F444883
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 442 | 316 | 884 | 345 |
Family's Representative Sequence
| Representative Sequence | 3300023557|Ga0247521_102428|Ga0247521_1024282 |
| Length | 412 |
| Sequence | MARASYLPAGSCLARDSNSKPRISFLTGEISGTAVSVSLKVSATRSVYKGVRCAVAEGFRETLGVSNSARPPRRVVGRGSKLIGSGSAVPKLVVSNHDLSKLVDTSDEWISSRTGIHNRRILSGDETLTGLAVESSRKALEMAKVKPEDVDLVLMCTSTPDDLFGSAPQVQREVGCIKALAFDITAACSGFVLGLVTATRFIKGGGFENVLVIGADALSRYVDWTDRGSCILFGDAAGAVLLQAAKGDQDGLLGFDLQSDGHGQKHLSVPAMGEGAVKDLGSSNGAALKPPKPPSPSCIQMNGKEVFRFAVSRVPQVIEAAMEEAGMTGSHLDWLLLHQANQRIISAVADRLQIQPDRVITNLADYGNTSAASIPLALDEAVRSGRVQSGHVIATAGFGAGVTWGSAIVRWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300023557 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003556 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003560 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003561 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003564 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 101 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300023558 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 104 | 3300023559 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 105 | 3300023560 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 106 | 3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 107 | 3300023664 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 108 | 3300023666 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 109 | 3300023686 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 110 | 3300023688 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 111 | 3300023690 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 112 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 178 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 179 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 180 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 181 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 182 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 183 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 185 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 186 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 187 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 202 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 203 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 204 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 205 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 206 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 210 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 211 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 213 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 214 | 3300041504 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT | Metatranscriptome | Unclassified |
| 215 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 216 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 217 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 285 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 286 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 287 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 288 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 290 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 291 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 292 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 296 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 297 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 298 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 299 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 300 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 301 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 302 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 303 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 304 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 305 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 306 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 307 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 308 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 309 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 310 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 311 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 312 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 313 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 314 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 315 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 316 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.97 |
| Metatranscriptomes | 9.28 |
| Isolates | 4.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.05 |
| Nodule | 0 |
| Rhizoplane | 2.71 |
| Rhizosphere | 77.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0247521_102428 | 3300023557 | Eukaryota | 1807 |
| 2 | CNXas_1000044 | 3300000545 | Bacteria | 25498 |
| 3 | Ga0006556J51387_1008026 | 3300003479 | Eukaryota | 2055 |
| 4 | Ga0006557J51388_1009583 | 3300003556 | Eukaryota | 1907 |
| 5 | Ga0006558J51389_1009412 | 3300003558 | Eukaryota | 1902 |
| 6 | Ga0006559J51393_1008410 | 3300003560 | Eukaryota | 1793 |
| 7 | Ga0006553J51392_1008836 | 3300003561 | Eukaryota | 2012 |
| 8 | Ga0006555J51386_1007989 | 3300003564 | Eukaryota | 1989 |
| 9 | Ga0006560J51390_1007647 | 3300003565 | Eukaryota | 1984 |
| 10 | Ga0006554J51385_1009443 | 3300003567 | Eukaryota | 1989 |
| 11 | Ga0055526_1000139 | 3300003771 | Bacteria | 63930 |
| 12 | Ga0055537_1000323 | 3300003773 | Bacteria | 32553 |
| 13 | Ga0055524_1000206 | 3300003775 | Bacteria | 63929 |
| 14 | Ga0055536_1010500 | 3300003781 | Bacteria | 3664 |
| 15 | Ga0055536_1024279 | 3300003781 | Bacteria | 1759 |
| 16 | Ga0055534_1000164 | 3300003784 | Bacteria | 49529 |
| 17 | Ga0055528_1000027 | 3300003790 | Bacteria | 126420 |
| 18 | Ga0055530_10002126 | 3300003791 | Bacteria | 13171 |
| 19 | Ga0055531_10027513 | 3300003794 | Bacteria | 1992 |
| 20 | Ga0065704_10093059 | 3300005289 | Bacteria | 2619 |
| 21 | Ga0065712_10002445 | 3300005290 | Bacteria | 14340 |
| 22 | Ga0065712_10008386 | 3300005290 | Bacteria | 4566 |
| 23 | Ga0065712_10073891 | 3300005290 | Bacteria | 4240 |
| 24 | Ga0065715_10093300 | 3300005293 | Bacteria | 4722 |
| 25 | Ga0065715_10095718 | 3300005293 | Bacteria | 4020 |
| 26 | Ga0070676_10001086 | 3300005328 | Bacteria | 13565 |
| 27 | Ga0070683_100051689 | 3300005329 | Unclassified | 3805 |
| 28 | Ga0070690_100002450 | 3300005330 | Bacteria | 9970 |
| 29 | Ga0070670_100003606 | 3300005331 | Bacteria | 12883 |
| 30 | Ga0070677_10036264 | 3300005333 | Bacteria | 1917 |
| 31 | Ga0068869_100001581 | 3300005334 | Bacteria | 13529 |
| 32 | Ga0068869_100121006 | 3300005334 | Bacteria | 2002 |
| 33 | Ga0070687_100003779 | 3300005343 | Bacteria | 5935 |
| 34 | Ga0070668_100007403 | 3300005347 | Bacteria | 8148 |
| 35 | Ga0070668_100017122 | 3300005347 | Bacteria | 5424 |
| 36 | Ga0070668_100106596 | 3300005347 | Bacteria | 2227 |
| 37 | Ga0070675_100012863 | 3300005354 | Bacteria | 6567 |
| 38 | Ga0070675_100050966 | 3300005354 | Bacteria | 3400 |
| 39 | Ga0070671_100012120 | 3300005355 | Bacteria | 6938 |
| 40 | Ga0070671_100027910 | 3300005355 | Bacteria | 4647 |
| 41 | Ga0070674_100118598 | 3300005356 | Bacteria | 1956 |
| 42 | Ga0070688_100020612 | 3300005365 | Bacteria | 3835 |
| 43 | Ga0070688_100023805 | 3300005365 | Bacteria | 3607 |
| 44 | Ga0070688_100045655 | 3300005365 | Unclassified | 2708 |
| 45 | Ga0070667_100079715 | 3300005367 | Bacteria | 2800 |
| 46 | Ga0070667_100150292 | 3300005367 | Bacteria | 2045 |
| 47 | Ga0070705_100035863 | 3300005440 | Bacteria | 2783 |
| 48 | Ga0070700_100045207 | 3300005441 | Bacteria | 2716 |
| 49 | Ga0070700_100062722 | 3300005441 | Bacteria | 2349 |
| 50 | Ga0070708_100360859 | 3300005445 | Bacteria | 1369 |
| 51 | Ga0070663_100042850 | 3300005455 | Unclassified | 3182 |
| 52 | Ga0070678_100001954 | 3300005456 | Bacteria | 11123 |
| 53 | Ga0070662_100003178 | 3300005457 | Bacteria | 10209 |
| 54 | Ga0070662_100272463 | 3300005457 | Bacteria | 1367 |
| 55 | Ga0070681_10004545 | 3300005458 | Bacteria | 13231 |
| 56 | Ga0070685_10174288 | 3300005466 | Unclassified | 1380 |
| 57 | Ga0070707_100000171 | 3300005468 | Bacteria | 63131 |
| 58 | Ga0070698_100042279 | 3300005471 | Bacteria | 4674 |
| 59 | Ga0070699_100000001 | 3300005518 | Bacteria | 910751 |
| 60 | Ga0070699_100003796 | 3300005518 | Bacteria | 13351 |
| 61 | Ga0070684_100041405 | 3300005535 | Unclassified | 3971 |
| 62 | Ga0070684_100124091 | 3300005535 | Bacteria | 2325 |
| 63 | Ga0070697_100003525 | 3300005536 | Bacteria | 12025 |
| 64 | Ga0070697_100136996 | 3300005536 | Bacteria | 2056 |
| 65 | Ga0068853_100001596 | 3300005539 | Bacteria | 16510 |
| 66 | Ga0068853_100004286 | 3300005539 | Bacteria | 11028 |
| 67 | Ga0068853_100012186 | 3300005539 | Bacteria | 6993 |
| 68 | Ga0068853_100038105 | 3300005539 | Bacteria | 4093 |
| 69 | Ga0070672_100004775 | 3300005543 | Bacteria | 8895 |
| 70 | Ga0070686_100004267 | 3300005544 | Bacteria | 7876 |
| 71 | Ga0070695_100000847 | 3300005545 | Bacteria | 16475 |
| 72 | Ga0070695_100105698 | 3300005545 | Bacteria | 1903 |
| 73 | Ga0070665_100006223 | 3300005548 | Bacteria | 12210 |
| 74 | Ga0070665_100013925 | 3300005548 | Bacteria | 8089 |
| 75 | Ga0070665_100019004 | 3300005548 | Bacteria | 6893 |
| 76 | Ga0068855_100007250 | 3300005563 | Bacteria | 13444 |
| 77 | Ga0068855_100008679 | 3300005563 | Bacteria | 12283 |
| 78 | Ga0068855_100019508 | 3300005563 | Bacteria | 8148 |
| 79 | Ga0070664_100002579 | 3300005564 | Bacteria | 14610 |
| 80 | Ga0070664_100230895 | 3300005564 | Bacteria | 1658 |
| 81 | Ga0068857_100011412 | 3300005577 | Bacteria | 7729 |
| 82 | Ga0068857_100021794 | 3300005577 | Bacteria | 5639 |
| 83 | Ga0068857_100127513 | 3300005577 | Bacteria | 2293 |
| 84 | Ga0068854_100001843 | 3300005578 | Bacteria | 12908 |
| 85 | Ga0068856_100405079 | 3300005614 | Bacteria | 1384 |
| 86 | Ga0070702_100007441 | 3300005615 | Bacteria | 5243 |
| 87 | Ga0068852_100193989 | 3300005616 | Bacteria | 1918 |
| 88 | Ga0068859_100001385 | 3300005617 | Bacteria | 24659 |
| 89 | Ga0068859_100130355 | 3300005617 | Bacteria | 2586 |
| 90 | Ga0068864_100002706 | 3300005618 | Bacteria | 14596 |
| 91 | Ga0068861_100003967 | 3300005719 | Bacteria | 9910 |
| 92 | Ga0068861_100007395 | 3300005719 | Bacteria | 7525 |
| 93 | Ga0068851_10028635 | 3300005834 | Bacteria | 2753 |
| 94 | Ga0068870_10016276 | 3300005840 | Bacteria | 3549 |
| 95 | Ga0068863_100002900 | 3300005841 | Bacteria | 16987 |
| 96 | Ga0068858_100013341 | 3300005842 | Bacteria | 7751 |
| 97 | Ga0068862_100001203 | 3300005844 | Bacteria | 24415 |
| 98 | Ga0068862_100005947 | 3300005844 | Bacteria | 10162 |
| 99 | Ga0081455_10061976 | 3300005937 | Unclassified | 3145 |
| 100 | Ga0070717_10324949 | 3300006028 | Bacteria | 1371 |
| 101 | Ga0070712_100097433 | 3300006175 | Bacteria | 2168 |
| 102 | Ga0097621_100028941 | 3300006237 | Bacteria | 4372 |
| 103 | Ga0068871_100004526 | 3300006358 | Bacteria | 9687 |
| 104 | Ga0075428_100001185 | 3300006844 | Bacteria | 27884 |
| 105 | Ga0075428_100008978 | 3300006844 | Bacteria | 11090 |
| 106 | Ga0075428_100009895 | 3300006844 | Bacteria | 10592 |
| 107 | Ga0075428_100072914 | 3300006844 | Bacteria | 3749 |
| 108 | Ga0075430_100006120 | 3300006846 | Bacteria | 10139 |
| 109 | Ga0075430_100034376 | 3300006846 | Bacteria | 4302 |
| 110 | Ga0075431_100000750 | 3300006847 | Bacteria | 28064 |
| 111 | Ga0075431_100008704 | 3300006847 | Bacteria | 10168 |
| 112 | Ga0075431_100031906 | 3300006847 | Bacteria | 5427 |
| 113 | Ga0075431_100467538 | 3300006847 | Bacteria | 1255 |
| 114 | Ga0075433_10044596 | 3300006852 | Bacteria | 3853 |
| 115 | Ga0075433_10095199 | 3300006852 | Bacteria | 2635 |
| 116 | Ga0075429_100000349 | 3300006880 | Bacteria | 33711 |
| 117 | Ga0075429_100042990 | 3300006880 | Bacteria | 3931 |
| 118 | Ga0068865_100033165 | 3300006881 | Bacteria | 3455 |
| 119 | Ga0075436_100085478 | 3300006914 | Bacteria | 2190 |
| 120 | Ga0097620_100001385 | 3300006931 | Bacteria | 24659 |
| 121 | Ga0075435_100015751 | 3300007076 | Bacteria | 5688 |
| 122 | Ga0075435_100079764 | 3300007076 | Bacteria | 2687 |
| 123 | Ga0105240_10001096 | 3300009093 | Bacteria | 47799 |
| 124 | Ga0105240_10010195 | 3300009093 | Bacteria | 13225 |
| 125 | Ga0111539_10002071 | 3300009094 | Bacteria | 26801 |
| 126 | Ga0111539_10018524 | 3300009094 | Bacteria | 8625 |
| 127 | Ga0111539_10440752 | 3300009094 | Bacteria | 1517 |
| 128 | Ga0114129_10000858 | 3300009147 | Bacteria | 39460 |
| 129 | Ga0114129_10291199 | 3300009147 | Bacteria | 2179 |
| 130 | Ga0114129_10638738 | 3300009147 | Bacteria | 1375 |
| 131 | Ga0105241_10004002 | 3300009174 | Bacteria | 10894 |
| 132 | Ga0105237_10010561 | 3300009545 | Bacteria | 9813 |
| 133 | Ga0105237_10055478 | 3300009545 | Bacteria | 3968 |
| 134 | Ga0105238_10037163 | 3300009551 | Bacteria | 4951 |
| 135 | Ga0105249_10005307 | 3300009553 | Bacteria | 11128 |
| 136 | Ga0105249_10372794 | 3300009553 | Bacteria | 1451 |
| 137 | Ga0105239_10006916 | 3300010375 | Bacteria | 13082 |
| 138 | Ga0105239_10009711 | 3300010375 | Bacteria | 10819 |
| 139 | Ga0105239_10031067 | 3300010375 | Bacteria | 5875 |
| 140 | Ga0157327_1000709 | 3300012512 | Bacteria | 1878 |
| 141 | Ga0157374_10023292 | 3300013296 | Bacteria | 5537 |
| 142 | Ga0157374_10102742 | 3300013296 | Bacteria | 2742 |
| 143 | Ga0157378_10502655 | 3300013297 | Unclassified | 1211 |
| 144 | Ga0163162_10035500 | 3300013306 | Bacteria | 4967 |
| 145 | Ga0157372_10006976 | 3300013307 | Bacteria | 12029 |
| 146 | Ga0157375_10011938 | 3300013308 | Bacteria | 7687 |
| 147 | Ga0157375_10154518 | 3300013308 | Bacteria | 2432 |
| 148 | Ga0157375_10302179 | 3300013308 | Bacteria | 1764 |
| 149 | Ga0163163_10006694 | 3300014325 | Bacteria | 10097 |
| 150 | Ga0163163_10211881 | 3300014325 | Bacteria | 1987 |
| 151 | Ga0157380_10060516 | 3300014326 | Bacteria | 3026 |
| 152 | Ga0157377_10015685 | 3300014745 | Bacteria | 3882 |
| 153 | Ga0157376_10025657 | 3300014969 | Bacteria | 4644 |
| 154 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 155 | Ga0213874_10033112 | 3300021377 | Unclassified | 1505 |
| 156 | Ga0224712_10095147 | 3300022467 | Bacteria | 1254 |
| 157 | Ga0247526_102359 | 3300023558 | Eukaryota | 1791 |
| 158 | Ga0247529_102472 | 3300023559 | Eukaryota | 1767 |
| 159 | Ga0247514_102247 | 3300023560 | Eukaryota | 2186 |
| 160 | Ga0247515_102286 | 3300023564 | Eukaryota | 2068 |
| 161 | Ga0247527_101528 | 3300023664 | Eukaryota | 1868 |
| 162 | Ga0247531_102474 | 3300023666 | Eukaryota | 1714 |
| 163 | Ga0247520_102498 | 3300023686 | Eukaryota | 1784 |
| 164 | Ga0247522_102013 | 3300023688 | Eukaryota | 1984 |
| 165 | Ga0247512_102344 | 3300023690 | Eukaryota | 2104 |
| 166 | Ga0207425_1012732 | 3300025245 | Bacteria | 1962 |
| 167 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 168 | Ga0209565_1006619 | 3300025263 | Bacteria | 3227 |
| 169 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 170 | Ga0209673_1020749 | 3300025273 | Bacteria | 2318 |
| 171 | Ga0209130_1003427 | 3300025284 | Bacteria | 6746 |
| 172 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 173 | Ga0209675_1005689 | 3300025291 | Bacteria | 5151 |
| 174 | Ga0209676_1003555 | 3300025292 | Bacteria | 9429 |
| 175 | Ga0209676_1009125 | 3300025292 | Bacteria | 4320 |
| 176 | Ga0209676_1010841 | 3300025292 | Bacteria | 3743 |
| 177 | Ga0209676_1011964 | 3300025292 | Bacteria | 3452 |
| 178 | Ga0209676_1013072 | 3300025292 | Bacteria | 3213 |
| 179 | Ga0209025_1003425 | 3300025294 | Bacteria | 15046 |
| 180 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 181 | Ga0209564_1016184 | 3300025295 | Bacteria | 2985 |
| 182 | Ga0209758_1034652 | 3300025297 | Bacteria | 2004 |
| 183 | Ga0209050_1001755 | 3300025298 | Bacteria | 21513 |
| 184 | Ga0209256_1000031 | 3300025299 | Bacteria | 410189 |
| 185 | Ga0209051_1007495 | 3300025303 | Bacteria | 5955 |
| 186 | Ga0209257_1000133 | 3300025304 | Bacteria | 208808 |
| 187 | Ga0209257_1012447 | 3300025304 | Bacteria | 3930 |
| 188 | Ga0209257_1015927 | 3300025304 | Bacteria | 3081 |
| 189 | Ga0207656_10130607 | 3300025321 | Bacteria | 1176 |
| 190 | Ga0207682_10063820 | 3300025893 | Bacteria | 1547 |
| 191 | Ga0207688_10139206 | 3300025901 | Bacteria | 1427 |
| 192 | Ga0207647_10004927 | 3300025904 | Bacteria | 9842 |
| 193 | Ga0207645_10016397 | 3300025907 | Bacteria | 4904 |
| 194 | Ga0207643_10028245 | 3300025908 | Bacteria | 3115 |
| 195 | Ga0207643_10054908 | 3300025908 | Bacteria | 2265 |
| 196 | Ga0207654_10017024 | 3300025911 | Bacteria | 3794 |
| 197 | Ga0207707_10005634 | 3300025912 | Bacteria | 10958 |
| 198 | Ga0207695_10002812 | 3300025913 | Bacteria | 25307 |
| 199 | Ga0207695_10006159 | 3300025913 | Bacteria | 15639 |
| 200 | Ga0207671_10000306 | 3300025914 | Bacteria | 72328 |
| 201 | Ga0207693_10046943 | 3300025915 | Bacteria | 3394 |
| 202 | Ga0207662_10004639 | 3300025918 | Bacteria | 7250 |
| 203 | Ga0207649_10084810 | 3300025920 | Bacteria | 2060 |
| 204 | Ga0207652_10246758 | 3300025921 | Bacteria | 1610 |
| 205 | Ga0207681_10128315 | 3300025923 | Bacteria | 1871 |
| 206 | Ga0207694_10001441 | 3300025924 | Bacteria | 20398 |
| 207 | Ga0207650_10020979 | 3300025925 | Bacteria | 4615 |
| 208 | Ga0207659_10003806 | 3300025926 | Bacteria | 9101 |
| 209 | Ga0207659_10062209 | 3300025926 | Bacteria | 2693 |
| 210 | Ga0207644_10114778 | 3300025931 | Bacteria | 2041 |
| 211 | Ga0207706_10001632 | 3300025933 | Bacteria | 22248 |
| 212 | Ga0207706_10026020 | 3300025933 | Bacteria | 5239 |
| 213 | Ga0207670_10004668 | 3300025936 | Bacteria | 7428 |
| 214 | Ga0207669_10081265 | 3300025937 | Bacteria | 2076 |
| 215 | Ga0207704_10032140 | 3300025938 | Bacteria | 2966 |
| 216 | Ga0207691_10001228 | 3300025940 | Bacteria | 25540 |
| 217 | Ga0207689_10046128 | 3300025942 | Bacteria | 3603 |
| 218 | Ga0207679_10004208 | 3300025945 | Bacteria | 8942 |
| 219 | Ga0207679_10150314 | 3300025945 | Bacteria | 1894 |
| 220 | Ga0207667_10033438 | 3300025949 | Bacteria | 5528 |
| 221 | Ga0207667_10062542 | 3300025949 | Bacteria | 3892 |
| 222 | Ga0207667_10066638 | 3300025949 | Bacteria | 3753 |
| 223 | Ga0207712_10038576 | 3300025961 | Bacteria | 3267 |
| 224 | Ga0207712_10078644 | 3300025961 | Bacteria | 2394 |
| 225 | Ga0207668_10003583 | 3300025972 | Bacteria | 9124 |
| 226 | Ga0207640_10001163 | 3300025981 | Bacteria | 14437 |
| 227 | Ga0207658_10221067 | 3300025986 | Bacteria | 1593 |
| 228 | Ga0207677_10116668 | 3300026023 | Bacteria | 1999 |
| 229 | Ga0207703_10057624 | 3300026035 | Bacteria | 3169 |
| 230 | Ga0207639_10003961 | 3300026041 | Bacteria | 9993 |
| 231 | Ga0207639_10007307 | 3300026041 | Bacteria | 7525 |
| 232 | Ga0207678_10021399 | 3300026067 | Bacteria | 5671 |
| 233 | Ga0207678_10153596 | 3300026067 | Bacteria | 1965 |
| 234 | Ga0207708_10067231 | 3300026075 | Bacteria | 2741 |
| 235 | Ga0207702_10041180 | 3300026078 | Bacteria | 3873 |
| 236 | Ga0207641_10035486 | 3300026088 | Bacteria | 4155 |
| 237 | Ga0207641_10044935 | 3300026088 | Bacteria | 3716 |
| 238 | Ga0207641_10143043 | 3300026088 | Bacteria | 2160 |
| 239 | Ga0207648_10007563 | 3300026089 | Bacteria | 10661 |
| 240 | Ga0207676_10087515 | 3300026095 | Bacteria | 2548 |
| 241 | Ga0207674_10012741 | 3300026116 | Bacteria | 9394 |
| 242 | Ga0207674_10013727 | 3300026116 | Bacteria | 8967 |
| 243 | Ga0207674_10125524 | 3300026116 | Bacteria | 2532 |
| 244 | Ga0207675_100000471 | 3300026118 | Bacteria | 39106 |
| 245 | Ga0207675_100084015 | 3300026118 | Bacteria | 2987 |
| 246 | Ga0207675_100088130 | 3300026118 | Bacteria | 2915 |
| 247 | Ga0207683_10011311 | 3300026121 | Bacteria | 7611 |
| 248 | Ga0207428_10157116 | 3300027907 | Bacteria | 1729 |
| 249 | Ga0268266_10004242 | 3300028379 | Bacteria | 13784 |
| 250 | Ga0268266_10251401 | 3300028379 | Bacteria | 1635 |
| 251 | Ga0268265_10002199 | 3300028380 | Bacteria | 15038 |
| 252 | Ga0268264_10021416 | 3300028381 | Bacteria | 5279 |
| 253 | Ga0265338_10084080 | 3300028800 | Bacteria | 2658 |
| 254 | Ga0265320_10028170 | 3300031240 | Unclassified | 2920 |
| 255 | Ga0265316_10051614 | 3300031344 | Bacteria | 3230 |
| 256 | Ga0307513_10089975 | 3300031456 | Bacteria | 3132 |
| 257 | Ga0307408_100205147 | 3300031548 | Bacteria | 1598 |
| 258 | Ga0310103_103038 | 3300031614 | Eukaryota | 2083 |
| 259 | Ga0310113_103444 | 3300031636 | Eukaryota | 1740 |
| 260 | Ga0316575_10040413 | 3300031665 | Bacteria | 1843 |
| 261 | Ga0316575_10066482 | 3300031665 | Bacteria | 1444 |
| 262 | Ga0310105_103332 | 3300031666 | Eukaryota | 1799 |
| 263 | Ga0310119_103916 | 3300031686 | Eukaryota | 1815 |
| 264 | Ga0310101_102362 | 3300031690 | Eukaryota | 2153 |
| 265 | Ga0316577_10006299 | 3300031733 | Bacteria | 6261 |
| 266 | Ga0316044_103248 | 3300031810 | Eukaryota | 1991 |
| 267 | Ga0316045_103334 | 3300031815 | Eukaryota | 1956 |
| 268 | Ga0316042_104212 | 3300031816 | Eukaryota | 2043 |
| 269 | Ga0316043_103757 | 3300031828 | Eukaryota | 2121 |
| 270 | Ga0307410_10241972 | 3300031852 | Bacteria | 1399 |
| 271 | Ga0307416_100498554 | 3300032002 | Bacteria | 1281 |
| 272 | Ga0307414_10002326 | 3300032004 | Bacteria | 9926 |
| 273 | Ga0316592_1003361 | 3300033524 | Bacteria | 2877 |
| 274 | Ga0373945_0074952 | 3300035116 | Bacteria | 1287 |
| 275 | Ga0373956_0000138 | 3300035119 | Bacteria | 26073 |
| 276 | Ga0373946_0002231 | 3300035171 | Bacteria | 6836 |
| 277 | Ga0373931_0055249 | 3300035691 | Bacteria | 2124 |
| 278 | Ga0373935_0106405 | 3300035692 | Bacteria | 1856 |
| 279 | Ga0373935_0265248 | 3300035692 | Bacteria | 1205 |
| 280 | Ga0373927_0014528 | 3300035695 | Bacteria | 5210 |
| 281 | Ga0373927_0238548 | 3300035695 | Bacteria | 1195 |
| 282 | Ga0373947_0001579 | 3300035725 | Bacteria | 13968 |
| 283 | Ga0310104_01872 | 3300036242 | Eukaryota | 1753 |
| 284 | Ga0373937_0117468 | 3300036401 | Bacteria | 2477 |
| 285 | Ga0310112_003458 | 3300036458 | Eukaryota | 2078 |
| 286 | Ga0372808_006032 | 3300036459 | Eukaryota | 1621 |
| 287 | Ga0310109_002246 | 3300036534 | Eukaryota | 2131 |
| 288 | Ga0310110_004732 | 3300036535 | Eukaryota | 1925 |
| 289 | Ga0310110_005276 | 3300036535 | Eukaryota | 1852 |
| 290 | Ga0316582_0002556 | 3300036647 | Bacteria | 8610 |
| 291 | Ga0316584_0016493 | 3300036712 | Bacteria | 5295 |
| 292 | Ga0373925_0000183 | 3300037068 | Bacteria | 68921 |
| 293 | Ga0373925_0016275 | 3300037068 | Bacteria | 5383 |
| 294 | Ga0373925_0155200 | 3300037068 | Bacteria | 1800 |
| 295 | Ga0395900_0104483 | 3300037418 | Bacteria | 2910 |
| 296 | Ga0316581_0006233 | 3300037588 | Bacteria | 3147 |
| 297 | Ga0439447_001592 | 3300041407 | Bacteria | 8309 |
| 298 | Ga0451807_0517856 | 3300041486 | Bacteria | 4827 |
| 299 | Ga0451807_1244457 | 3300041486 | Bacteria | 1955 |
| 300 | Ga0451837_0602140 | 3300041494 | Bacteria | 3506 |
| 301 | Ga0451846_52639 | 3300041502 | Eukaryota | 1623 |
| 302 | Ga0451848_09797 | 3300041504 | Eukaryota | 1705 |
| 303 | Ga0451850_58294 | 3300041506 | Eukaryota | 1683 |
| 304 | Ga0439432_046728 | 3300042006 | Bacteria | 1359 |
| 305 | Ga0451577_0000229 | 3300042876 | Bacteria | 114275 |
| 306 | Ga0451577_0015360 | 3300042876 | Bacteria | 7124 |
| 307 | Ga0451577_0262316 | 3300042876 | Bacteria | 1564 |
| 308 | Ga0466972_0007169 | 3300044658 | Bacteria | 5598 |
| 309 | Ga0453683_0000007 | 3300044673 | Bacteria | 581341 |
| 310 | Ga0453683_0000165 | 3300044673 | Bacteria | 94483 |
| 311 | Ga0453683_0020992 | 3300044673 | Bacteria | 4170 |
| 312 | Ga0453684_0000740 | 3300044712 | Bacteria | 114275 |
| 313 | Ga0453684_0000883 | 3300044712 | Bacteria | 100160 |
| 314 | Ga0453684_0004226 | 3300044712 | Bacteria | 30795 |
| 315 | Ga0453684_0007705 | 3300044712 | Bacteria | 19672 |
| 316 | Ga0453684_0015820 | 3300044712 | Bacteria | 11862 |
| 317 | Ga0453684_0016330 | 3300044712 | Bacteria | 11622 |
| 318 | Ga0453684_0051326 | 3300044712 | Bacteria | 5409 |
| 319 | Ga0453684_0088437 | 3300044712 | Bacteria | 3836 |
| 320 | Ga0453684_0307908 | 3300044712 | Bacteria | 1799 |
| 321 | Ga0451576_0016474 | 3300045051 | Bacteria | 8158 |
| 322 | Ga0451576_0018371 | 3300045051 | Bacteria | 7667 |
| 323 | Ga0451576_0087831 | 3300045051 | Bacteria | 3234 |
| 324 | Ga0451576_0211282 | 3300045051 | Bacteria | 2026 |
| 325 | Ga0451576_0385839 | 3300045051 | Bacteria | 1468 |
| 326 | Ga0495629_0025311 | 3300046459 | Bacteria | 4220 |
| 327 | Ga0495639_0000842 | 3300046475 | Bacteria | 13990 |
| 328 | Ga0495628_0006373 | 3300046516 | Bacteria | 10314 |
| 329 | Ga0495630_0007958 | 3300046517 | Bacteria | 7609 |
| 330 | Ga0495666_0000024 | 3300046526 | Bacteria | 57339 |
| 331 | Ga0495586_0001169 | 3300046535 | Bacteria | 14718 |
| 332 | Ga0495586_0145809 | 3300046535 | Bacteria | 1330 |
| 333 | Ga0495621_0017978 | 3300046539 | Bacteria | 2292 |
| 334 | Ga0495622_0040730 | 3300046557 | Bacteria | 2161 |
| 335 | Ga0495668_0015855 | 3300046616 | Bacteria | 4390 |
| 336 | Ga0495658_0014155 | 3300046683 | Bacteria | 4069 |
| 337 | Ga0495636_0005386 | 3300047318 | Bacteria | 5027 |
| 338 | Ga0495636_0010202 | 3300047318 | Bacteria | 3706 |
| 339 | Ga0495676_0001542 | 3300047321 | Bacteria | 19955 |
| 340 | Ga0495686_0082419 | 3300047472 | Bacteria | 1963 |
| 341 | Ga0496102_0079813 | 3300048905 | Bacteria | 3014 |
| 342 | Ga0496106_0006799 | 3300048909 | Bacteria | 8466 |
| 343 | Ga0496106_0041646 | 3300048909 | Bacteria | 3442 |
| 344 | Ga0496107_0234227 | 3300048910 | Bacteria | 1366 |
| 345 | Ga0496108_0032361 | 3300048911 | Bacteria | 4344 |
| 346 | Ga0496109_0147625 | 3300048912 | Bacteria | 2200 |
| 347 | Ga0496110_0079115 | 3300048913 | Bacteria | 2926 |
| 348 | Ga0496111_0027319 | 3300048914 | Bacteria | 4035 |
| 349 | Ga0496111_0100751 | 3300048914 | Bacteria | 2122 |
| 350 | Ga0496113_0016016 | 3300048916 | Bacteria | 5172 |
| 351 | Ga0496121_0006877 | 3300048924 | Bacteria | 13903 |
| 352 | Ga0496125_0000148 | 3300048928 | Bacteria | 154612 |
| 353 | Ga0501299_002041 | 3300049522 | Bacteria | 2747 |
| 354 | Ga0501031_0001795 | 3300049568 | Bacteria | 13467 |
| 355 | Ga0501031_0041255 | 3300049568 | Bacteria | 3014 |
| 356 | Ga0501032_0010175 | 3300049569 | Bacteria | 6789 |
| 357 | Ga0501032_0162106 | 3300049569 | Bacteria | 1468 |
| 358 | Ga0501033_0005319 | 3300049570 | Bacteria | 10199 |
| 359 | Ga0501034_0003437 | 3300049571 | Bacteria | 18085 |
| 360 | Ga0501036_0014061 | 3300049572 | Bacteria | 6651 |
| 361 | Ga0501037_0013333 | 3300049573 | Bacteria | 6057 |
| 362 | Ga0501038_0001131 | 3300049574 | Bacteria | 24190 |
| 363 | Ga0501039_0015074 | 3300049575 | Bacteria | 5912 |
| 364 | Ga0501039_0026902 | 3300049575 | Bacteria | 4422 |
| 365 | Ga0501039_0374585 | 3300049575 | Bacteria | 1118 |
| 366 | Ga0501041_0066037 | 3300049577 | Bacteria | 2216 |
| 367 | Ga0501043_0069812 | 3300049579 | Bacteria | 2760 |
| 368 | Ga0501046_0008828 | 3300049580 | Bacteria | 8754 |
| 369 | Ga0501046_0028174 | 3300049580 | Bacteria | 4578 |
| 370 | Ga0501047_0003649 | 3300049581 | Bacteria | 14507 |
| 371 | Ga0501048_0023137 | 3300049582 | Bacteria | 4543 |
| 372 | Ga0501048_0039668 | 3300049582 | Bacteria | 3377 |
| 373 | Ga0501067_0109441 | 3300049583 | Bacteria | 1536 |
| 374 | Ga0501068_0160518 | 3300049584 | Bacteria | 1417 |
| 375 | Ga0501071_0013447 | 3300049587 | Bacteria | 5578 |
| 376 | Ga0501072_0005884 | 3300049588 | Bacteria | 9341 |
| 377 | Ga0501073_0003923 | 3300049589 | Bacteria | 11163 |
| 378 | Ga0501074_0033912 | 3300049590 | Bacteria | 3701 |
| 379 | Ga0501075_0002964 | 3300049591 | Bacteria | 11361 |
| 380 | Ga0501076_0046881 | 3300049592 | Bacteria | 3415 |
| 381 | Ga0501077_0003882 | 3300049593 | Bacteria | 9003 |
| 382 | Ga0501079_0016111 | 3300049741 | Bacteria | 5712 |
| 383 | Ga0501080_0028217 | 3300049742 | Bacteria | 5220 |
| 384 | Ga0501080_0393059 | 3300049742 | Bacteria | 1248 |
| 385 | Ga0501081_0158981 | 3300049743 | Bacteria | 1627 |
| 386 | Ga0501083_0002867 | 3300049744 | Bacteria | 11931 |
| 387 | Ga0501083_0118398 | 3300049744 | Bacteria | 1738 |
| 388 | Ga0501035_0002271 | 3300049822 | Bacteria | 18986 |
| 389 | Ga0501035_0051513 | 3300049822 | Bacteria | 3686 |
| 390 | Ga0501044_0002762 | 3300049823 | Bacteria | 19988 |
| 391 | Ga0501045_0000657 | 3300049824 | Bacteria | 21947 |
| 392 | nmdc:mga05p37_41251_c1 | 3300050507 | Bacteria | 5667 |
| 393 | nmdc:mga05p37_52965_c1 | 3300050507 | Bacteria | 4991 |
| 394 | nmdc:mga09592_13658_c1 | 3300050508 | Bacteria | 6637 |
| 395 | nmdc:mga09592_13853_c1 | 3300050508 | Bacteria | 6589 |
| 396 | nmdc:mga0qj67_119996_c1 | 3300050509 | Bacteria | 2126 |
| 397 | nmdc:mga0qj67_4242_c1 | 3300050509 | Bacteria | 10385 |
| 398 | nmdc:mga06r32_2630_c1 | 3300050510 | Bacteria | 16035 |
| 399 | nmdc:mga06r32_598_c1 | 3300050510 | Bacteria | 31407 |
| 400 | nmdc:mga08y16_18298_c1 | 3300050511 | Bacteria | 7382 |
| 401 | nmdc:mga08y16_232070_c1 | 3300050511 | Bacteria | 1909 |
| 402 | nmdc:mga08y16_43000_c1 | 3300050511 | Bacteria | 4732 |
| 403 | nmdc:mga08y16_5133_c1 | 3300050511 | Bacteria | 13688 |
| 404 | nmdc:mga0n895_20553_c1 | 3300050512 | Bacteria | 6159 |
| 405 | nmdc:mga0rr50_11633_c1 | 3300050513 | Bacteria | 5643 |
| 406 | nmdc:mga0rr50_74803_c1 | 3300050513 | Bacteria | 2594 |
| 407 | nmdc:mga08x19_58808_c1 | 3300050514 | Bacteria | 2487 |
| 408 | nmdc:mga0a205_111482_c1 | 3300050515 | Bacteria | 2635 |
| 409 | nmdc:mga0a205_14656_c1 | 3300050515 | Bacteria | 7314 |
| 410 | Ga0500610_0000500 | 3300053079 | Bacteria | 12074 |
| 411 | Ga0500583_0003712 | 3300053092 | Bacteria | 4864 |
| 412 | Ga0500641_0024258 | 3300053096 | Unclassified | 2337 |
| 413 | Ga0500553_066267 | 3300053101 | Bacteria | 1674 |
| 414 | Ga0500556_0071016 | 3300053104 | Bacteria | 1300 |
| 415 | Ga0500617_064669 | 3300053124 | Bacteria | 1613 |
| 416 | Ga0500577_0024112 | 3300053142 | Bacteria | 2042 |
| 417 | Ga0500637_0061225 | 3300053178 | Bacteria | 2156 |
| 418 | Ga0587073_0007282 | 3300059492 | Eukaryota | 1742 |
| 419 | Ga0587080_004854 | 3300059503 | Eukaryota | 1774 |
| 420 | Ga0587109_010097 | 3300059624 | Eukaryota | 1499 |
| 421 | Ga0530510_0010435 | 3300061734 | Bacteria | 6513 |
| 422 | 2617918271 | 2617270889 | Bacteria | 9064343 |
| 423 | 2643818718 | 2643221559 | Bacteria | 4424915 |
| 424 | 2643940969 | 2643221586 | Bacteria | 4446529 |
| 425 | 2644079989 | 2643221612 | Bacteria | 4361984 |
| 426 | 2644695584 | 2643221727 | Bacteria | 4415595 |
| 427 | 2804849462 | 2802429296 | Bacteria | 7227771 |
| 428 | 2812365158 | 2811994880 | Bacteria | 4147780 |
| 429 | 2831431756 | 2831426010 | Bacteria | 8662725 |
| 430 | 2848696670 | 2848694841 | Bacteria | 9205737 |
| 431 | 2849666276 | 2849660919 | Bacteria | 8251853 |
| 432 | 2873156019 | 2873151551 | Bacteria | 8625867 |
| 433 | 2886633917 | 2886627955 | Bacteria | 7618130 |
| 434 | 2912729565 | 2912723979 | Bacteria | 8557534 |
| 435 | 2913848303 | 2913844669 | Bacteria | 8381711 |
| 436 | 2913912672 | 2913912277 | Bacteria | 9037797 |
| 437 | 2913941330 | 2913939268 | Bacteria | 8559644 |
| 438 | 2941493422 | 2941489479 | Bacteria | 6313767 |
| 439 | 2995952483 | 2995948881 | Bacteria | 6358104 |
| 440 | 642599434 | 642555144 | Bacteria | 9059191 |
| 441 | 8003016328 | 8003014200 | Bacteria | 4059994 |
| 442 | 8025414516 | 8025413630 | Bacteria | 7014048 |
| 443 | Ga0247521_102428 | |||
| 444 | CNXas_1000044 | |||
| 445 | Ga0006556J51387_1008026 | |||
| 446 | Ga0006557J51388_1009583 | |||
| 447 | Ga0006558J51389_1009412 | |||
| 448 | Ga0006559J51393_1008410 | |||
| 449 | Ga0006553J51392_1008836 | |||
| 450 | Ga0006555J51386_1007989 | |||
| 451 | Ga0006560J51390_1007647 | |||
| 452 | Ga0006554J51385_1009443 | |||
| 453 | Ga0055526_1000139 | |||
| 454 | Ga0055537_1000323 | |||
| 455 | Ga0055524_1000206 | |||
| 456 | Ga0055536_1010500 | |||
| 457 | Ga0055536_1024279 | |||
| 458 | Ga0055534_1000164 | |||
| 459 | Ga0055528_1000027 | |||
| 460 | Ga0055530_10002126 | |||
| 461 | Ga0055531_10027513 | |||
| 462 | Ga0065704_10093059 | |||
| 463 | Ga0065712_10002445 | |||
| 464 | Ga0065712_10008386 | |||
| 465 | Ga0065712_10073891 | |||
| 466 | Ga0065715_10093300 | |||
| 467 | Ga0065715_10095718 | |||
| 468 | Ga0070676_10001086 | |||
| 469 | Ga0070683_100051689 | |||
| 470 | Ga0070690_100002450 | |||
| 471 | Ga0070670_100003606 | |||
| 472 | Ga0070677_10036264 | |||
| 473 | Ga0068869_100001581 | |||
| 474 | Ga0068869_100121006 | |||
| 475 | Ga0070687_100003779 | |||
| 476 | Ga0070668_100007403 | |||
| 477 | Ga0070668_100017122 | |||
| 478 | Ga0070668_100106596 | |||
| 479 | Ga0070675_100012863 | |||
| 480 | Ga0070675_100050966 | |||
| 481 | Ga0070671_100012120 | |||
| 482 | Ga0070671_100027910 | |||
| 483 | Ga0070674_100118598 | |||
| 484 | Ga0070688_100020612 | |||
| 485 | Ga0070688_100023805 | |||
| 486 | Ga0070688_100045655 | |||
| 487 | Ga0070667_100079715 | |||
| 488 | Ga0070667_100150292 | |||
| 489 | Ga0070705_100035863 | |||
| 490 | Ga0070700_100045207 | |||
| 491 | Ga0070700_100062722 | |||
| 492 | Ga0070708_100360859 | |||
| 493 | Ga0070663_100042850 | |||
| 494 | Ga0070678_100001954 | |||
| 495 | Ga0070662_100003178 | |||
| 496 | Ga0070662_100272463 | |||
| 497 | Ga0070681_10004545 | |||
| 498 | Ga0070685_10174288 | |||
| 499 | Ga0070707_100000171 | |||
| 500 | Ga0070698_100042279 | |||
| 501 | Ga0070699_100000001 | |||
| 502 | Ga0070699_100003796 | |||
| 503 | Ga0070684_100041405 | |||
| 504 | Ga0070684_100124091 | |||
| 505 | Ga0070697_100003525 | |||
| 506 | Ga0070697_100136996 | |||
| 507 | Ga0068853_100001596 | |||
| 508 | Ga0068853_100004286 | |||
| 509 | Ga0068853_100012186 | |||
| 510 | Ga0068853_100038105 | |||
| 511 | Ga0070672_100004775 | |||
| 512 | Ga0070686_100004267 | |||
| 513 | Ga0070695_100000847 | |||
| 514 | Ga0070695_100105698 | |||
| 515 | Ga0070665_100006223 | |||
| 516 | Ga0070665_100013925 | |||
| 517 | Ga0070665_100019004 | |||
| 518 | Ga0068855_100007250 | |||
| 519 | Ga0068855_100008679 | |||
| 520 | Ga0068855_100019508 | |||
| 521 | Ga0070664_100002579 | |||
| 522 | Ga0070664_100230895 | |||
| 523 | Ga0068857_100011412 | |||
| 524 | Ga0068857_100021794 | |||
| 525 | Ga0068857_100127513 | |||
| 526 | Ga0068854_100001843 | |||
| 527 | Ga0068856_100405079 | |||
| 528 | Ga0070702_100007441 | |||
| 529 | Ga0068852_100193989 | |||
| 530 | Ga0068859_100001385 | |||
| 531 | Ga0068859_100130355 | |||
| 532 | Ga0068864_100002706 | |||
| 533 | Ga0068861_100003967 | |||
| 534 | Ga0068861_100007395 | |||
| 535 | Ga0068851_10028635 | |||
| 536 | Ga0068870_10016276 | |||
| 537 | Ga0068863_100002900 | |||
| 538 | Ga0068858_100013341 | |||
| 539 | Ga0068862_100001203 | |||
| 540 | Ga0068862_100005947 | |||
| 541 | Ga0081455_10061976 | |||
| 542 | Ga0070717_10324949 | |||
| 543 | Ga0070712_100097433 | |||
| 544 | Ga0097621_100028941 | |||
| 545 | Ga0068871_100004526 | |||
| 546 | Ga0075428_100001185 | |||
| 547 | Ga0075428_100008978 | |||
| 548 | Ga0075428_100009895 | |||
| 549 | Ga0075428_100072914 | |||
| 550 | Ga0075430_100006120 | |||
| 551 | Ga0075430_100034376 | |||
| 552 | Ga0075431_100000750 | |||
| 553 | Ga0075431_100008704 | |||
| 554 | Ga0075431_100031906 | |||
| 555 | Ga0075431_100467538 | |||
| 556 | Ga0075433_10044596 | |||
| 557 | Ga0075433_10095199 | |||
| 558 | Ga0075429_100000349 | |||
| 559 | Ga0075429_100042990 | |||
| 560 | Ga0068865_100033165 | |||
| 561 | Ga0075436_100085478 | |||
| 562 | Ga0097620_100001385 | |||
| 563 | Ga0075435_100015751 | |||
| 564 | Ga0075435_100079764 | |||
| 565 | Ga0105240_10001096 | |||
| 566 | Ga0105240_10010195 | |||
| 567 | Ga0111539_10002071 | |||
| 568 | Ga0111539_10018524 | |||
| 569 | Ga0111539_10440752 | |||
| 570 | Ga0114129_10000858 | |||
| 571 | Ga0114129_10291199 | |||
| 572 | Ga0114129_10638738 | |||
| 573 | Ga0105241_10004002 | |||
| 574 | Ga0105237_10010561 | |||
| 575 | Ga0105237_10055478 | |||
| 576 | Ga0105238_10037163 | |||
| 577 | Ga0105249_10005307 | |||
| 578 | Ga0105249_10372794 | |||
| 579 | Ga0105239_10006916 | |||
| 580 | Ga0105239_10009711 | |||
| 581 | Ga0105239_10031067 | |||
| 582 | Ga0157327_1000709 | |||
| 583 | Ga0157374_10023292 | |||
| 584 | Ga0157374_10102742 | |||
| 585 | Ga0157378_10502655 | |||
| 586 | Ga0163162_10035500 | |||
| 587 | Ga0157372_10006976 | |||
| 588 | Ga0157375_10011938 | |||
| 589 | Ga0157375_10154518 | |||
| 590 | Ga0157375_10302179 | |||
| 591 | Ga0163163_10006694 | |||
| 592 | Ga0163163_10211881 | |||
| 593 | Ga0157380_10060516 | |||
| 594 | Ga0157377_10015685 | |||
| 595 | Ga0157376_10025657 | |||
| 596 | Ga0183360_10001 | |||
| 597 | Ga0213874_10033112 | |||
| 598 | Ga0224712_10095147 | |||
| 599 | Ga0247526_102359 | |||
| 600 | Ga0247529_102472 | |||
| 601 | Ga0247514_102247 | |||
| 602 | Ga0247515_102286 | |||
| 603 | Ga0247527_101528 | |||
| 604 | Ga0247531_102474 | |||
| 605 | Ga0247520_102498 | |||
| 606 | Ga0247522_102013 | |||
| 607 | Ga0247512_102344 | |||
| 608 | Ga0207425_1012732 | |||
| 609 | Ga0209565_1000005 | |||
| 610 | Ga0209565_1006619 | |||
| 611 | Ga0209673_1000011 | |||
| 612 | Ga0209673_1020749 | |||
| 613 | Ga0209130_1003427 | |||
| 614 | Ga0209675_1000004 | |||
| 615 | Ga0209675_1005689 | |||
| 616 | Ga0209676_1003555 | |||
| 617 | Ga0209676_1009125 | |||
| 618 | Ga0209676_1010841 | |||
| 619 | Ga0209676_1011964 | |||
| 620 | Ga0209676_1013072 | |||
| 621 | Ga0209025_1003425 | |||
| 622 | Ga0209564_1000018 | |||
| 623 | Ga0209564_1016184 | |||
| 624 | Ga0209758_1034652 | |||
| 625 | Ga0209050_1001755 | |||
| 626 | Ga0209256_1000031 | |||
| 627 | Ga0209051_1007495 | |||
| 628 | Ga0209257_1000133 | |||
| 629 | Ga0209257_1012447 | |||
| 630 | Ga0209257_1015927 | |||
| 631 | Ga0207656_10130607 | |||
| 632 | Ga0207682_10063820 | |||
| 633 | Ga0207688_10139206 | |||
| 634 | Ga0207647_10004927 | |||
| 635 | Ga0207645_10016397 | |||
| 636 | Ga0207643_10028245 | |||
| 637 | Ga0207643_10054908 | |||
| 638 | Ga0207654_10017024 | |||
| 639 | Ga0207707_10005634 | |||
| 640 | Ga0207695_10002812 | |||
| 641 | Ga0207695_10006159 | |||
| 642 | Ga0207671_10000306 | |||
| 643 | Ga0207693_10046943 | |||
| 644 | Ga0207662_10004639 | |||
| 645 | Ga0207649_10084810 | |||
| 646 | Ga0207652_10246758 | |||
| 647 | Ga0207681_10128315 | |||
| 648 | Ga0207694_10001441 | |||
| 649 | Ga0207650_10020979 | |||
| 650 | Ga0207659_10003806 | |||
| 651 | Ga0207659_10062209 | |||
| 652 | Ga0207644_10114778 | |||
| 653 | Ga0207706_10001632 | |||
| 654 | Ga0207706_10026020 | |||
| 655 | Ga0207670_10004668 | |||
| 656 | Ga0207669_10081265 | |||
| 657 | Ga0207704_10032140 | |||
| 658 | Ga0207691_10001228 | |||
| 659 | Ga0207689_10046128 | |||
| 660 | Ga0207679_10004208 | |||
| 661 | Ga0207679_10150314 | |||
| 662 | Ga0207667_10033438 | |||
| 663 | Ga0207667_10062542 | |||
| 664 | Ga0207667_10066638 | |||
| 665 | Ga0207712_10038576 | |||
| 666 | Ga0207712_10078644 | |||
| 667 | Ga0207668_10003583 | |||
| 668 | Ga0207640_10001163 | |||
| 669 | Ga0207658_10221067 | |||
| 670 | Ga0207677_10116668 | |||
| 671 | Ga0207703_10057624 | |||
| 672 | Ga0207639_10003961 | |||
| 673 | Ga0207639_10007307 | |||
| 674 | Ga0207678_10021399 | |||
| 675 | Ga0207678_10153596 | |||
| 676 | Ga0207708_10067231 | |||
| 677 | Ga0207702_10041180 | |||
| 678 | Ga0207641_10035486 | |||
| 679 | Ga0207641_10044935 | |||
| 680 | Ga0207641_10143043 | |||
| 681 | Ga0207648_10007563 | |||
| 682 | Ga0207676_10087515 | |||
| 683 | Ga0207674_10012741 | |||
| 684 | Ga0207674_10013727 | |||
| 685 | Ga0207674_10125524 | |||
| 686 | Ga0207675_100000471 | |||
| 687 | Ga0207675_100084015 | |||
| 688 | Ga0207675_100088130 | |||
| 689 | Ga0207683_10011311 | |||
| 690 | Ga0207428_10157116 | |||
| 691 | Ga0268266_10004242 | |||
| 692 | Ga0268266_10251401 | |||
| 693 | Ga0268265_10002199 | |||
| 694 | Ga0268264_10021416 | |||
| 695 | Ga0265338_10084080 | |||
| 696 | Ga0265320_10028170 | |||
| 697 | Ga0265316_10051614 | |||
| 698 | Ga0307513_10089975 | |||
| 699 | Ga0307408_100205147 | |||
| 700 | Ga0310103_103038 | |||
| 701 | Ga0310113_103444 | |||
| 702 | Ga0316575_10040413 | |||
| 703 | Ga0316575_10066482 | |||
| 704 | Ga0310105_103332 | |||
| 705 | Ga0310119_103916 | |||
| 706 | Ga0310101_102362 | |||
| 707 | Ga0316577_10006299 | |||
| 708 | Ga0316044_103248 | |||
| 709 | Ga0316045_103334 | |||
| 710 | Ga0316042_104212 | |||
| 711 | Ga0316043_103757 | |||
| 712 | Ga0307410_10241972 | |||
| 713 | Ga0307416_100498554 | |||
| 714 | Ga0307414_10002326 | |||
| 715 | Ga0316592_1003361 | |||
| 716 | Ga0373945_0074952 | |||
| 717 | Ga0373956_0000138 | |||
| 718 | Ga0373946_0002231 | |||
| 719 | Ga0373931_0055249 | |||
| 720 | Ga0373935_0106405 | |||
| 721 | Ga0373935_0265248 | |||
| 722 | Ga0373927_0014528 | |||
| 723 | Ga0373927_0238548 | |||
| 724 | Ga0373947_0001579 | |||
| 725 | Ga0310104_01872 | |||
| 726 | Ga0373937_0117468 | |||
| 727 | Ga0310112_003458 | |||
| 728 | Ga0372808_006032 | |||
| 729 | Ga0310109_002246 | |||
| 730 | Ga0310110_004732 | |||
| 731 | Ga0310110_005276 | |||
| 732 | Ga0316582_0002556 | |||
| 733 | Ga0316584_0016493 | |||
| 734 | Ga0373925_0000183 | |||
| 735 | Ga0373925_0016275 | |||
| 736 | Ga0373925_0155200 | |||
| 737 | Ga0395900_0104483 | |||
| 738 | Ga0316581_0006233 | |||
| 739 | Ga0439447_001592 | |||
| 740 | Ga0451807_0517856 | |||
| 741 | Ga0451807_1244457 | |||
| 742 | Ga0451837_0602140 | |||
| 743 | Ga0451846_52639 | |||
| 744 | Ga0451848_09797 | |||
| 745 | Ga0451850_58294 | |||
| 746 | Ga0439432_046728 | |||
| 747 | Ga0451577_0000229 | |||
| 748 | Ga0451577_0015360 | |||
| 749 | Ga0451577_0262316 | |||
| 750 | Ga0466972_0007169 | |||
| 751 | Ga0453683_0000007 | |||
| 752 | Ga0453683_0000165 | |||
| 753 | Ga0453683_0020992 | |||
| 754 | Ga0453684_0000740 | |||
| 755 | Ga0453684_0000883 | |||
| 756 | Ga0453684_0004226 | |||
| 757 | Ga0453684_0007705 | |||
| 758 | Ga0453684_0015820 | |||
| 759 | Ga0453684_0016330 | |||
| 760 | Ga0453684_0051326 | |||
| 761 | Ga0453684_0088437 | |||
| 762 | Ga0453684_0307908 | |||
| 763 | Ga0451576_0016474 | |||
| 764 | Ga0451576_0018371 | |||
| 765 | Ga0451576_0087831 | |||
| 766 | Ga0451576_0211282 | |||
| 767 | Ga0451576_0385839 | |||
| 768 | Ga0495629_0025311 | |||
| 769 | Ga0495639_0000842 | |||
| 770 | Ga0495628_0006373 | |||
| 771 | Ga0495630_0007958 | |||
| 772 | Ga0495666_0000024 | |||
| 773 | Ga0495586_0001169 | |||
| 774 | Ga0495586_0145809 | |||
| 775 | Ga0495621_0017978 | |||
| 776 | Ga0495622_0040730 | |||
| 777 | Ga0495668_0015855 | |||
| 778 | Ga0495658_0014155 | |||
| 779 | Ga0495636_0005386 | |||
| 780 | Ga0495636_0010202 | |||
| 781 | Ga0495676_0001542 | |||
| 782 | Ga0495686_0082419 | |||
| 783 | Ga0496102_0079813 | |||
| 784 | Ga0496106_0006799 | |||
| 785 | Ga0496106_0041646 | |||
| 786 | Ga0496107_0234227 | |||
| 787 | Ga0496108_0032361 | |||
| 788 | Ga0496109_0147625 | |||
| 789 | Ga0496110_0079115 | |||
| 790 | Ga0496111_0027319 | |||
| 791 | Ga0496111_0100751 | |||
| 792 | Ga0496113_0016016 | |||
| 793 | Ga0496121_0006877 | |||
| 794 | Ga0496125_0000148 | |||
| 795 | Ga0501299_002041 | |||
| 796 | Ga0501031_0001795 | |||
| 797 | Ga0501031_0041255 | |||
| 798 | Ga0501032_0010175 | |||
| 799 | Ga0501032_0162106 | |||
| 800 | Ga0501033_0005319 | |||
| 801 | Ga0501034_0003437 | |||
| 802 | Ga0501036_0014061 | |||
| 803 | Ga0501037_0013333 | |||
| 804 | Ga0501038_0001131 | |||
| 805 | Ga0501039_0015074 | |||
| 806 | Ga0501039_0026902 | |||
| 807 | Ga0501039_0374585 | |||
| 808 | Ga0501041_0066037 | |||
| 809 | Ga0501043_0069812 | |||
| 810 | Ga0501046_0008828 | |||
| 811 | Ga0501046_0028174 | |||
| 812 | Ga0501047_0003649 | |||
| 813 | Ga0501048_0023137 | |||
| 814 | Ga0501048_0039668 | |||
| 815 | Ga0501067_0109441 | |||
| 816 | Ga0501068_0160518 | |||
| 817 | Ga0501071_0013447 | |||
| 818 | Ga0501072_0005884 | |||
| 819 | Ga0501073_0003923 | |||
| 820 | Ga0501074_0033912 | |||
| 821 | Ga0501075_0002964 | |||
| 822 | Ga0501076_0046881 | |||
| 823 | Ga0501077_0003882 | |||
| 824 | Ga0501079_0016111 | |||
| 825 | Ga0501080_0028217 | |||
| 826 | Ga0501080_0393059 | |||
| 827 | Ga0501081_0158981 | |||
| 828 | Ga0501083_0002867 | |||
| 829 | Ga0501083_0118398 | |||
| 830 | Ga0501035_0002271 | |||
| 831 | Ga0501035_0051513 | |||
| 832 | Ga0501044_0002762 | |||
| 833 | Ga0501045_0000657 | |||
| 834 | nmdc:mga05p37_41251_c1 | |||
| 835 | nmdc:mga05p37_52965_c1 | |||
| 836 | nmdc:mga09592_13658_c1 | |||
| 837 | nmdc:mga09592_13853_c1 | |||
| 838 | nmdc:mga0qj67_119996_c1 | |||
| 839 | nmdc:mga0qj67_4242_c1 | |||
| 840 | nmdc:mga06r32_2630_c1 | |||
| 841 | nmdc:mga06r32_598_c1 | |||
| 842 | nmdc:mga08y16_18298_c1 | |||
| 843 | nmdc:mga08y16_232070_c1 | |||
| 844 | nmdc:mga08y16_43000_c1 | |||
| 845 | nmdc:mga08y16_5133_c1 | |||
| 846 | nmdc:mga0n895_20553_c1 | |||
| 847 | nmdc:mga0rr50_11633_c1 | |||
| 848 | nmdc:mga0rr50_74803_c1 | |||
| 849 | nmdc:mga08x19_58808_c1 | |||
| 850 | nmdc:mga0a205_111482_c1 | |||
| 851 | nmdc:mga0a205_14656_c1 | |||
| 852 | Ga0500610_0000500 | |||
| 853 | Ga0500583_0003712 | |||
| 854 | Ga0500641_0024258 | |||
| 855 | Ga0500553_066267 | |||
| 856 | Ga0500556_0071016 | |||
| 857 | Ga0500617_064669 | |||
| 858 | Ga0500577_0024112 | |||
| 859 | Ga0500637_0061225 | |||
| 860 | Ga0587073_0007282 | |||
| 861 | Ga0587080_004854 | |||
| 862 | Ga0587109_010097 | |||
| 863 | Ga0530510_0010435 | |||
| 864 | 2617918271 | |||
| 865 | 2643818718 | |||
| 866 | 2643940969 | |||
| 867 | 2644079989 | |||
| 868 | 2644695584 | |||
| 869 | 2804849462 | |||
| 870 | 2812365158 | |||
| 871 | 2831431756 | |||
| 872 | 2848696670 | |||
| 873 | 2849666276 | |||
| 874 | 2873156019 | |||
| 875 | 2886633917 | |||
| 876 | 2912729565 | |||
| 877 | 2913848303 | |||
| 878 | 2913912672 | |||
| 879 | 2913941330 | |||
| 880 | 2941493422 | |||
| 881 | 2995952483 | |||
| 882 | 642599434 | |||
| 883 | 8003016328 | |||
| 884 | 8025414516 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.9868 | 18 | 340 |
| 4ylt-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis | 0.9856 | 17 | 340 |
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9838 | 17 | 340 |
| 4x9o-assembly1.cif.gz_B | beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate | 0.9834 | 17 | 340 |
| 5bnr-assembly1.cif.gz_A-2 | e. coli fabh with small molecule inhibitor 2 | 0.9816 | 17 | 340 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9892 | 17 | 184 | 3.40.47.10 |
| 1zowB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.984 | 17 | 184 | 3.40.47.10 |
| 4x9oB00 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9834 | 17 | 340 | 3.40.47.10 |
| 3il4B01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9821 | 17 | 184 | 3.40.47.10 |
| af_Q2FZS0_1_313_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9803 | 17 | 340 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661PT68-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9996 | 20 | 130 |
GO:0016746
GO:0044550 |
| AF-A0A800M9R9-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9989 | 19 | 169 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A535AJN1-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9953 | 15 | 174 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A7X3RR09-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9951 | 16 | 340 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 |
| AF-A0A3D1TF25-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) | 0.9948 | 26 | 340 |
GO:0004315
GO:0005737 GO:0006633 GO:0033818 GO:0044550 |