3300005719 Bacteria 7525
93 Ga0068851_10028635 3300005834 Bacteria 2753
94 Ga0068870_10016276 3300005840 Bacteria 3549
95 Ga0068863_100002900 3300005841 Bacteria 16987
96 Ga0068858_100013341 3300005842 Bacteria 7751
97 Ga0068862_100001203 3300005844 Bacteria 24415
98 Ga0068862_100005947 3300005844 Bacteria 10162
99 Ga0081455_10061976 3300005937 Unclassified 3145
100 Ga0070717_10324949 3300006028 Bacteria 1371
101 Ga0070712_100097433 3300006175 Bacteria 2168
102 Ga0097621_100028941 3300006237 Bacteria 4372
103 Ga0068871_100004526 3300006358 Bacteria 9687
104 Ga0075428_100001185 3300006844 Bacteria 27884
105 Ga0075428_100008978 3300006844 Bacteria 11090
106 Ga0075428_100009895 3300006844 Bacteria 10592
107 Ga0075428_100072914 3300006844 Bacteria 3749
108 Ga0075430_100006120 3300006846 Bacteria 10139
109 Ga0075430_100034376 3300006846 Bacteria 4302
110 Ga0075431_100000750 3300006847 Bacteria 28064
111 Ga0075431_100008704 3300006847 Bacteria 10168
112 Ga0075431_100031906 3300006847 Bacteria 5427
113 Ga0075431_100467538 3300006847 Bacteria 1255
114 Ga0075433_10044596 3300006852 Bacteria 3853
115 Ga0075433_10095199 3300006852 Bacteria 2635
116 Ga0075429_100000349 3300006880 Bacteria 33711
117 Ga0075429_100042990 3300006880 Bacteria 3931
118 Ga0068865_100033165 3300006881 Bacteria 3455
119 Ga0075436_100085478 3300006914 Bacteria 2190
120 Ga0097620_100001385 3300006931 Bacteria 24659
121 Ga0075435_100015751 3300007076 Bacteria 5688
122 Ga0075435_100079764 3300007076 Bacteria 2687
123 Ga0105240_10001096 3300009093 Bacteria 47799
124 Ga0105240_10010195 3300009093 Bacteria 13225
125 Ga0111539_10002071 3300009094 Bacteria 26801
126 Ga0111539_10018524 3300009094 Bacteria 8625
127 Ga0111539_10440752 3300009094 Bacteria 1517
128 Ga0114129_10000858 3300009147 Bacteria 39460
129 Ga0114129_10291199 3300009147 Bacteria 2179
130 Ga0114129_10638738 3300009147 Bacteria 1375
131 Ga0105241_10004002 3300009174 Bacteria 10894
132 Ga0105237_10010561 3300009545 Bacteria 9813
133 Ga0105237_10055478 3300009545 Bacteria 3968
134 Ga0105238_10037163 3300009551 Bacteria 4951
135 Ga0105249_10005307 3300009553 Bacteria 11128
136 Ga0105249_10372794 3300009553 Bacteria 1451
137 Ga0105239_10006916 3300010375 Bacteria 13082
138 Ga0105239_10009711 3300010375 Bacteria 10819
139 Ga0105239_10031067 3300010375 Bacteria 5875
140 Ga0157327_1000709 3300012512 Bacteria 1878
141 Ga0157374_10023292 3300013296 Bacteria 5537
142 Ga0157374_10102742 3300013296 Bacteria 2742
143 Ga0157378_10502655 3300013297 Unclassified 1211
144 Ga0163162_10035500 3300013306 Bacteria 4967
145 Ga0157372_10006976 3300013307 Bacteria 12029
146 Ga0157375_10011938 3300013308 Bacteria 7687
147 Ga0157375_10154518 3300013308 Bacteria 2432
148 Ga0157375_10302179 3300013308 Bacteria 1764
149 Ga0163163_10006694 3300014325 Bacteria 10097
150 Ga0163163_10211881 3300014325 Bacteria 1987
151 Ga0157380_10060516 3300014326 Bacteria 3026
152 Ga0157377_10015685 3300014745 Bacteria 3882
153 Ga0157376_10025657 3300014969 Bacteria 4644
154 Ga0183360_10001 3300015689 Bacteria 3943671
155 Ga0213874_10033112 3300021377 Unclassified 1505
156 Ga0224712_10095147 3300022467 Bacteria 1254
157 Ga0247526_102359 3300023558 Eukaryota 1791
158 Ga0247529_102472 3300023559 Eukaryota 1767
159 Ga0247514_102247 3300023560 Eukaryota 2186
160 Ga0247515_102286 3300023564 Eukaryota 2068
161 Ga0247527_101528 3300023664 Eukaryota 1868
162 Ga0247531_102474 3300023666 Eukaryota 1714
163 Ga0247520_102498 3300023686 Eukaryota 1784
164 Ga0247522_102013 3300023688 Eukaryota 1984
165 Ga0247512_102344 3300023690 Eukaryota 2104
166 Ga0207425_1012732 3300025245 Bacteria 1962
167 Ga0209565_1000005 3300025263 Bacteria 947317
168 Ga0209565_1006619 3300025263 Bacteria 3227
169 Ga0209673_1000011 3300025273 Bacteria 586604
170 Ga0209673_1020749 3300025273 Bacteria 2318
171 Ga0209130_1003427 3300025284 Bacteria 6746
172 Ga0209675_1000004 3300025291 Bacteria 947166
173 Ga0209675_1005689 3300025291 Bacteria 5151
174 Ga0209676_1003555 3300025292 Bacteria 9429
175 Ga0209676_1009125 3300025292 Bacteria 4320
176 Ga0209676_1010841 3300025292 Bacteria 3743
177 Ga0209676_1011964 3300025292 Bacteria 3452
178 Ga0209676_1013072 3300025292 Bacteria 3213
179 Ga0209025_1003425 3300025294 Bacteria 15046
180 Ga0209564_1000018 3300025295 Bacteria 586913
181 Ga0209564_1016184 3300025295 Bacteria 2985
182 Ga0209758_1034652 3300025297 Bacteria 2004
183 Ga0209050_1001755 3300025298 Bacteria 21513
184 Ga0209256_1000031 3300025299 Bacteria 410189
185 Ga0209051_1007495 3300025303 Bacteria 5955
186 Ga0209257_1000133 3300025304 Bacteria 208808
187 Ga0209257_1012447 3300025304 Bacteria 3930
188 Ga0209257_1015927 3300025304 Bacteria 3081
189 Ga0207656_10130607 3300025321 Bacteria 1176
190 Ga0207682_10063820 3300025893 Bacteria 1547
191 Ga0207688_10139206 3300025901 Bacteria 1427
192 Ga0207647_10004927 3300025904 Bacteria 9842
193 Ga0207645_10016397 3300025907 Bacteria 4904
194 Ga0207643_10028245 3300025908 Bacteria 3115
195 Ga0207643_10054908 3300025908 Bacteria 2265
196 Ga0207654_10017024 3300025911 Bacteria 3794
197 Ga0207707_10005634 3300025912 Bacteria 10958
198 Ga0207695_10002812 3300025913 Bacteria 25307
199 Ga0207695_10006159 3300025913 Bacteria 15639
200 Ga0207671_10000306 3300025914 Bacteria 72328
201 Ga0207693_10046943 3300025915 Bacteria 3394
202 Ga0207662_10004639 3300025918 Bacteria 7250
203 Ga0207649_10084810 3300025920 Bacteria 2060
204 Ga0207652_10246758 3300025921 Bacteria 1610
205 Ga0207681_10128315 3300025923 Bacteria 1871
206 Ga0207694_10001441 3300025924 Bacteria 20398
207 Ga0207650_10020979 3300025925 Bacteria 4615
208 Ga0207659_10003806 3300025926 Bacteria 9101
209 Ga0207659_10062209 3300025926 Bacteria 2693
210 Ga0207644_10114778 3300025931 Bacteria 2041
211 Ga0207706_10001632 3300025933 Bacteria 22248
212 Ga0207706_10026020 3300025933 Bacteria 5239
213 Ga0207670_10004668 3300025936 Bacteria 7428
214 Ga0207669_10081265 3300025937 Bacteria 2076
215 Ga0207704_10032140 3300025938 Bacteria 2966
216 Ga0207691_10001228 3300025940 Bacteria 25540
217 Ga0207689_10046128 3300025942 Bacteria 3603
218 Ga0207679_10004208 3300025945 Bacteria 8942
219 Ga0207679_10150314 3300025945 Bacteria 1894
220 Ga0207667_10033438 3300025949 Bacteria 5528
221 Ga0207667_10062542 3300025949 Bacteria 3892
222 Ga0207667_10066638 3300025949 Bacteria 3753
223 Ga0207712_10038576 3300025961 Bacteria 3267
224 Ga0207712_10078644 3300025961 Bacteria 2394
225 Ga0207668_10003583 3300025972 Bacteria 9124
226 Ga0207640_10001163 3300025981 Bacteria 14437
227 Ga0207658_10221067 3300025986 Bacteria 1593
228 Ga0207677_10116668 3300026023 Bacteria 1999
229 Ga0207703_10057624 3300026035 Bacteria 3169
230 Ga0207639_10003961 3300026041 Bacteria 9993
231 Ga0207639_10007307 3300026041 Bacteria 7525
232 Ga0207678_10021399 3300026067 Bacteria 5671
233 Ga0207678_10153596 3300026067 Bacteria 1965
234 Ga0207708_10067231 3300026075 Bacteria 2741
235 Ga0207702_10041180 3300026078 Bacteria 3873
236 Ga0207641_10035486 3300026088 Bacteria 4155
237 Ga0207641_10044935 3300026088 Bacteria 3716
238 Ga0207641_10143043 3300026088 Bacteria 2160
239 Ga0207648_10007563 3300026089 Bacteria 10661
240 Ga0207676_10087515 3300026095 Bacteria 2548
241 Ga0207674_10012741 3300026116 Bacteria 9394
242 Ga0207674_10013727 3300026116 Bacteria 8967
243 Ga0207674_10125524 3300026116 Bacteria 2532
244 Ga0207675_100000471 3300026118 Bacteria 39106
245 Ga0207675_100084015 3300026118 Bacteria 2987
246 Ga0207675_100088130 3300026118 Bacteria 2915
247 Ga0207683_10011311 3300026121 Bacteria 7611
248 Ga0207428_10157116 3300027907 Bacteria 1729
249 Ga0268266_10004242 3300028379 Bacteria 13784
250 Ga0268266_10251401 3300028379 Bacteria 1635
251 Ga0268265_10002199 3300028380 Bacteria 15038
252 Ga0268264_10021416 3300028381 Bacteria 5279
253 Ga0265338_10084080 3300028800 Bacteria 2658
254 Ga0265320_10028170 3300031240 Unclassified 2920
255 Ga0265316_10051614 3300031344 Bacteria 3230
256 Ga0307513_10089975 3300031456 Bacteria 3132
257 Ga0307408_100205147 3300031548 Bacteria 1598
258 Ga0310103_103038 3300031614 Eukaryota 2083
259 Ga0310113_103444 3300031636 Eukaryota 1740
260 Ga0316575_10040413 3300031665 Bacteria 1843
261 Ga0316575_10066482 3300031665 Bacteria 1444
262 Ga0310105_103332 3300031666 Eukaryota 1799
263 Ga0310119_103916 3300031686 Eukaryota 1815
264 Ga0310101_102362 3300031690 Eukaryota 2153
265 Ga0316577_10006299 3300031733 Bacteria 6261
266 Ga0316044_103248 3300031810 Eukaryota 1991
267 Ga0316045_103334 3300031815 Eukaryota 1956
268 Ga0316042_104212 3300031816 Eukaryota 2043
269 Ga0316043_103757 3300031828 Eukaryota 2121
270 Ga0307410_10241972 3300031852 Bacteria 1399
271 Ga0307416_100498554 3300032002 Bacteria 1281
272 Ga0307414_10002326 3300032004 Bacteria 9926
273 Ga0316592_1003361 3300033524 Bacteria 2877
274 Ga0373945_0074952 3300035116 Bacteria 1287
275 Ga0373956_0000138 3300035119 Bacteria 26073
276 Ga0373946_0002231 3300035171 Bacteria 6836
277 Ga0373931_0055249 3300035691 Bacteria 2124
278 Ga0373935_0106405 3300035692 Bacteria 1856
279 Ga0373935_0265248 3300035692 Bacteria 1205
280 Ga0373927_0014528 3300035695 Bacteria 5210
281 Ga0373927_0238548 3300035695 Bacteria 1195
282 Ga0373947_0001579 3300035725 Bacteria 13968
283 Ga0310104_01872 3300036242 Eukaryota 1753
284 Ga0373937_0117468 3300036401 Bacteria 2477
285 Ga0310112_003458 3300036458 Eukaryota 2078
286 Ga0372808_006032 3300036459 Eukaryota 1621
287 Ga0310109_002246 3300036534 Eukaryota 2131
288 Ga0310110_004732 3300036535 Eukaryota 1925
289 Ga0310110_005276 3300036535 Eukaryota 1852
290 Ga0316582_0002556 3300036647 Bacteria 8610
291 Ga0316584_0016493 3300036712 Bacteria 5295
292 Ga0373925_0000183 3300037068 Bacteria 68921
293 Ga0373925_0016275 3300037068 Bacteria 5383
294 Ga0373925_0155200 3300037068 Bacteria 1800
295 Ga0395900_0104483 3300037418 Bacteria 2910
296 Ga0316581_0006233 3300037588 Bacteria 3147
297 Ga0439447_001592 3300041407 Bacteria 8309
298 Ga0451807_0517856 3300041486 Bacteria 4827
299 Ga0451807_1244457 3300041486 Bacteria 1955
300 Ga0451837_0602140 3300041494 Bacteria 3506
301 Ga0451846_52639 3300041502 Eukaryota 1623
302 Ga0451848_09797 3300041504 Eukaryota 1705
303 Ga0451850_58294 3300041506 Eukaryota 1683
304 Ga0439432_046728 3300042006 Bacteria 1359
305 Ga0451577_0000229 3300042876 Bacteria 114275
306 Ga0451577_0015360 3300042876 Bacteria 7124
307 Ga0451577_0262316 3300042876 Bacteria 1564
308 Ga0466972_0007169 3300044658 Bacteria 5598
309 Ga0453683_0000007 3300044673 Bacteria 581341
310 Ga0453683_0000165 3300044673 Bacteria 94483
311 Ga0453683_0020992 3300044673 Bacteria 4170
312 Ga0453684_0000740 3300044712 Bacteria 114275
313 Ga0453684_0000883 3300044712 Bacteria 100160
314 Ga0453684_0004226 3300044712 Bacteria 30795
315 Ga0453684_0007705 3300044712 Bacteria 19672
316 Ga0453684_0015820 3300044712 Bacteria 11862
317 Ga0453684_0016330 3300044712 Bacteria 11622
318 Ga0453684_0051326 3300044712 Bacteria 5409
319 Ga0453684_0088437 3300044712 Bacteria 3836
320 Ga0453684_0307908 3300044712 Bacteria 1799
321 Ga0451576_0016474 3300045051 Bacteria 8158
322 Ga0451576_0018371 3300045051 Bacteria 7667
323 Ga0451576_0087831 3300045051 Bacteria 3234
324 Ga0451576_0211282 3300045051 Bacteria 2026
325 Ga0451576_0385839 3300045051 Bacteria 1468
326 Ga0495629_0025311 3300046459 Bacteria 4220
327 Ga0495639_0000842 3300046475 Bacteria 13990
328 Ga0495628_0006373 3300046516 Bacteria 10314
329 Ga0495630_0007958 3300046517 Bacteria 7609
330 Ga0495666_0000024 3300046526 Bacteria 57339
331 Ga0495586_0001169 3300046535 Bacteria 14718
332 Ga0495586_0145809 3300046535 Bacteria 1330
333 Ga0495621_0017978 3300046539 Bacteria 2292
334 Ga0495622_0040730 3300046557 Bacteria 2161
335 Ga0495668_0015855 3300046616 Bacteria 4390
336 Ga0495658_0014155 3300046683 Bacteria 4069
337 Ga0495636_0005386 3300047318 Bacteria 5027
338 Ga0495636_0010202 3300047318 Bacteria 3706
339 Ga0495676_0001542 3300047321 Bacteria 19955
340 Ga0495686_0082419 3300047472 Bacteria 1963
341 Ga0496102_0079813 3300048905 Bacteria 3014
342 Ga0496106_0006799 3300048909 Bacteria 8466
343 Ga0496106_0041646 3300048909 Bacteria 3442
344 Ga0496107_0234227 3300048910 Bacteria 1366
345 Ga0496108_0032361 3300048911 Bacteria 4344
346 Ga0496109_0147625 3300048912 Bacteria 2200
347 Ga0496110_0079115 3300048913 Bacteria 2926
348 Ga0496111_0027319 3300048914 Bacteria 4035
349 Ga0496111_0100751 3300048914 Bacteria 2122
350 Ga0496113_0016016 3300048916 Bacteria 5172
351 Ga0496121_0006877 3300048924 Bacteria 13903
352 Ga0496125_0000148 3300048928 Bacteria 154612
353 Ga0501299_002041 3300049522 Bacteria 2747
354 Ga0501031_0001795 3300049568 Bacteria 13467
355 Ga0501031_0041255 3300049568 Bacteria 3014
356 Ga0501032_0010175 3300049569 Bacteria 6789
357 Ga0501032_0162106 3300049569 Bacteria 1468
358 Ga0501033_0005319 3300049570 Bacteria 10199
359 Ga0501034_0003437 3300049571 Bacteria 18085
360 Ga0501036_0014061 3300049572 Bacteria 6651
361 Ga0501037_0013333 3300049573 Bacteria 6057
362 Ga0501038_0001131 3300049574 Bacteria 24190
363 Ga0501039_0015074 3300049575 Bacteria 5912
364 Ga0501039_0026902 3300049575 Bacteria 4422
365 Ga0501039_0374585 3300049575 Bacteria 1118
366 Ga0501041_0066037 3300049577 Bacteria 2216
367 Ga0501043_0069812 3300049579 Bacteria 2760
368 Ga0501046_0008828 3300049580 Bacteria 8754
369 Ga0501046_0028174 3300049580 Bacteria 4578
370 Ga0501047_0003649 3300049581 Bacteria 14507
371 Ga0501048_0023137 3300049582 Bacteria 4543
372 Ga0501048_0039668 3300049582 Bacteria 3377
373 Ga0501067_0109441 3300049583 Bacteria 1536
374 Ga0501068_0160518 3300049584 Bacteria 1417
375 Ga0501071_0013447 3300049587 Bacteria 5578
376 Ga0501072_0005884 3300049588 Bacteria 9341
377 Ga0501073_0003923 3300049589 Bacteria 11163
378 Ga0501074_0033912 3300049590 Bacteria 3701
379 Ga0501075_0002964 3300049591 Bacteria 11361
380 Ga0501076_0046881 3300049592 Bacteria 3415
381 Ga0501077_0003882 3300049593 Bacteria 9003
382 Ga0501079_0016111 3300049741 Bacteria 5712
383 Ga0501080_0028217 3300049742 Bacteria 5220
384 Ga0501080_0393059 3300049742 Bacteria 1248
385 Ga0501081_0158981 3300049743 Bacteria 1627
386 Ga0501083_0002867 3300049744 Bacteria 11931
387 Ga0501083_0118398 3300049744 Bacteria 1738
388 Ga0501035_0002271 3300049822 Bacteria 18986
389 Ga0501035_0051513 3300049822 Bacteria 3686
390 Ga0501044_0002762 3300049823 Bacteria 19988
391 Ga0501045_0000657 3300049824 Bacteria 21947
392 nmdc:mga05p37_41251_c1 3300050507 Bacteria 5667
393 nmdc:mga05p37_52965_c1 3300050507 Bacteria 4991
394 nmdc:mga09592_13658_c1 3300050508 Bacteria 6637
395 nmdc:mga09592_13853_c1 3300050508 Bacteria 6589
396 nmdc:mga0qj67_119996_c1 3300050509 Bacteria 2126
397 nmdc:mga0qj67_4242_c1 3300050509 Bacteria 10385
398 nmdc:mga06r32_2630_c1 3300050510 Bacteria 16035
399 nmdc:mga06r32_598_c1 3300050510 Bacteria 31407
400 nmdc:mga08y16_18298_c1 3300050511 Bacteria 7382
401 nmdc:mga08y16_232070_c1 3300050511 Bacteria 1909
402 nmdc:mga08y16_43000_c1 3300050511 Bacteria 4732
403 nmdc:mga08y16_5133_c1 3300050511 Bacteria 13688
404 nmdc:mga0n895_20553_c1 3300050512 Bacteria 6159
405 nmdc:mga0rr50_11633_c1 3300050513 Bacteria 5643
406 nmdc:mga0rr50_74803_c1 3300050513 Bacteria 2594
407 nmdc:mga08x19_58808_c1 3300050514 Bacteria 2487
408 nmdc:mga0a205_111482_c1 3300050515 Bacteria 2635
409 nmdc:mga0a205_14656_c1 3300050515 Bacteria 7314
410 Ga0500610_0000500 3300053079 Bacteria 12074
411 Ga0500583_0003712 3300053092 Bacteria 4864
412 Ga0500641_0024258 3300053096 Unclassified 2337
413 Ga0500553_066267 3300053101 Bacteria 1674
414 Ga0500556_0071016 3300053104 Bacteria 1300
415 Ga0500617_064669 3300053124 Bacteria 1613
416 Ga0500577_0024112 3300053142 Bacteria 2042
417 Ga0500637_0061225 3300053178 Bacteria 2156
418 Ga0587073_0007282 3300059492 Eukaryota 1742
419 Ga0587080_004854 3300059503 Eukaryota 1774
420 Ga0587109_010097 3300059624 Eukaryota 1499
421 Ga0530510_0010435 3300061734 Bacteria 6513
422 2617918271 2617270889 Bacteria 9064343
423 2643818718 2643221559 Bacteria 4424915
424 2643940969 2643221586 Bacteria 4446529
425 2644079989 2643221612 Bacteria 4361984
426 2644695584 2643221727 Bacteria 4415595
427 2804849462 2802429296 Bacteria 7227771
428 2812365158 2811994880 Bacteria 4147780
429 2831431756 2831426010 Bacteria 8662725
430 2848696670 2848694841 Bacteria 9205737
431 2849666276 2849660919 Bacteria 8251853
432 2873156019 2873151551 Bacteria 8625867
433 2886633917 2886627955 Bacteria 7618130
434 2912729565 2912723979 Bacteria 8557534
435 2913848303 2913844669 Bacteria 8381711
436 2913912672 2913912277 Bacteria 9037797
437 2913941330 2913939268 Bacteria 8559644
438 2941493422 2941489479 Bacteria 6313767
439 2995952483 2995948881 Bacteria 6358104
440 642599434 642555144 Bacteria 9059191
441 8003016328 8003014200 Bacteria 4059994
442 8025414516 8025413630 Bacteria 7014048
443 Ga0247521_102428
444 CNXas_1000044
445 Ga0006556J51387_1008026
446 Ga0006557J51388_1009583
447 Ga0006558J51389_1009412
448 Ga0006559J51393_1008410
449 Ga0006553J51392_1008836
450 Ga0006555J51386_1007989
451 Ga0006560J51390_1007647
452 Ga0006554J51385_1009443
453 Ga0055526_1000139
454 Ga0055537_1000323
455 Ga0055524_1000206
456 Ga0055536_1010500
457 Ga0055536_1024279
458 Ga0055534_1000164
459 Ga0055528_1000027
460 Ga0055530_10002126
461 Ga0055531_10027513
462 Ga0065704_10093059
463 Ga0065712_10002445
464 Ga0065712_10008386
465 Ga0065712_10073891
466 Ga0065715_10093300
467 Ga0065715_10095718
468 Ga0070676_10001086
469 Ga0070683_100051689
470 Ga0070690_100002450
471 Ga0070670_100003606
472 Ga0070677_10036264
473 Ga0068869_100001581
474 Ga0068869_100121006
475 Ga0070687_100003779
476 Ga0070668_100007403
477 Ga0070668_100017122
478 Ga0070668_100106596
479 Ga0070675_100012863
480 Ga0070675_100050966
481 Ga0070671_100012120
482 Ga0070671_100027910
483 Ga0070674_100118598
484 Ga0070688_100020612
485 Ga0070688_100023805
486 Ga0070688_100045655
487 Ga0070667_100079715
488 Ga0070667_100150292
489 Ga0070705_100035863
490 Ga0070700_100045207
491 Ga0070700_100062722
492 Ga0070708_100360859
493 Ga0070663_100042850
494 Ga0070678_100001954
495 Ga0070662_100003178
496 Ga0070662_100272463
497 Ga0070681_10004545
498 Ga0070685_10174288
499 Ga0070707_100000171
500 Ga0070698_100042279
501 Ga0070699_100000001
502 Ga0070699_100003796
503 Ga0070684_100041405
504 Ga0070684_100124091
505 Ga0070697_100003525
506 Ga0070697_100136996
507 Ga0068853_100001596
508 Ga0068853_100004286
509 Ga0068853_100012186
510 Ga0068853_100038105
511 Ga0070672_100004775
512 Ga0070686_100004267
513 Ga0070695_100000847
514 Ga0070695_100105698
515 Ga0070665_100006223
516 Ga0070665_100013925
517 Ga0070665_100019004
518 Ga0068855_100007250
519 Ga0068855_100008679
520 Ga0068855_100019508
521 Ga0070664_100002579
522 Ga0070664_100230895
523 Ga0068857_100011412
524 Ga0068857_100021794
525 Ga0068857_100127513
526 Ga0068854_100001843
527 Ga0068856_100405079
528 Ga0070702_100007441
529 Ga0068852_100193989
530 Ga0068859_100001385
531 Ga0068859_100130355
532 Ga0068864_100002706
533 Ga0068861_100003967
534 Ga0068861_100007395
535 Ga0068851_10028635
536 Ga0068870_10016276
537 Ga0068863_100002900
538 Ga0068858_100013341
539 Ga0068862_100001203
540 Ga0068862_100005947
541 Ga0081455_10061976
542 Ga0070717_10324949
543 Ga0070712_100097433
544 Ga0097621_100028941
545 Ga0068871_100004526
546 Ga0075428_100001185
547 Ga0075428_100008978
548 Ga0075428_100009895
549 Ga0075428_100072914
550 Ga0075430_100006120
551 Ga0075430_100034376
552 Ga0075431_100000750
553 Ga0075431_100008704
554 Ga0075431_100031906
555 Ga0075431_100467538
556 Ga0075433_10044596
557 Ga0075433_10095199
558 Ga0075429_100000349
559 Ga0075429_100042990
560 Ga0068865_100033165
561 Ga0075436_100085478
562 Ga0097620_100001385
563 Ga0075435_100015751
564 Ga0075435_100079764
565 Ga0105240_10001096
566 Ga0105240_10010195
567 Ga0111539_10002071
568 Ga0111539_10018524
569 Ga0111539_10440752
570 Ga0114129_10000858
571 Ga0114129_10291199
572 Ga0114129_10638738
573 Ga0105241_10004002
574 Ga0105237_10010561
575 Ga0105237_10055478
576 Ga0105238_10037163
577 Ga0105249_10005307
578 Ga0105249_10372794
579 Ga0105239_10006916
580 Ga0105239_10009711
581 Ga0105239_10031067
582 Ga0157327_1000709
583 Ga0157374_10023292
584 Ga0157374_10102742
585 Ga0157378_10502655
586 Ga0163162_10035500
587 Ga0157372_10006976
588 Ga0157375_10011938
589 Ga0157375_10154518
590 Ga0157375_10302179
591 Ga0163163_10006694
592 Ga0163163_10211881
593 Ga0157380_10060516
594 Ga0157377_10015685
595 Ga0157376_10025657
596 Ga0183360_10001
597 Ga0213874_10033112
598 Ga0224712_10095147
599 Ga0247526_102359
600 Ga0247529_102472
601 Ga0247514_102247
602 Ga0247515_102286
603 Ga0247527_101528
604 Ga0247531_102474
605 Ga0247520_102498
606 Ga0247522_102013
607 Ga0247512_102344
608 Ga0207425_1012732
609 Ga0209565_1000005
610 Ga0209565_1006619
611 Ga0209673_1000011
612 Ga0209673_1020749
613 Ga0209130_1003427
614 Ga0209675_1000004
615 Ga0209675_1005689
616 Ga0209676_1003555
617 Ga0209676_1009125
618 Ga0209676_1010841
619 Ga0209676_1011964
620 Ga0209676_1013072
621 Ga0209025_1003425
622 Ga0209564_1000018
623 Ga0209564_1016184
624 Ga0209758_1034652
625 Ga0209050_1001755
626 Ga0209256_1000031
627 Ga0209051_1007495
628 Ga0209257_1000133
629 Ga0209257_1012447
630 Ga0209257_1015927
631 Ga0207656_10130607
632 Ga0207682_10063820
633 Ga0207688_10139206
634 Ga0207647_10004927
635 Ga0207645_10016397
636 Ga0207643_10028245
637 Ga0207643_10054908
638 Ga0207654_10017024
639 Ga0207707_10005634
640 Ga0207695_10002812
641 Ga0207695_10006159
642 Ga0207671_10000306
643 Ga0207693_10046943
644 Ga0207662_10004639
645 Ga0207649_10084810
646 Ga0207652_10246758
647 Ga0207681_10128315
648 Ga0207694_10001441
649 Ga0207650_10020979
650 Ga0207659_10003806
651 Ga0207659_10062209
652 Ga0207644_10114778
653 Ga0207706_10001632
654 Ga0207706_10026020
655 Ga0207670_10004668
656 Ga0207669_10081265
657 Ga0207704_10032140
658 Ga0207691_10001228
659 Ga0207689_10046128
660 Ga0207679_10004208
661 Ga0207679_10150314
662 Ga0207667_10033438
663 Ga0207667_10062542
664 Ga0207667_10066638
665 Ga0207712_10038576
666 Ga0207712_10078644
667 Ga0207668_10003583
668 Ga0207640_10001163
669 Ga0207658_10221067
670 Ga0207677_10116668
671 Ga0207703_10057624
672 Ga0207639_10003961
673 Ga0207639_10007307
674 Ga0207678_10021399
675 Ga0207678_10153596
676 Ga0207708_10067231
677 Ga0207702_10041180
678 Ga0207641_10035486
679 Ga0207641_10044935
680 Ga0207641_10143043
681 Ga0207648_10007563
682 Ga0207676_10087515
683 Ga0207674_10012741
684 Ga0207674_10013727
685 Ga0207674_10125524
686 Ga0207675_100000471
687 Ga0207675_100084015
688 Ga0207675_100088130
689 Ga0207683_10011311
690 Ga0207428_10157116
691 Ga0268266_10004242
692 Ga0268266_10251401
693 Ga0268265_10002199
694 Ga0268264_10021416
695 Ga0265338_10084080
696 Ga0265320_10028170
697 Ga0265316_10051614
698 Ga0307513_10089975
699 Ga0307408_100205147
700 Ga0310103_103038
701 Ga0310113_103444
702 Ga0316575_10040413
703 Ga0316575_10066482
704 Ga0310105_103332
705 Ga0310119_103916
706 Ga0310101_102362
707 Ga0316577_10006299
708 Ga0316044_103248
709 Ga0316045_103334
710 Ga0316042_104212
711 Ga0316043_103757
712 Ga0307410_10241972
713 Ga0307416_100498554
714 Ga0307414_10002326
715 Ga0316592_1003361
716 Ga0373945_0074952
717 Ga0373956_0000138
718 Ga0373946_0002231
719 Ga0373931_0055249
720 Ga0373935_0106405
721 Ga0373935_0265248
722 Ga0373927_0014528
723 Ga0373927_0238548
724 Ga0373947_0001579
725 Ga0310104_01872
726 Ga0373937_0117468
727 Ga0310112_003458
728 Ga0372808_006032
729 Ga0310109_002246
730 Ga0310110_004732
731 Ga0310110_005276
732 Ga0316582_0002556
733 Ga0316584_0016493
734 Ga0373925_0000183
735 Ga0373925_0016275
736 Ga0373925_0155200
737 Ga0395900_0104483
738 Ga0316581_0006233
739 Ga0439447_001592
740 Ga0451807_0517856
741 Ga0451807_1244457
742 Ga0451837_0602140
743 Ga0451846_52639
744 Ga0451848_09797
745 Ga0451850_58294
746 Ga0439432_046728
747 Ga0451577_0000229
748 Ga0451577_0015360
749 Ga0451577_0262316
750 Ga0466972_0007169
751 Ga0453683_0000007
752 Ga0453683_0000165
753 Ga0453683_0020992
754 Ga0453684_0000740
755 Ga0453684_0000883
756 Ga0453684_0004226
757 Ga0453684_0007705
758 Ga0453684_0015820
759 Ga0453684_0016330
760 Ga0453684_0051326
761 Ga0453684_0088437
762 Ga0453684_0307908
763 Ga0451576_0016474
764 Ga0451576_0018371
765 Ga0451576_0087831
766 Ga0451576_0211282
767 Ga0451576_0385839
768 Ga0495629_0025311
769 Ga0495639_0000842
770 Ga0495628_0006373
771 Ga0495630_0007958
772 Ga0495666_0000024
773 Ga0495586_0001169
774 Ga0495586_0145809
775 Ga0495621_0017978
776 Ga0495622_0040730
777 Ga0495668_0015855
778 Ga0495658_0014155
779 Ga0495636_0005386
780 Ga0495636_0010202
781 Ga0495676_0001542
782 Ga0495686_0082419
783 Ga0496102_0079813
784 Ga0496106_0006799
785 Ga0496106_0041646
786 Ga0496107_0234227
787 Ga0496108_0032361
788 Ga0496109_0147625
789 Ga0496110_0079115
790 Ga0496111_0027319
791 Ga0496111_0100751
792 Ga0496113_0016016
793 Ga0496121_0006877
794 Ga0496125_0000148
795 Ga0501299_002041
796 Ga0501031_0001795
797 Ga0501031_0041255
798 Ga0501032_0010175
799 Ga0501032_0162106
800 Ga0501033_0005319
801 Ga0501034_0003437
802 Ga0501036_0014061
803 Ga0501037_0013333
804 Ga0501038_0001131
805 Ga0501039_0015074
806 Ga0501039_0026902
807 Ga0501039_0374585
808 Ga0501041_0066037
809 Ga0501043_0069812
810 Ga0501046_0008828
811 Ga0501046_0028174
812 Ga0501047_0003649
813 Ga0501048_0023137
814 Ga0501048_0039668
815 Ga0501067_0109441
816 Ga0501068_0160518
817 Ga0501071_0013447
818 Ga0501072_0005884
819 Ga0501073_0003923
820 Ga0501074_0033912
821 Ga0501075_0002964
822 Ga0501076_0046881
823 Ga0501077_0003882
824 Ga0501079_0016111
825 Ga0501080_0028217
826 Ga0501080_0393059
827 Ga0501081_0158981
828 Ga0501083_0002867
829 Ga0501083_0118398
830 Ga0501035_0002271
831 Ga0501035_0051513
832 Ga0501044_0002762
833 Ga0501045_0000657
834 nmdc:mga05p37_41251_c1
835 nmdc:mga05p37_52965_c1
836 nmdc:mga09592_13658_c1
837 nmdc:mga09592_13853_c1
838 nmdc:mga0qj67_119996_c1
839 nmdc:mga0qj67_4242_c1
840 nmdc:mga06r32_2630_c1
841 nmdc:mga06r32_598_c1
842 nmdc:mga08y16_18298_c1
843 nmdc:mga08y16_232070_c1
844 nmdc:mga08y16_43000_c1
845 nmdc:mga08y16_5133_c1
846 nmdc:mga0n895_20553_c1
847 nmdc:mga0rr50_11633_c1
848 nmdc:mga0rr50_74803_c1
849 nmdc:mga08x19_58808_c1
850 nmdc:mga0a205_111482_c1
851 nmdc:mga0a205_14656_c1
852 Ga0500610_0000500
853 Ga0500583_0003712
854 Ga0500641_0024258
855 Ga0500553_066267
856 Ga0500556_0071016
857 Ga0500617_064669
858 Ga0500577_0024112
859 Ga0500637_0061225
860 Ga0587073_0007282
861 Ga0587080_004854
862 Ga0587109_010097
863 Ga0530510_0010435
864 2617918271
865 2643818718
866 2643940969
867 2644079989
868 2644695584
869 2804849462
870 2812365158
871 2831431756
872 2848696670
873 2849666276
874 2873156019
875 2886633917
876 2912729565
877 2913848303
878 2913912672
879 2913941330
880 2941493422
881 2995952483
882 642599434
883 8003016328
884 8025414516

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

322

411

0.99

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

182

261

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9868 18 340
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9856 17 340
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9838 17 340
4x9o-assembly1.cif.gz_B beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate 0.9834 17 340
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9816 17 340
ID Description Score Start End Superfamily
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9892 17 184 3.40.47.10
1zowB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.984 17 184 3.40.47.10
4x9oB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9834 17 340 3.40.47.10
3il4B01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9821 17 184 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9803 17 340 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A661PT68-F1-model_v4 3-oxoacyl-ACP synthase 0.9996 20 130 GO:0016746
GO:0044550
AF-A0A800M9R9-F1-model_v4 3-oxoacyl-ACP synthase 0.9989 19 169 GO:0004315
GO:0006633
GO:0044550
AF-A0A535AJN1-F1-model_v4 3-oxoacyl-ACP synthase 0.9953 15 174 GO:0004315
GO:0006633
GO:0044550
AF-A0A7X3RR09-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9951 16 340 GO:0004315
GO:0005737
GO:0006633
GO:0033818
AF-A0A3D1TF25-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9948 26 340 GO:0004315
GO:0005737
GO:0006633
GO:0033818
GO:0044550

Map