F444895

General Info

Members Datasets Scaffolds Average Seq Length
442 216 884 463

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10065760|Ga0207668_100657602
Length 535
Sequence MSPCLCRLKVISKRQRLRSHAAAKHIELGLSVLSESETAGDRFFSLVKSFRQVMESMRVAVVKVYLALLLTLLVGGPMLVGQKAMAQATTTASASPADRLAALEKQASDNATAIAAAQTSGDNAWMLVSAALVLMMSGPGLALFYAGLVRKKNVLGTMMQTFAMMAVITVLWAVVTYSLAFGEGNAFIGGFHNMFLRGVGLVPDVKYAATIPLQTFMVYQLMFAIITPALITGAFAERMKFSSMLVFMILWALFIYSPMAHMVWGKGGFLNAALGGRLPCLDFAGGTVVHVTSGVSALVTAIYLGKRLGYPKEPMPPHSVVLSFIGACLLWVGWFGFNAGSALSAGTLATSAFVATHFGAAAAAIGWSAAEWLRQGKASALGAISGXXXXLVAITPAAGFVTPMSGLWIGLIAGVFCYFMVVKVKALFGYDDSLDAFGVHGAGGTLGALLTGFFANSAINPIFGKDKPTGLFEGNWHQVLNQAAGVAIAWTISIVGTLIILFLVDKVMGLRVSVDDERDGLDLSQHGEEGYDWAH

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 3.62
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_10065760 3300025972 Bacteria 2568
2 rootH1_10065962 3300003316 Bacteria 3356
3 Ga0070658_10000007 3300005327 Bacteria 349444
4 Ga0070658_10016767 3300005327 Bacteria 5864
5 Ga0070658_10030777 3300005327 Bacteria 4311
6 Ga0070683_100000063 3300005329 Bacteria 79423
7 Ga0070683_100017801 3300005329 Bacteria 6279
8 Ga0070683_100027721 3300005329 Bacteria 5111
9 Ga0070683_100065441 3300005329 Bacteria 3384
10 Ga0070670_100022763 3300005331 Bacteria 5392
11 Ga0070670_100045281 3300005331 Bacteria 3781
12 Ga0070660_100009595 3300005339 Bacteria 6816
13 Ga0070660_100017843 3300005339 Bacteria 5177
14 Ga0070660_100098540 3300005339 Bacteria 2314
15 Ga0070661_100008049 3300005344 Bacteria 7278
16 Ga0070661_100115979 3300005344 Bacteria 2003
17 Ga0070692_10011885 3300005345 Bacteria 4014
18 Ga0070671_100000429 3300005355 Bacteria 29172
19 Ga0070659_100003992 3300005366 Bacteria 10505
20 Ga0070659_100033495 3300005366 Bacteria 3990
21 Ga0070659_100075807 3300005366 Bacteria 2681
22 Ga0070709_10001219 3300005434 Bacteria 14108
23 Ga0070709_10069120 3300005434 Bacteria 2274
24 Ga0070714_100076807 3300005435 Bacteria 2900
25 Ga0070714_100079446 3300005435 Bacteria 2852
26 Ga0070713_100000461 3300005436 Bacteria 25984
27 Ga0070713_100001905 3300005436 Bacteria 13442
28 Ga0070713_100029875 3300005436 Bacteria 4322
29 Ga0070713_100051997 3300005436 Bacteria 3390
30 Ga0070711_100052412 3300005439 Bacteria 2807
31 Ga0070711_100090159 3300005439 Bacteria 2207
32 Ga0070708_100007563 3300005445 Bacteria 8698
33 Ga0070663_100019462 3300005455 Bacteria 4475
34 Ga0070678_100019714 3300005456 Bacteria 4406
35 Ga0070678_100045787 3300005456 Bacteria 3132
36 Ga0070662_100077109 3300005457 Bacteria 2473
37 Ga0070662_100133781 3300005457 Bacteria 1915
38 Ga0070681_10007366 3300005458 Bacteria 10756
39 Ga0070681_10009425 3300005458 Bacteria 9608
40 Ga0070681_10023633 3300005458 Bacteria 6184
41 Ga0070681_10087148 3300005458 Bacteria 3075
42 Ga0070699_100000753 3300005518 Bacteria 29961
43 Ga0070699_100025672 3300005518 Bacteria 5079
44 Ga0070679_100002145 3300005530 Bacteria 17787
45 Ga0070679_100021139 3300005530 Bacteria 6349
46 Ga0070679_100097887 3300005530 Bacteria 2921
47 Ga0070679_100179955 3300005530 Bacteria 2087
48 Ga0070684_100000089 3300005535 Bacteria 59395
49 Ga0070684_100009023 3300005535 Bacteria 7834
50 Ga0070684_100032260 3300005535 Bacteria 4464
51 Ga0070684_100116079 3300005535 Bacteria 2404
52 Ga0068853_100025543 3300005539 Bacteria 4957
53 Ga0068853_100045286 3300005539 Bacteria 3767
54 Ga0068853_100091136 3300005539 Bacteria 2680
55 Ga0070665_100022304 3300005548 Bacteria 6371
56 Ga0070665_100025415 3300005548 Bacteria 5968
57 Ga0068855_100009876 3300005563 Bacteria 11511
58 Ga0068855_100030240 3300005563 Bacteria 6478
59 Ga0068855_100057365 3300005563 Bacteria 4565
60 Ga0070664_100013503 3300005564 Bacteria 6654
61 Ga0070664_100034658 3300005564 Bacteria 4234
62 Ga0068857_100025768 3300005577 Bacteria 5178
63 Ga0068854_100002891 3300005578 Bacteria 10676
64 Ga0068856_100017545 3300005614 Bacteria 6936
65 Ga0068856_100042762 3300005614 Bacteria 4458
66 Ga0068856_100046391 3300005614 Bacteria 4280
67 Ga0068852_100034025 3300005616 Bacteria 4238
68 Ga0068852_100038794 3300005616 Bacteria 4006
69 Ga0068852_100042908 3300005616 Bacteria 3832
70 Ga0068859_100016556 3300005617 Bacteria 7402
71 Ga0068864_100008637 3300005618 Bacteria 8405
72 Ga0068864_100019140 3300005618 Bacteria 5724
73 Ga0068864_100065073 3300005618 Bacteria 3163
74 Ga0068851_10003533 3300005834 Bacteria 6955
75 Ga0068863_100006574 3300005841 Bacteria 11408
76 Ga0068863_100020699 3300005841 Bacteria 6283
77 Ga0068858_100048646 3300005842 Bacteria 3927
78 Ga0068858_100237910 3300005842 Bacteria 1727
79 Ga0068860_100043909 3300005843 Bacteria 4262
80 Ga0081539_10001130 3300005985 Bacteria 48420
81 Ga0070717_10015061 3300006028 Bacteria 5962
82 Ga0070717_10033023 3300006028 Bacteria 4173
83 Ga0070717_10066758 3300006028 Bacteria 2992
84 Ga0070716_100056595 3300006173 Bacteria 2249
85 Ga0070712_100000506 3300006175 Bacteria 22281
86 Ga0070712_100045778 3300006175 Bacteria 3022
87 Ga0070712_100120836 3300006175 Bacteria 1970
88 Ga0097621_100026337 3300006237 Bacteria 4560
89 Ga0068871_100015595 3300006358 Bacteria 5694
90 Ga0075431_100006164 3300006847 Bacteria 11898
91 Ga0075431_100054603 3300006847 Bacteria 4119
92 Ga0075436_100026299 3300006914 Bacteria 4006
93 Ga0097620_100016557 3300006931 Bacteria 7402
94 Ga0075435_100049414 3300007076 Bacteria 3383
95 Ga0099794_10071565 3300007265 Bacteria 1699
96 Ga0105240_10000903 3300009093 Bacteria 53014
97 Ga0105240_10002616 3300009093 Bacteria 28749
98 Ga0105240_10021776 3300009093 Bacteria 8517
99 Ga0105240_10032891 3300009093 Bacteria 6707
100 Ga0105240_10072810 3300009093 Bacteria 4245
101 Ga0105240_10121221 3300009093 Bacteria 3148
102 Ga0105245_10002083 3300009098 Bacteria 18160
103 Ga0105245_10003047 3300009098 Bacteria 15009
104 Ga0105245_10010631 3300009098 Bacteria 8007
105 Ga0105245_10019206 3300009098 Bacteria 5985
106 Ga0105243_10020438 3300009148 Bacteria 5020
107 Ga0105243_10057967 3300009148 Bacteria 3085
108 Ga0105241_10033397 3300009174 Bacteria 3863
109 Ga0105248_10009955 3300009177 Bacteria 10467
110 Ga0105248_10018604 3300009177 Bacteria 7680
111 Ga0105248_10034546 3300009177 Bacteria 5655
112 Ga0105248_10048589 3300009177 Bacteria 4760
113 Ga0105248_10115869 3300009177 Bacteria 3022
114 Ga0105248_10173445 3300009177 Bacteria 2431
115 Ga0105248_10203335 3300009177 Bacteria 2232
116 Ga0105237_10006811 3300009545 Bacteria 12599
117 Ga0105237_10009958 3300009545 Bacteria 10142
118 Ga0105237_10036600 3300009545 Bacteria 4967
119 Ga0105237_10077921 3300009545 Bacteria 3304
120 Ga0105237_10194359 3300009545 Bacteria 2029
121 Ga0105237_10289760 3300009545 Bacteria 1640
122 Ga0105238_10006161 3300009551 Bacteria 11903
123 Ga0105238_10020785 3300009551 Bacteria 6686
124 Ga0105238_10090082 3300009551 Bacteria 3055
125 Ga0105239_10010040 3300010375 Bacteria 10614
126 Ga0105239_10017516 3300010375 Bacteria 7923
127 Ga0105239_10019392 3300010375 Bacteria 7509
128 Ga0105239_10119440 3300010375 Bacteria 2926
129 Ga0105239_10245070 3300010375 Bacteria 2012
130 Ga0105239_10412574 3300010375 Bacteria 1529
131 Ga0105246_10015230 3300011119 Bacteria 4852
132 Ga0105246_10112136 3300011119 Bacteria 2005
133 Ga0157370_10001720 3300013104 Bacteria 26945
134 Ga0157370_10005842 3300013104 Bacteria 13747
135 Ga0157370_10043585 3300013104 Bacteria 4316
136 Ga0157370_10054800 3300013104 Bacteria 3801
137 Ga0157370_10096396 3300013104 Bacteria 2775
138 Ga0157370_10146565 3300013104 Bacteria 2198
139 Ga0157370_10205463 3300013104 Bacteria 1826
140 Ga0157369_10004154 3300013105 Bacteria 17157
141 Ga0157369_10006100 3300013105 Bacteria 13992
142 Ga0157369_10013784 3300013105 Bacteria 9138
143 Ga0157369_10016811 3300013105 Bacteria 8223
144 Ga0157369_10017943 3300013105 Bacteria 7945
145 Ga0157369_10027593 3300013105 Bacteria 6291
146 Ga0157369_10030064 3300013105 Bacteria 5994
147 Ga0157369_10040564 3300013105 Bacteria 5081
148 Ga0157369_10118784 3300013105 Bacteria 2806
149 Ga0157369_10140129 3300013105 Bacteria 2559
150 Ga0157374_10003180 3300013296 Bacteria 13792
151 Ga0157374_10018388 3300013296 Bacteria 6166
152 Ga0157374_10019202 3300013296 Bacteria 6048
153 Ga0157378_10007993 3300013297 Bacteria 9233
154 Ga0157378_10017818 3300013297 Bacteria 6235
155 Ga0157378_10152434 3300013297 Bacteria 2154
156 Ga0157378_10167812 3300013297 Bacteria 2057
157 Ga0157378_10170110 3300013297 Bacteria 2043
158 Ga0163162_10003253 3300013306 Bacteria 15534
159 Ga0157372_10017408 3300013307 Bacteria 7713
160 Ga0157372_10025905 3300013307 Bacteria 6378
161 Ga0157372_10062938 3300013307 Bacteria 4158
162 Ga0157372_10088297 3300013307 Bacteria 3520
163 Ga0157372_10121594 3300013307 Bacteria 2999
164 Ga0157372_10165997 3300013307 Bacteria 2553
165 Ga0157372_10192188 3300013307 Bacteria 2364
166 Ga0157375_10019887 3300013308 Bacteria 6121
167 Ga0163163_10012609 3300014325 Bacteria 7707
168 Ga0163163_10312399 3300014325 Bacteria 1625
169 Ga0182008_10038939 3300014497 Bacteria 2376
170 Ga0157376_10017455 3300014969 Bacteria 5475
171 Ga0157376_10026840 3300014969 Bacteria 4556
172 Ga0157376_10033123 3300014969 Bacteria 4156
173 Ga0157376_10050613 3300014969 Bacteria 3447
174 Ga0182007_10006890 3300015262 Bacteria 4831
175 Ga0213872_10000901 3300021361 Bacteria 21377
176 Ga0213872_10002030 3300021361 Bacteria 12297
177 Ga0213872_10012963 3300021361 Bacteria 3910
178 Ga0213876_10002419 3300021384 Bacteria 10974
179 Ga0213875_10000769 3300021388 Bacteria 24016
180 Ga0207647_10001523 3300025904 Bacteria 17820
181 Ga0207699_10033347 3300025906 Bacteria 2910
182 Ga0207699_10037468 3300025906 Bacteria 2772
183 Ga0207705_10000013 3300025909 Bacteria 451680
184 Ga0207705_10000585 3300025909 Bacteria 30596
185 Ga0207705_10018627 3300025909 Bacteria 4964
186 Ga0207654_10002229 3300025911 Bacteria 9952
187 Ga0207654_10102072 3300025911 Unclassified 1769
188 Ga0207707_10030731 3300025912 Bacteria 4698
189 Ga0207707_10031492 3300025912 Bacteria 4641
190 Ga0207707_10041436 3300025912 Bacteria 4022
191 Ga0207707_10114360 3300025912 Bacteria 2358
192 Ga0207695_10003059 3300025913 Bacteria 23974
193 Ga0207695_10103576 3300025913 Bacteria 2837
194 Ga0207671_10007472 3300025914 Bacteria 9479
195 Ga0207671_10051340 3300025914 Bacteria 3056
196 Ga0207693_10000065 3300025915 Bacteria 91476
197 Ga0207693_10001204 3300025915 Bacteria 23045
198 Ga0207693_10026042 3300025915 Bacteria 4632
199 Ga0207693_10041550 3300025915 Bacteria 3620
200 Ga0207663_10054316 3300025916 Bacteria 2507
201 Ga0207663_10085139 3300025916 Bacteria 2081
202 Ga0207660_10018579 3300025917 Bacteria 4636
203 Ga0207660_10033768 3300025917 Bacteria 3542
204 Ga0207657_10000099 3300025919 Bacteria 83148
205 Ga0207657_10002042 3300025919 Bacteria 21838
206 Ga0207657_10029142 3300025919 Bacteria 5029
207 Ga0207649_10005481 3300025920 Bacteria 6866
208 Ga0207649_10083726 3300025920 Bacteria 2071
209 Ga0207652_10003176 3300025921 Bacteria 13673
210 Ga0207694_10009253 3300025924 Bacteria 7433
211 Ga0207650_10108040 3300025925 Bacteria 2150
212 Ga0207687_10004086 3300025927 Bacteria 9783
213 Ga0207687_10011383 3300025927 Bacteria 5815
214 Ga0207687_10017958 3300025927 Bacteria 4667
215 Ga0207687_10024489 3300025927 Bacteria 4033
216 Ga0207687_10026348 3300025927 Bacteria 3892
217 Ga0207700_10000988 3300025928 Bacteria 16396
218 Ga0207700_10002339 3300025928 Bacteria 10874
219 Ga0207700_10005050 3300025928 Bacteria 7849
220 Ga0207700_10028324 3300025928 Bacteria 3937
221 Ga0207700_10036669 3300025928 Bacteria 3544
222 Ga0207700_10071426 3300025928 Bacteria 2673
223 Ga0207664_10041378 3300025929 Bacteria 3589
224 Ga0207664_10126320 3300025929 Bacteria 2148
225 Ga0207690_10024883 3300025932 Bacteria 3753
226 Ga0207690_10049728 3300025932 Bacteria 2796
227 Ga0207706_10002670 3300025933 Bacteria 17375
228 Ga0207686_10025498 3300025934 Bacteria 3439
229 Ga0207709_10077688 3300025935 Bacteria 2129
230 Ga0207665_10011868 3300025939 Bacteria 5721
231 Ga0207665_10019608 3300025939 Unclassified 4447
232 Ga0207691_10203264 3300025940 Bacteria 1723
233 Ga0207711_10007259 3300025941 Bacteria 9285
234 Ga0207711_10008123 3300025941 Bacteria 8785
235 Ga0207711_10088678 3300025941 Bacteria 2716
236 Ga0207711_10097773 3300025941 Bacteria 2592
237 Ga0207711_10181977 3300025941 Bacteria 1912
238 Ga0207689_10033911 3300025942 Bacteria 4240
239 Ga0207661_10000020 3300025944 Bacteria 216011
240 Ga0207661_10033518 3300025944 Bacteria 3987
241 Ga0207661_10175872 3300025944 Bacteria 1866
242 Ga0207667_10015158 3300025949 Bacteria 8765
243 Ga0207667_10017720 3300025949 Bacteria 8011
244 Ga0207667_10022987 3300025949 Bacteria 6872
245 Ga0207667_10075770 3300025949 Bacteria 3492
246 Ga0207640_10020019 3300025981 Bacteria 3965
247 Ga0207677_10127546 3300026023 Bacteria 1925
248 Ga0207703_10017507 3300026035 Bacteria 5593
249 Ga0207703_10263718 3300026035 Bacteria 1558
250 Ga0207678_10003651 3300026067 Bacteria 13832
251 Ga0207678_10010640 3300026067 Bacteria 8082
252 Ga0207702_10134627 3300026078 Bacteria 2228
253 Ga0207641_10013496 3300026088 Bacteria 6700
254 Ga0207648_10047101 3300026089 Bacteria 3780
255 Ga0207676_10017137 3300026095 Bacteria 5248
256 Ga0207676_10050011 3300026095 Bacteria 3256
257 Ga0207676_10116418 3300026095 Bacteria 2246
258 Ga0207674_10005608 3300026116 Bacteria 14880
259 Ga0207683_10085124 3300026121 Bacteria 2811
260 Ga0207698_10028258 3300026142 Bacteria 3997
261 Ga0207698_10036137 3300026142 Bacteria 3623
262 Ga0268266_10000895 3300028379 Bacteria 38492
263 Ga0268266_10002668 3300028379 Bacteria 18781
264 Ga0268266_10004148 3300028379 Bacteria 13990
265 Ga0268266_10011773 3300028379 Bacteria 7585
266 Ga0268266_10069904 3300028379 Bacteria 3043
267 Ga0265338_10008294 3300028800 Bacteria 12644
268 Ga0265338_10037616 3300028800 Bacteria 4602
269 Ga0265320_10000655 3300031240 Bacteria 26440
270 Ga0265325_10002348 3300031241 Bacteria 12809
271 Ga0265325_10067996 3300031241 Bacteria 1794
272 Ga0265340_10032792 3300031247 Bacteria 2591
273 Ga0265339_10019402 3300031249 Bacteria 3992
274 Ga0265331_10002620 3300031250 Bacteria 12070
275 Ga0265331_10009609 3300031250 Bacteria 5419
276 Ga0265316_10003196 3300031344 Bacteria 16651
277 Ga0265316_10024356 3300031344 Bacteria 5074
278 Ga0265313_10024272 3300031595 Bacteria 3242
279 Ga0265314_10006088 3300031711 Bacteria 10720
280 Ga0265342_10026325 3300031712 Bacteria 3646
281 Ga0307510_10138407 3300033180 Bacteria 2085
282 Ga0373926_0001437 3300035083 Bacteria 7245
283 Ga0373926_0006952 3300035083 Bacteria 3761
284 Ga0373936_0011473 3300035113 Bacteria 3354
285 Ga0373954_0001548 3300035118 Bacteria 9372
286 Ga0373943_0006986 3300035170 Bacteria 5064
287 Ga0373955_0030623 3300035172 Bacteria 2811
288 Ga0373955_0032365 3300035172 Bacteria 2744
289 Ga0373955_0049618 3300035172 Bacteria 2279
290 Ga0316574_0139593 3300035398 Bacteria 1561
291 Ga0373924_0000010 3300035410 Bacteria 49782
292 Ga0373935_0133606 3300035692 Bacteria 1670
293 Ga0373927_0004655 3300035695 Bacteria 9565
294 Ga0373927_0035711 3300035695 Bacteria 3232
295 Ga0373947_0010835 3300035725 Bacteria 5232
296 Ga0373947_0020284 3300035725 Bacteria 3836
297 Ga0373947_0055007 3300035725 Unclassified 2403
298 Ga0373937_0000132 3300036401 Bacteria 72758
299 Ga0373937_0114044 3300036401 Bacteria 2515
300 Ga0373925_0001957 3300037068 Bacteria 17042
301 Ga0436364_0197022 3300037853 Bacteria 80312
302 Ga0436364_0309225 3300037853 Bacteria 9567
303 Ga0436364_1321514 3300037853 Bacteria 1880
304 Ga0436365_0420090 3300039437 Bacteria 19560
305 Ga0436365_1233600 3300039437 Bacteria 3192
306 Ga0436360_0027910 3300039438 Bacteria 1815
307 Ga0436360_0161883 3300039438 Bacteria 14356
308 Ga0436360_1036151 3300039438 Bacteria 10193
309 Ga0436361_0307406 3300039447 Bacteria 13409
310 Ga0436361_0696344 3300039447 Bacteria 16797
311 Ga0436361_0779674 3300039447 Bacteria 61407
312 Ga0436363_0145130 3300039450 Bacteria 3725
313 Ga0436363_1107018 3300039450 Bacteria 2784
314 Ga0436363_1371418 3300039450 Bacteria 2109
315 Ga0436363_1403142 3300039450 Bacteria 4242
316 Ga0436362_0525229 3300039453 Bacteria 2693
317 Ga0436362_1239677 3300039453 Bacteria 5399
318 Ga0466964_0046345 3300044706 Bacteria 1772
319 Ga0466959_0057283 3300045049 Bacteria 2841
320 Ga0466967_0144534 3300045976 Bacteria 2218
321 Ga0495603_0039861 3300046455 Bacteria 2813
322 Ga0495629_0006654 3300046459 Bacteria 8553
323 Ga0495629_0025160 3300046459 Bacteria 4234
324 Ga0495638_0075905 3300046460 Bacteria 2048
325 Ga0495650_0000038 3300046471 Bacteria 377530
326 Ga0495650_0006759 3300046471 Bacteria 7093
327 Ga0495650_0006951 3300046471 Bacteria 6921
328 Ga0495580_0001231 3300046472 Bacteria 22586
329 Ga0495580_0001517 3300046472 Bacteria 20424
330 Ga0495580_0001935 3300046472 Bacteria 18202
331 Ga0495580_0007097 3300046472 Bacteria 9027
332 Ga0495580_0083582 3300046472 Bacteria 2224
333 Ga0495582_0000405 3300046473 Bacteria 23553
334 Ga0495582_0003388 3300046473 Bacteria 8971
335 Ga0495582_0039217 3300046473 Bacteria 2608
336 Ga0495582_0123463 3300046473 Bacteria 1460
337 Ga0495639_0001954 3300046475 Bacteria 9140
338 Ga0495662_0001280 3300046476 Bacteria 12438
339 Ga0495664_0009472 3300046477 Bacteria 5451
340 Ga0495594_0000395 3300046499 Bacteria 21937
341 Ga0495594_0000883 3300046499 Bacteria 15463
342 Ga0495594_0010925 3300046499 Bacteria 4713
343 Ga0495583_0016461 3300046506 Bacteria 3972
344 Ga0495606_0060363 3300046507 Bacteria 2429
345 Ga0495608_0046086 3300046511 Bacteria 2903
346 Ga0495616_0053817 3300046513 Bacteria 1999
347 Ga0495644_0000219 3300046523 Bacteria 26962
348 Ga0495666_0000810 3300046526 Bacteria 14490
349 Ga0495652_0006431 3300046529 Bacteria 10927
350 Ga0495652_0007766 3300046529 Bacteria 9859
351 Ga0495652_0061067 3300046529 Bacteria 3183
352 Ga0495652_0073899 3300046529 Bacteria 2837
353 Ga0495652_0104318 3300046529 Bacteria 2293
354 Ga0495665_0002595 3300046531 Bacteria 9747
355 Ga0495665_0041815 3300046531 Bacteria 2440
356 Ga0495665_0049962 3300046531 Bacteria 2217
357 Ga0495640_0007633 3300046533 Bacteria 8502
358 Ga0495586_0002392 3300046535 Bacteria 10193
359 Ga0495587_0083537 3300046536 Bacteria 1850
360 Ga0495645_0002780 3300046543 Bacteria 11868
361 Ga0495645_0014391 3300046543 Bacteria 5613
362 Ga0495645_0117287 3300046543 Bacteria 1878
363 Ga0495633_0034650 3300046558 Bacteria 2427
364 Ga0495667_0003008 3300046559 Bacteria 11307
365 Ga0495667_0014467 3300046559 Bacteria 5331
366 Ga0495667_0072599 3300046559 Bacteria 2243
367 Ga0495667_0170482 3300046559 Bacteria 1398
368 Ga0495634_0008727 3300046642 Bacteria 7516
369 Ga0495625_0024832 3300046660 Bacteria 4553
370 Ga0495625_0039604 3300046660 Bacteria 3440
371 Ga0495635_0011585 3300046663 Bacteria 6181
372 Ga0495659_0019591 3300046664 Bacteria 2264
373 Ga0495661_0020075 3300046665 Bacteria 4370
374 Ga0495599_0004912 3300046678 Bacteria 7944
375 Ga0495623_0014292 3300046679 Bacteria 5141
376 Ga0495613_0004130 3300046689 Bacteria 10864
377 Ga0495613_0058484 3300046689 Bacteria 2829
378 Ga0495624_0003027 3300046690 Bacteria 12587
379 Ga0495649_0007234 3300046694 Bacteria 6800
380 Ga0495600_0050474 3300046809 Bacteria 2715
381 Ga0495581_0012382 3300047315 Bacteria 4941
382 Ga0495604_0015963 3300047317 Bacteria 5995
383 Ga0495604_0021328 3300047317 Bacteria 5171
384 Ga0495674_0017116 3300047319 Bacteria 6751
385 Ga0495674_0038007 3300047319 Bacteria 4324
386 Ga0495674_0052634 3300047319 Bacteria 3581
387 Ga0495674_0192236 3300047319 Bacteria 1696
388 Ga0495676_0005277 3300047321 Bacteria 11829
389 Ga0495680_0024503 3300047322 Bacteria 5005
390 Ga0495675_0026103 3300047444 Bacteria 3724
391 Ga0495677_0025532 3300047445 Bacteria 2144
392 Ga0495684_0014270 3300047471 Bacteria 6113
393 Ga0495686_0000031 3300047472 Bacteria 350171
394 Ga0495686_0002398 3300047472 Bacteria 17807
395 Ga0495686_0003361 3300047472 Bacteria 13943
396 Ga0495686_0007930 3300047472 Bacteria 7882
397 Ga0495602_0039630 3300048088 Bacteria 4336
398 Ga0495602_0069298 3300048088 Bacteria 3024
399 Ga0496100_0115006 3300048903 Bacteria 1875
400 Ga0496102_0099614 3300048905 Bacteria 2698
401 Ga0496103_0026334 3300048906 Bacteria 3521
402 Ga0496104_0000276 3300048907 Bacteria 45779
403 Ga0496104_0094575 3300048907 Bacteria 2859
404 Ga0496104_0357333 3300048907 Bacteria 1373
405 Ga0496105_0004114 3300048908 Bacteria 10907
406 Ga0496105_0049696 3300048908 Bacteria 3463
407 Ga0496105_0081353 3300048908 Bacteria 2675
408 Ga0496108_0028874 3300048911 Bacteria 4590
409 Ga0496112_0014614 3300048915 Bacteria 7295
410 Ga0496112_0020790 3300048915 Bacteria 6229
411 Ga0496112_0066646 3300048915 Bacteria 3553
412 Ga0496112_0205666 3300048915 Bacteria 1927
413 Ga0496113_0009235 3300048916 Bacteria 6469
414 Ga0496115_0194455 3300048918 Bacteria 1676
415 Ga0496126_0000004 3300048929 Bacteria 925026
416 Ga0496126_0000150 3300048929 Bacteria 162748
417 Ga0496126_0000770 3300048929 Bacteria 57986
418 Ga0496126_0010867 3300048929 Bacteria 9487
419 Ga0496126_0055369 3300048929 Bacteria 3589
420 Ga0501036_0003961 3300049572 Bacteria 11901
421 Ga0501037_0007912 3300049573 Bacteria 7791
422 Ga0501043_0003276 3300049579 Bacteria 13348
423 Ga0501046_0002059 3300049580 Bacteria 19089
424 Ga0501047_0011843 3300049581 Bacteria 8248
425 Ga0501047_0147313 3300049581 Bacteria 2230
426 Ga0501048_0126374 3300049582 Bacteria 1808
427 Ga0501073_0031613 3300049589 Bacteria 3776
428 Ga0501073_0064891 3300049589 Bacteria 2546
429 Ga0501074_0107651 3300049590 Bacteria 1995
430 Ga0501080_0010542 3300049742 Bacteria 8464
431 Ga0501035_0030526 3300049822 Bacteria 4911
432 Ga0501035_0194021 3300049822 Bacteria 1745
433 Ga0501044_0044860 3300049823 Bacteria 4584
434 nmdc:mga06r32_10934_c1 3300050510 Bacteria 8173
435 nmdc:mga0n895_195090_c1 3300050512 Bacteria 2056
436 nmdc:mga0rr50_23467_c1 3300050513 Bacteria 4254
437 nmdc:mga08x19_170_c1 3300050514 Bacteria 54086
438 nmdc:mga08x19_53719_c1 3300050514 Bacteria 2592
439 Ga0495601_0021899 3300053077 Bacteria 3920
440 Ga0500651_0000005 3300053093 Bacteria 384761
441 Ga0500595_000011 3300053119 Bacteria 268589
442 Ga0501082_0024694 3300060353 Bacteria 5180
443 Ga0207668_10065760
444 rootH1_10065962
445 Ga0070658_10000007
446 Ga0070658_10016767
447 Ga0070658_10030777
448 Ga0070683_100000063
449 Ga0070683_100017801
450 Ga0070683_100027721
451 Ga0070683_100065441
452 Ga0070670_100022763
453 Ga0070670_100045281
454 Ga0070660_100009595
455 Ga0070660_100017843
456 Ga0070660_100098540
457 Ga0070661_100008049
458 Ga0070661_100115979
459 Ga0070692_10011885
460 Ga0070671_100000429
461 Ga0070659_100003992
462 Ga0070659_100033495
463 Ga0070659_100075807
464 Ga0070709_10001219
465 Ga0070709_10069120
466 Ga0070714_100076807
467 Ga0070714_100079446
468 Ga0070713_100000461
469 Ga0070713_100001905
470 Ga0070713_100029875
471 Ga0070713_100051997
472 Ga0070711_100052412
473 Ga0070711_100090159
474 Ga0070708_100007563
475 Ga0070663_100019462
476 Ga0070678_100019714
477 Ga0070678_100045787
478 Ga0070662_100077109
479 Ga0070662_100133781
480 Ga0070681_10007366
481 Ga0070681_10009425
482 Ga0070681_10023633
483 Ga0070681_10087148
484 Ga0070699_100000753
485 Ga0070699_100025672
486 Ga0070679_100002145
487 Ga0070679_100021139
488 Ga0070679_100097887
489 Ga0070679_100179955
490 Ga0070684_100000089
491 Ga0070684_100009023
492 Ga0070684_100032260
493 Ga0070684_100116079
494 Ga0068853_100025543
495 Ga0068853_100045286
496 Ga0068853_100091136
497 Ga0070665_100022304
498 Ga0070665_100025415
499 Ga0068855_100009876
500 Ga0068855_100030240
501 Ga0068855_100057365
502 Ga0070664_100013503
503 Ga0070664_100034658
504 Ga0068857_100025768
505 Ga0068854_100002891
506 Ga0068856_100017545
507 Ga0068856_100042762
508 Ga0068856_100046391
509 Ga0068852_100034025
510 Ga0068852_100038794
511 Ga0068852_100042908
512 Ga0068859_100016556
513 Ga0068864_100008637
514 Ga0068864_100019140
515 Ga0068864_100065073
516 Ga0068851_10003533
517 Ga0068863_100006574
518 Ga0068863_100020699
519 Ga0068858_100048646
520 Ga0068858_100237910
521 Ga0068860_100043909
522 Ga0081539_10001130
523 Ga0070717_10015061
524 Ga0070717_10033023
525 Ga0070717_10066758
526 Ga0070716_100056595
527 Ga0070712_100000506
528 Ga0070712_100045778
529 Ga0070712_100120836
530 Ga0097621_100026337
531 Ga0068871_100015595
532 Ga0075431_100006164
533 Ga0075431_100054603
534 Ga0075436_100026299
535 Ga0097620_100016557
536 Ga0075435_100049414
537 Ga0099794_10071565
538 Ga0105240_10000903
539 Ga0105240_10002616
540 Ga0105240_10021776
541 Ga0105240_10032891
542 Ga0105240_10072810
543 Ga0105240_10121221
544 Ga0105245_10002083
545 Ga0105245_10003047
546 Ga0105245_10010631
547 Ga0105245_10019206
548 Ga0105243_10020438
549 Ga0105243_10057967
550 Ga0105241_10033397
551 Ga0105248_10009955
552 Ga0105248_10018604
553 Ga0105248_10034546
554 Ga0105248_10048589
555 Ga0105248_10115869
556 Ga0105248_10173445
557 Ga0105248_10203335
558 Ga0105237_10006811
559 Ga0105237_10009958
560 Ga0105237_10036600
561 Ga0105237_10077921
562 Ga0105237_10194359
563 Ga0105237_10289760
564 Ga0105238_10006161
565 Ga0105238_10020785
566 Ga0105238_10090082
567 Ga0105239_10010040
568 Ga0105239_10017516
569 Ga0105239_10019392
570 Ga0105239_10119440
571 Ga0105239_10245070
572 Ga0105239_10412574
573 Ga0105246_10015230
574 Ga0105246_10112136
575 Ga0157370_10001720
576 Ga0157370_10005842
577 Ga0157370_10043585
578 Ga0157370_10054800
579 Ga0157370_10096396
580 Ga0157370_10146565
581 Ga0157370_10205463
582 Ga0157369_10004154
583 Ga0157369_10006100
584 Ga0157369_10013784
585 Ga0157369_10016811
586 Ga0157369_10017943
587 Ga0157369_10027593
588 Ga0157369_10030064
589 Ga0157369_10040564
590 Ga0157369_10118784
591 Ga0157369_10140129
592 Ga0157374_10003180
593 Ga0157374_10018388
594 Ga0157374_10019202
595 Ga0157378_10007993
596 Ga0157378_10017818
597 Ga0157378_10152434
598 Ga0157378_10167812
599 Ga0157378_10170110
600 Ga0163162_10003253
601 Ga0157372_10017408
602 Ga0157372_10025905
603 Ga0157372_10062938
604 Ga0157372_10088297
605 Ga0157372_10121594
606 Ga0157372_10165997
607 Ga0157372_10192188
608 Ga0157375_10019887
609 Ga0163163_10012609
610 Ga0163163_10312399
611 Ga0182008_10038939
612 Ga0157376_10017455
613 Ga0157376_10026840
614 Ga0157376_10033123
615 Ga0157376_10050613
616 Ga0182007_10006890
617 Ga0213872_10000901
618 Ga0213872_10002030
619 Ga0213872_10012963
620 Ga0213876_10002419
621 Ga0213875_10000769
622 Ga0207647_10001523
623 Ga0207699_10033347
624 Ga0207699_10037468
625 Ga0207705_10000013
626 Ga0207705_10000585
627 Ga0207705_10018627
628 Ga0207654_10002229
629 Ga0207654_10102072
630 Ga0207707_10030731
631 Ga0207707_10031492
632 Ga0207707_10041436
633 Ga0207707_10114360
634 Ga0207695_10003059
635 Ga0207695_10103576
636 Ga0207671_10007472
637 Ga0207671_10051340
638 Ga0207693_10000065
639 Ga0207693_10001204
640 Ga0207693_10026042
641 Ga0207693_10041550
642 Ga0207663_10054316
643 Ga0207663_10085139
644 Ga0207660_10018579
645 Ga0207660_10033768
646 Ga0207657_10000099
647 Ga0207657_10002042
648 Ga0207657_10029142
649 Ga0207649_10005481
650 Ga0207649_10083726
651 Ga0207652_10003176
652 Ga0207694_10009253
653 Ga0207650_10108040
654 Ga0207687_10004086
655 Ga0207687_10011383
656 Ga0207687_10017958
657 Ga0207687_10024489
658 Ga0207687_10026348
659 Ga0207700_10000988
660 Ga0207700_10002339
661 Ga0207700_10005050
662 Ga0207700_10028324
663 Ga0207700_10036669
664 Ga0207700_10071426
665 Ga0207664_10041378
666 Ga0207664_10126320
667 Ga0207690_10024883
668 Ga0207690_10049728
669 Ga0207706_10002670
670 Ga0207686_10025498
671 Ga0207709_10077688
672 Ga0207665_10011868
673 Ga0207665_10019608
674 Ga0207691_10203264
675 Ga0207711_10007259
676 Ga0207711_10008123
677 Ga0207711_10088678
678 Ga0207711_10097773
679 Ga0207711_10181977
680 Ga0207689_10033911
681 Ga0207661_10000020
682 Ga0207661_10033518
683 Ga0207661_10175872
684 Ga0207667_10015158
685 Ga0207667_10017720
686 Ga0207667_10022987
687 Ga0207667_10075770
688 Ga0207640_10020019
689 Ga0207677_10127546
690 Ga0207703_10017507
691 Ga0207703_10263718
692 Ga0207678_10003651
693 Ga0207678_10010640
694 Ga0207702_10134627
695 Ga0207641_10013496
696 Ga0207648_10047101
697 Ga0207676_10017137
698 Ga0207676_10050011
699 Ga0207676_10116418
700 Ga0207674_10005608
701 Ga0207683_10085124
702 Ga0207698_10028258
703 Ga0207698_10036137
704 Ga0268266_10000895
705 Ga0268266_10002668
706 Ga0268266_10004148
707 Ga0268266_10011773
708 Ga0268266_10069904
709 Ga0265338_10008294
710 Ga0265338_10037616
711 Ga0265320_10000655
712 Ga0265325_10002348
713 Ga0265325_10067996
714 Ga0265340_10032792
715 Ga0265339_10019402
716 Ga0265331_10002620
717 Ga0265331_10009609
718 Ga0265316_10003196
719 Ga0265316_10024356
720 Ga0265313_10024272
721 Ga0265314_10006088
722 Ga0265342_10026325
723 Ga0307510_10138407
724 Ga0373926_0001437
725 Ga0373926_0006952
726 Ga0373936_0011473
727 Ga0373954_0001548
728 Ga0373943_0006986
729 Ga0373955_0030623
730 Ga0373955_0032365
731 Ga0373955_0049618
732 Ga0316574_0139593
733 Ga0373924_0000010
734 Ga0373935_0133606
735 Ga0373927_0004655
736 Ga0373927_0035711
737 Ga0373947_0010835
738 Ga0373947_0020284
739 Ga0373947_0055007
740 Ga0373937_0000132
741 Ga0373937_0114044
742 Ga0373925_0001957
743 Ga0436364_0197022
744 Ga0436364_0309225
745 Ga0436364_1321514
746 Ga0436365_0420090
747 Ga0436365_1233600
748 Ga0436360_0027910
749 Ga0436360_0161883
750 Ga0436360_1036151
751 Ga0436361_0307406
752 Ga0436361_0696344
753 Ga0436361_0779674
754 Ga0436363_0145130
755 Ga0436363_1107018
756 Ga0436363_1371418
757 Ga0436363_1403142
758 Ga0436362_0525229
759 Ga0436362_1239677
760 Ga0466964_0046345
761 Ga0466959_0057283
762 Ga0466967_0144534
763 Ga0495603_0039861
764 Ga0495629_0006654
765 Ga0495629_0025160
766 Ga0495638_0075905
767 Ga0495650_0000038
768 Ga0495650_0006759
769 Ga0495650_0006951
770 Ga0495580_0001231
771 Ga0495580_0001517
772 Ga0495580_0001935
773 Ga0495580_0007097
774 Ga0495580_0083582
775 Ga0495582_0000405
776 Ga0495582_0003388
777 Ga0495582_0039217
778 Ga0495582_0123463
779 Ga0495639_0001954
780 Ga0495662_0001280
781 Ga0495664_0009472
782 Ga0495594_0000395
783 Ga0495594_0000883
784 Ga0495594_0010925
785 Ga0495583_0016461
786 Ga0495606_0060363
787 Ga0495608_0046086
788 Ga0495616_0053817
789 Ga0495644_0000219
790 Ga0495666_0000810
791 Ga0495652_0006431
792 Ga0495652_0007766
793 Ga0495652_0061067
794 Ga0495652_0073899
795 Ga0495652_0104318
796 Ga0495665_0002595
797 Ga0495665_0041815
798 Ga0495665_0049962
799 Ga0495640_0007633
800 Ga0495586_0002392
801 Ga0495587_0083537
802 Ga0495645_0002780
803 Ga0495645_0014391
804 Ga0495645_0117287
805 Ga0495633_0034650
806 Ga0495667_0003008
807 Ga0495667_0014467
808 Ga0495667_0072599
809 Ga0495667_0170482
810 Ga0495634_0008727
811 Ga0495625_0024832
812 Ga0495625_0039604
813 Ga0495635_0011585
814 Ga0495659_0019591
815 Ga0495661_0020075
816 Ga0495599_0004912
817 Ga0495623_0014292
818 Ga0495613_0004130
819 Ga0495613_0058484
820 Ga0495624_0003027
821 Ga0495649_0007234
822 Ga0495600_0050474
823 Ga0495581_0012382
824 Ga0495604_0015963
825 Ga0495604_0021328
826 Ga0495674_0017116
827 Ga0495674_0038007
828 Ga0495674_0052634
829 Ga0495674_0192236
830 Ga0495676_0005277
831 Ga0495680_0024503
832 Ga0495675_0026103
833 Ga0495677_0025532
834 Ga0495684_0014270
835 Ga0495686_0000031
836 Ga0495686_0002398
837 Ga0495686_0003361
838 Ga0495686_0007930
839 Ga0495602_0039630
840 Ga0495602_0069298
841 Ga0496100_0115006
842 Ga0496102_0099614
843 Ga0496103_0026334
844 Ga0496104_0000276
845 Ga0496104_0094575
846 Ga0496104_0357333
847 Ga0496105_0004114
848 Ga0496105_0049696
849 Ga0496105_0081353
850 Ga0496108_0028874
851 Ga0496112_0014614
852 Ga0496112_0020790
853 Ga0496112_0066646
854 Ga0496112_0205666
855 Ga0496113_0009235
856 Ga0496115_0194455
857 Ga0496126_0000004
858 Ga0496126_0000150
859 Ga0496126_0000770
860 Ga0496126_0010867
861 Ga0496126_0055369
862 Ga0501036_0003961
863 Ga0501037_0007912
864 Ga0501043_0003276
865 Ga0501046_0002059
866 Ga0501047_0011843
867 Ga0501047_0147313
868 Ga0501048_0126374
869 Ga0501073_0031613
870 Ga0501073_0064891
871 Ga0501074_0107651
872 Ga0501080_0010542
873 Ga0501035_0030526
874 Ga0501035_0194021
875 Ga0501044_0044860
876 nmdc:mga06r32_10934_c1
877 nmdc:mga0n895_195090_c1
878 nmdc:mga0rr50_23467_c1
879 nmdc:mga08x19_170_c1
880 nmdc:mga08x19_53719_c1
881 Ga0495601_0021899
882 Ga0500651_0000005
883 Ga0500595_000011
884 Ga0501082_0024694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00909

Ammonium_transp

Ammonium Transporter Family

124

531

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c1h-assembly1.cif.gz_A substrate binding, deprotonation and selectivity at the periplasmic entrance of the e. coli ammonia channel amtb 0.9597 35 430
2npg-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.957 35 430
3c1i-assembly1.cif.gz_A substrate binding, deprotonation and selectivity at the periplasmic entrance of the e. coli ammonia channel amtb 0.9562 35 430
2npe-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9559 35 430
2npj-assembly1.cif.gz_A an unusual twin-his arrangement in the pore of ammonia channels is essential for substrate conductance 0.9551 35 430
ID Description Score Start End Superfamily
af_Q2FWL9_1_414_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9673 38 450 1.10.3430.10
2npdA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.954 35 430 1.10.3430.10
2b2hA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9536 37 449 1.10.3430.10
2b2hA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9465 37 449 1.10.3430.10
2npdA00 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.9464 35 430 1.10.3430.10
ID Description Score Start End GO Terms
AF-A0A522YD66-F1-model_v4 Ammonium transporter 0.9919 37 182 GO:0005886
GO:0008519
AF-A0A6C8EDF1-F1-model_v4 Ammonium transporter 0.9793 39 449 GO:0005886
GO:0008519
AF-A0A519UQN0-F1-model_v4 Ammonium transporter 0.9791 39 259 GO:0005886
GO:0008519
AF-A0A380H119-F1-model_v4 Probabale ammonium transporter 0.9788 39 188 GO:0005886
GO:0008519
AF-A0A4R6ZME6-F1-model_v4 Ammonium transporter 0.9786 39 449 GO:0005886
GO:0008519

Map