F444896

General Info

Members Datasets Scaffolds Average Seq Length
442 278 431 205

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10288121|Ga0207708_102881211
Length 232
Sequence MARAPWSEARAPDVILFASLEVHSHAMKLIGSSTSPFVRKARIALTEKRIDYEFVLAKPFAPDAQIAQLNPLGKVPVLLIDDGGAIYDSSVIVEYLDTISPVGRLIPEPGRQRIQVKRWEALADGLLDAATLVVLERRRPEQQQSREWIDRHNTKVSDALRAAAHDLGERVWCAGDSYTLADIALGCALGYLDFRFPDLGWRTQHPNLVRHAEKLFKRPPFQATAPYDIAAA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
8 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
9 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
10 2547132512 Azospira oryzae 6a3 Isolate Unclassified
11 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
260 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
276 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0
Isolates 2.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0
Rhizoplane 0.9
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002086 3300002738 Bacteria 5659
2 JGI25157J39369_1000341 3300002741 Bacteria 33014
3 Ga0055539_1000813 3300003752 Bacteria 7359
4 Ga0055540_1020591 3300003792 Bacteria 1739
5 Ga0055531_10000333 3300003794 Bacteria 46562
6 Ga0070658_10159985 3300005327 Bacteria 1889
7 Ga0070658_10210006 3300005327 Bacteria 1644
8 Ga0070658_10528907 3300005327 Bacteria 1020
9 Ga0070683_100103219 3300005329 Bacteria 2686
10 Ga0070683_100178286 3300005329 Bacteria 2017
11 Ga0070690_100126581 3300005330 Bacteria 1720
12 Ga0070690_100347415 3300005330 Bacteria 1076
13 Ga0070670_100106488 3300005331 Bacteria 2416
14 Ga0070670_100587776 3300005331 Bacteria 995
15 Ga0070670_100635965 3300005331 Unclassified 956
16 Ga0070677_10022168 3300005333 Bacteria 2336
17 Ga0068869_100157188 3300005334 Bacteria 1767
18 Ga0070682_100099504 3300005337 Bacteria 1917
19 Ga0068868_100434152 3300005338 Bacteria 1139
20 Ga0070660_100076788 3300005339 Bacteria 2616
21 Ga0070689_100279873 3300005340 Bacteria 1384
22 Ga0070689_100379212 3300005340 Bacteria 1191
23 Ga0070687_100311439 3300005343 Bacteria 1002
24 Ga0070687_100714162 3300005343 Bacteria 701
25 Ga0070661_100152080 3300005344 Bacteria 1750
26 Ga0070692_10173057 3300005345 Bacteria 1246
27 Ga0070668_100039023 3300005347 Bacteria 3632
28 Ga0070668_100461220 3300005347 Bacteria 1094
29 Ga0070675_100186954 3300005354 Bacteria 1793
30 Ga0070675_100304647 3300005354 Bacteria 1404
31 Ga0070671_100299733 3300005355 Bacteria 1368
32 Ga0070674_100017035 3300005356 Bacteria 4561
33 Ga0070674_100018234 3300005356 Bacteria 4434
34 Ga0070673_100066421 3300005364 Bacteria 2881
35 Ga0070659_100078481 3300005366 Bacteria 2634
36 Ga0070659_100563466 3300005366 Bacteria 976
37 Ga0070701_10283865 3300005438 Bacteria 1012
38 Ga0070663_100000730 3300005455 Bacteria 17702
39 Ga0070681_10744858 3300005458 Bacteria 896
40 Ga0068867_100000076 3300005459 Bacteria 59983
41 Ga0068867_100213374 3300005459 Bacteria 1551
42 Ga0070679_100083376 3300005530 Bacteria 3185
43 Ga0070679_100109390 3300005530 Bacteria 2750
44 Ga0070684_100396948 3300005535 Bacteria 1271
45 Ga0070684_100903757 3300005535 Bacteria 827
46 Ga0068853_100137498 3300005539 Bacteria 2191
47 Ga0068853_100412959 3300005539 Bacteria 1265
48 Ga0070672_100236545 3300005543 Bacteria 1535
49 Ga0070672_100280548 3300005543 Bacteria 1408
50 Ga0070672_100694915 3300005543 Bacteria 890
51 Ga0070686_100805230 3300005544 Bacteria 758
52 Ga0070696_100383884 3300005546 Bacteria 1095
53 Ga0070665_100296405 3300005548 Bacteria 1620
54 Ga0070704_100135181 3300005549 Bacteria 1917
55 Ga0070704_100185198 3300005549 Bacteria 1669
56 Ga0068855_100032493 3300005563 Bacteria 6231
57 Ga0068855_100099397 3300005563 Bacteria 3351
58 Ga0068855_100219994 3300005563 Bacteria 2130
59 Ga0068855_100236568 3300005563 Bacteria 2042
60 Ga0068855_100313765 3300005563 Bacteria 1734
61 Ga0070664_100337726 3300005564 Bacteria 1368
62 Ga0068857_100009087 3300005577 Bacteria 8622
63 Ga0068857_100030365 3300005577 Bacteria 4772
64 Ga0068857_100080298 3300005577 Bacteria 2912
65 Ga0068857_101328635 3300005577 Bacteria 698
66 Ga0068854_100145135 3300005578 Bacteria 1825
67 Ga0068854_100570574 3300005578 Bacteria 962
68 Ga0068856_100003535 3300005614 Bacteria 15759
69 Ga0068856_100279896 3300005614 Bacteria 1685
70 Ga0070702_100182463 3300005615 Bacteria 1374
71 Ga0068852_100050911 3300005616 Bacteria 3552
72 Ga0068852_100051638 3300005616 Bacteria 3530
73 Ga0068852_100109179 3300005616 Bacteria 2512
74 Ga0068859_100254164 3300005617 Bacteria 1848
75 Ga0068859_100471940 3300005617 Bacteria 1350
76 Ga0068864_100052156 3300005618 Bacteria 3525
77 Ga0068864_100782934 3300005618 Bacteria 936
78 Ga0068866_10446444 3300005718 Unclassified 845
79 Ga0068861_100322036 3300005719 Bacteria 1347
80 Ga0068870_10168645 3300005840 Bacteria 1304
81 Ga0068863_100124845 3300005841 Bacteria 2455
82 Ga0068863_100133824 3300005841 Bacteria 2368
83 Ga0068858_100100429 3300005842 Bacteria 2698
84 Ga0068858_100185812 3300005842 Bacteria 1963
85 Ga0068860_100294331 3300005843 Bacteria 1589
86 Ga0068862_100191911 3300005844 Bacteria 1838
87 Ga0068862_100377456 3300005844 Bacteria 1321
88 Ga0075365_10216108 3300006038 Bacteria 1344
89 Ga0075365_10226327 3300006038 Bacteria 1312
90 Ga0075365_10693435 3300006038 Bacteria 719
91 Ga0075363_100107043 3300006048 Bacteria 1551
92 Ga0075363_100358400 3300006048 Bacteria 853
93 Ga0075362_10039117 3300006177 Bacteria 2084
94 Ga0075366_10180638 3300006195 Bacteria 1282
95 Ga0075366_10517788 3300006195 Bacteria 738
96 Ga0097621_100342685 3300006237 Bacteria 1327
97 Ga0097621_100366017 3300006237 Bacteria 1285
98 Ga0068871_100041736 3300006358 Bacteria 3680
99 Ga0068871_100042413 3300006358 Bacteria 3652
100 Ga0075428_100061373 3300006844 Bacteria 4117
101 Ga0075428_100550672 3300006844 Bacteria 1233
102 Ga0075428_101268658 3300006844 Bacteria 775
103 Ga0075430_100039475 3300006846 Bacteria 3997
104 Ga0075431_101019399 3300006847 Bacteria 794
105 Ga0075429_100142563 3300006880 Bacteria 2097
106 Ga0075429_100704502 3300006880 Unclassified 884
107 Ga0068865_100337846 3300006881 Bacteria 1216
108 Ga0097620_100254167 3300006931 Bacteria 1848
109 Ga0097620_100471888 3300006931 Bacteria 1350
110 Ga0097620_100806912 3300006931 Bacteria 1026
111 Ga0105240_10012435 3300009093 Bacteria 11750
112 Ga0105240_10445964 3300009093 Bacteria 1449
113 Ga0105240_10593469 3300009093 Bacteria 1220
114 Ga0111539_10026639 3300009094 Bacteria 7067
115 Ga0111539_10361201 3300009094 Bacteria 1690
116 Ga0105245_10007063 3300009098 Bacteria 9851
117 Ga0105245_10235905 3300009098 Bacteria 1771
118 Ga0114129_10330496 3300009147 Bacteria 2024
119 Ga0105243_10001449 3300009148 Bacteria 20854
120 Ga0105243_10177497 3300009148 Bacteria 1850
121 Ga0105241_10050428 3300009174 Bacteria 3172
122 Ga0105242_10077242 3300009176 Bacteria 2778
123 Ga0105242_10200343 3300009176 Bacteria 1773
124 Ga0105248_10038120 3300009177 Bacteria 5378
125 Ga0105248_10859542 3300009177 Bacteria 1024
126 Ga0105237_10007206 3300009545 Bacteria 12208
127 Ga0105238_10031327 3300009551 Bacteria 5413
128 Ga0105238_10079743 3300009551 Bacteria 3263
129 Ga0105238_10181049 3300009551 Bacteria 2084
130 Ga0105249_10296333 3300009553 Bacteria 1621
131 Ga0105239_10038998 3300010375 Bacteria 5204
132 Ga0105239_10367280 3300010375 Bacteria 1626
133 Ga0105239_10709759 3300010375 Bacteria 1150
134 Ga0157373_10217299 3300013100 Bacteria 1348
135 Ga0157369_10081455 3300013105 Bacteria 3464
136 Ga0157374_10136348 3300013296 Bacteria 2380
137 Ga0157374_10282946 3300013296 Bacteria 1638
138 Ga0157374_10897704 3300013296 Bacteria 904
139 Ga0157378_10421247 3300013297 Bacteria 1320
140 Ga0163162_10285152 3300013306 Bacteria 1783
141 Ga0163162_11101077 3300013306 Bacteria 900
142 Ga0157375_10138648 3300013308 Bacteria 2558
143 Ga0157375_10411203 3300013308 Bacteria 1519
144 Ga0163163_10020142 3300014325 Bacteria 6279
145 Ga0163163_11543511 3300014325 Bacteria 725
146 Ga0157380_10209302 3300014326 Bacteria 1737
147 Ga0157377_10000006 3300014745 Bacteria 419853
148 Ga0157377_10181625 3300014745 Bacteria 1323
149 Ga0157379_10361461 3300014968 Bacteria 1330
150 Ga0157376_10004513 3300014969 Bacteria 9701
151 Ga0157376_10131339 3300014969 Bacteria 2235
152 Ga0157376_10458794 3300014969 Unclassified 1245
153 Ga0163161_10010630 3300017792 Bacteria 6373
154 Ga0209646_1000012 3300025246 Bacteria 573300
155 Ga0209026_1000004 3300025250 Bacteria 949012
156 Ga0209677_100150 3300025253 Bacteria 64346
157 Ga0209759_1000003 3300025256 Bacteria 792130
158 Ga0209759_1000067 3300025256 Bacteria 183764
159 Ga0209673_1011484 3300025273 Bacteria 3647
160 Ga0209673_1024619 3300025273 Bacteria 2018
161 Ga0209130_1017550 3300025284 Bacteria 1703
162 Ga0209051_1000214 3300025303 Bacteria 98444
163 Ga0209257_1000015 3300025304 Bacteria 908141
164 Ga0207682_10001068 3300025893 Bacteria 12641
165 Ga0207642_10120935 3300025899 Bacteria 1350
166 Ga0207642_10323562 3300025899 Bacteria 901
167 Ga0207688_10033843 3300025901 Bacteria 2828
168 Ga0207645_10012872 3300025907 Bacteria 5662
169 Ga0207705_10353125 3300025909 Bacteria 1133
170 Ga0207705_10380505 3300025909 Bacteria 1090
171 Ga0207654_10087740 3300025911 Bacteria 1888
172 Ga0207654_10538426 3300025911 Bacteria 828
173 Ga0207707_10048305 3300025912 Bacteria 3707
174 Ga0207695_10074404 3300025913 Bacteria 3459
175 Ga0207671_10017207 3300025914 Bacteria 5584
176 Ga0207662_10015271 3300025918 Bacteria 4321
177 Ga0207657_10011675 3300025919 Bacteria 8706
178 Ga0207657_10058343 3300025919 Bacteria 3322
179 Ga0207657_10659520 3300025919 Bacteria 814
180 Ga0207649_10084544 3300025920 Bacteria 2063
181 Ga0207652_10028160 3300025921 Bacteria 4686
182 Ga0207652_10113141 3300025921 Bacteria 2409
183 Ga0207652_10184636 3300025921 Bacteria 1875
184 Ga0207681_10340461 3300025923 Bacteria 1198
185 Ga0207694_10024111 3300025924 Bacteria 4620
186 Ga0207694_10092064 3300025924 Bacteria 2393
187 Ga0207650_10007896 3300025925 Bacteria 7250
188 Ga0207659_10057211 3300025926 Bacteria 2795
189 Ga0207659_10134104 3300025926 Bacteria 1915
190 Ga0207687_10973206 3300025927 Bacteria 727
191 Ga0207644_10115095 3300025931 Bacteria 2039
192 Ga0207686_10159651 3300025934 Bacteria 1579
193 Ga0207709_10001013 3300025935 Bacteria 20832
194 Ga0207669_10303589 3300025937 Bacteria 1214
195 Ga0207704_10429242 3300025938 Unclassified 1050
196 Ga0207691_10072113 3300025940 Bacteria 3115
197 Ga0207691_10244361 3300025940 Bacteria 1551
198 Ga0207691_10424977 3300025940 Bacteria 1132
199 Ga0207711_10986907 3300025941 Bacteria 781
200 Ga0207689_10065764 3300025942 Bacteria 2982
201 Ga0207689_10075995 3300025942 Bacteria 2761
202 Ga0207661_10172045 3300025944 Bacteria 1886
203 Ga0207667_10017442 3300025949 Bacteria 8078
204 Ga0207667_10194554 3300025949 Bacteria 2081
205 Ga0207667_10229165 3300025949 Bacteria 1903
206 Ga0207667_10426388 3300025949 Bacteria 1349
207 Ga0207651_10034290 3300025960 Bacteria 3285
208 Ga0207668_10296762 3300025972 Bacteria 1332
209 Ga0207677_10612282 3300026023 Bacteria 957
210 Ga0207703_10160378 3300026035 Bacteria 1969
211 Ga0207639_10039642 3300026041 Bacteria 3511
212 Ga0207639_10291723 3300026041 Bacteria 1438
213 Ga0207678_10000060 3300026067 Bacteria 85708
214 Ga0207678_10417624 3300026067 Bacteria 1163
215 Ga0207708_10042148 3300026075 Bacteria 3480
216 Ga0207708_10288121 3300026075 Bacteria 1332
217 Ga0207702_10001911 3300026078 Bacteria 20342
218 Ga0207641_10154282 3300026088 Bacteria 2082
219 Ga0207648_10008141 3300026089 Bacteria 10195
220 Ga0207648_10011312 3300026089 Bacteria 8412
221 Ga0207648_10556186 3300026089 Unclassified 1054
222 Ga0207674_10032484 3300026116 Bacteria 5474
223 Ga0207674_10049178 3300026116 Bacteria 4314
224 Ga0207674_10058558 3300026116 Bacteria 3902
225 Ga0207674_10387340 3300026116 Bacteria 1351
226 Ga0207675_100111423 3300026118 Bacteria 2582
227 Ga0207683_10015792 3300026121 Bacteria 6427
228 Ga0207698_10005394 3300026142 Bacteria 7895
229 Ga0207698_10014920 3300026142 Bacteria 5184
230 Ga0207698_10094205 3300026142 Bacteria 2461
231 Ga0268266_10515395 3300028379 Bacteria 1143
232 Ga0268264_10401286 3300028381 Bacteria 1318
233 Ga0268264_10816037 3300028381 Bacteria 933
234 Ga0307515_10001320 3300028794 Bacteria 56334
235 Ga0307515_10021749 3300028794 Bacteria 11347
236 Ga0265338_10000113 3300028800 Bacteria 150993
237 Ga0265324_10026466 3300029957 Bacteria 2053
238 Ga0265332_10000004 3300031238 Bacteria 426592
239 Ga0265332_10000006 3300031238 Bacteria 327963
240 Ga0265332_10017342 3300031238 Bacteria 3178
241 Ga0265328_10035886 3300031239 Bacteria 1833
242 Ga0265328_10057245 3300031239 Bacteria 1431
243 Ga0265320_10043733 3300031240 Bacteria 2212
244 Ga0265325_10153123 3300031241 Bacteria 1089
245 Ga0265329_10022323 3300031242 Bacteria 2118
246 Ga0265331_10053698 3300031250 Bacteria 1921
247 Ga0265327_10060132 3300031251 Bacteria 1943
248 Ga0265316_10220401 3300031344 Bacteria 1400
249 Ga0265316_10613112 3300031344 Bacteria 771
250 Ga0307408_100403511 3300031548 Bacteria 1174
251 Ga0265313_10197283 3300031595 Bacteria 839
252 Ga0265314_10000960 3300031711 Bacteria 33864
253 Ga0265314_10014690 3300031711 Bacteria 6249
254 Ga0265314_10025776 3300031711 Bacteria 4429
255 Ga0265314_10125412 3300031711 Bacteria 1609
256 Ga0265342_10067859 3300031712 Bacteria 2086
257 Ga0307516_10000973 3300031730 Bacteria 39600
258 Ga0307412_10032019 3300031911 Bacteria 3327
259 Ga0307412_10259273 3300031911 Bacteria 1354
260 Ga0307416_100329196 3300032002 Bacteria 1534
261 Ga0307414_10173489 3300032004 Bacteria 1726
262 Ga0307411_11246506 3300032005 Bacteria 676
263 Ga0373938_0012359 3300034957 Bacteria 1601
264 Ga0373928_0032500 3300035084 Bacteria 1164
265 Ga0373940_0158973 3300035088 Bacteria 724
266 Ga0395899_0003555 3300037312 Bacteria 12338
267 Ga0395899_0044364 3300037312 Bacteria 3313
268 Ga0395900_0005229 3300037418 Bacteria 13619
269 Ga0395900_0040082 3300037418 Bacteria 4826
270 Ga0395900_0090018 3300037418 Bacteria 3154
271 Ga0395900_0175952 3300037418 Bacteria 2176
272 Ga0395900_0658762 3300037418 Bacteria 983
273 Ga0395898_0029810 3300037466 Bacteria 5461
274 Ga0395898_0058007 3300037466 Bacteria 3770
275 Ga0395898_0058632 3300037466 Bacteria 3747
276 Ga0395898_0072472 3300037466 Bacteria 3328
277 Ga0395905_0000047 3300037471 Bacteria 237582
278 Ga0395905_0001133 3300037471 Bacteria 33350
279 Ga0395905_0008913 3300037471 Bacteria 9850
280 Ga0395905_0015524 3300037471 Bacteria 7238
281 Ga0395905_0029583 3300037471 Bacteria 5161
282 Ga0395905_0039142 3300037471 Bacteria 4448
283 Ga0395905_0114328 3300037471 Bacteria 2536
284 Ga0395905_0145539 3300037471 Bacteria 2229
285 Ga0395905_0204600 3300037471 Bacteria 1850
286 Ga0395905_0238791 3300037471 Bacteria 1698
287 Ga0395905_0260120 3300037471 Bacteria 1620
288 Ga0395905_0288917 3300037471 Bacteria 1526
289 Ga0395905_0500067 3300037471 Bacteria 1116
290 Ga0395901_0009451 3300038443 Bacteria 9892
291 Ga0395901_0010842 3300038443 Bacteria 9242
292 Ga0395901_0011724 3300038443 Bacteria 8885
293 Ga0395901_0021623 3300038443 Bacteria 6590
294 Ga0395901_0112741 3300038443 Bacteria 2855
295 Ga0395901_0163178 3300038443 Bacteria 2340
296 Ga0395901_0219268 3300038443 Bacteria 1989
297 Ga0436360_0276311 3300039438 Bacteria 918
298 Ga0439439_0043404 3300041406 Bacteria 1169
299 Ga0439433_0034959 3300041999 Bacteria 1158
300 Ga0439433_0039105 3300041999 Bacteria 1101
301 Ga0439449_0000317 3300042007 Bacteria 17464
302 Ga0439457_023412 3300042014 Bacteria 1367
303 Ga0439462_0036882 3300042015 Bacteria 1301
304 Ga0450923_014715 3300042125 Bacteria 1455
305 Ga0439446_0007493 3300042156 Bacteria 2870
306 Ga0439458_0029747 3300042157 Bacteria 1297
307 Ga0439434_0162507 3300042435 Bacteria 742
308 Ga0439464_0009508 3300042439 Bacteria 2559
309 Ga0451577_0000126 3300042876 Bacteria 168037
310 Ga0451577_0001338 3300042876 Bacteria 33477
311 Ga0451577_0017496 3300042876 Bacteria 6621
312 Ga0451577_0048719 3300042876 Bacteria 3784
313 Ga0451577_0067682 3300042876 Bacteria 3186
314 Ga0451577_0958089 3300042876 Bacteria 769
315 Ga0466969_0008374 3300044656 Bacteria 5483
316 Ga0453683_0001138 3300044673 Bacteria 24154
317 Ga0453683_0026745 3300044673 Bacteria 3663
318 Ga0466965_0086805 3300044683 Bacteria 1587
319 Ga0466966_0003980 3300044684 Bacteria 9759
320 Ga0466966_0021246 3300044684 Bacteria 4263
321 Ga0466961_0002664 3300044693 Bacteria 11073
322 Ga0466961_0031263 3300044693 Bacteria 3422
323 Ga0466961_0156318 3300044693 Bacteria 1422
324 Ga0466964_0012225 3300044706 Bacteria 3247
325 Ga0453684_0000365 3300044712 Bacteria 186233
326 Ga0453684_0031332 3300044712 Bacteria 7478
327 Ga0453684_0342383 3300044712 Bacteria 1688
328 Ga0453684_0926497 3300044712 Bacteria 931
329 Ga0466971_0103715 3300044719 Bacteria 1308
330 Ga0466971_0129720 3300044719 Bacteria 1170
331 Ga0466970_0459516 3300044765 Bacteria 730
332 Ga0466957_0026889 3300044842 Bacteria 3415
333 Ga0466960_0017714 3300044901 Bacteria 3111
334 Ga0466959_0000517 3300045049 Bacteria 22405
335 Ga0466959_0025103 3300045049 Bacteria 4414
336 Ga0466959_0296523 3300045049 Bacteria 1108
337 Ga0451576_0000627 3300045051 Bacteria 73597
338 Ga0451576_0006791 3300045051 Bacteria 13913
339 Ga0451576_0056022 3300045051 Bacteria 4124
340 Ga0451576_0233699 3300045051 Bacteria 1920
341 Ga0451576_0621434 3300045051 Bacteria 1135
342 Ga0466958_0094282 3300045836 Bacteria 1854
343 Ga0495627_000007 3300046453 Bacteria 575915
344 Ga0495650_0009002 3300046471 Bacteria 5737
345 Ga0495605_0001617 3300046474 Bacteria 14594
346 Ga0495605_0001777 3300046474 Bacteria 13823
347 Ga0495605_0216044 3300046474 Bacteria 830
348 Ga0495584_0001462 3300046491 Bacteria 14191
349 Ga0495584_0024722 3300046491 Bacteria 3045
350 Ga0495585_0020862 3300046492 Bacteria 3764
351 Ga0495596_0001420 3300046500 Bacteria 13740
352 Ga0495607_0007314 3300046501 Bacteria 7654
353 Ga0495583_0000060 3300046506 Bacteria 199091
354 Ga0495606_0212391 3300046507 Bacteria 1095
355 Ga0495616_0006711 3300046513 Bacteria 6943
356 Ga0495631_0003039 3300046518 Bacteria 9269
357 Ga0495632_0000750 3300046519 Bacteria 29271
358 Ga0495637_0061942 3300046520 Bacteria 1532
359 Ga0495644_0003522 3300046523 Bacteria 6192
360 Ga0495644_0017777 3300046523 Bacteria 2716
361 Ga0495642_0017515 3300046528 Bacteria 2799
362 Ga0495642_0110354 3300046528 Bacteria 1176
363 Ga0495609_0000055 3300046538 Bacteria 146808
364 Ga0495609_0013520 3300046538 Bacteria 3852
365 Ga0495633_0015841 3300046558 Bacteria 3903
366 Ga0495656_0196314 3300046615 Bacteria 999
367 Ga0495668_0009474 3300046616 Bacteria 5981
368 Ga0495611_0003537 3300046648 Bacteria 6871
369 Ga0495625_0401830 3300046660 Bacteria 856
370 Ga0495661_0027704 3300046665 Bacteria 3633
371 Ga0495588_0151227 3300046674 Bacteria 1227
372 Ga0495669_0015279 3300046684 Bacteria 3287
373 Ga0495669_0135359 3300046684 Bacteria 1161
374 Ga0495649_0029676 3300046694 Bacteria 3023
375 Ga0495589_0010929 3300046794 Bacteria 4715
376 Ga0495660_0000091 3300046810 Bacteria 98065
377 Ga0495660_0002081 3300046810 Bacteria 12968
378 Ga0495660_0014872 3300046810 Bacteria 4500
379 Ga0495636_0131165 3300047318 Bacteria 1115
380 Ga0495672_0003337 3300047320 Bacteria 13835
381 Ga0495683_0003166 3300047323 Bacteria 9611
382 Ga0495677_0000375 3300047445 Bacteria 19231
383 Ga0495679_011019 3300047446 Bacteria 3515
384 Ga0495685_005674 3300047447 Bacteria 4080
385 Ga0495673_0000113 3300047469 Bacteria 163495
386 Ga0495681_0001779 3300047470 Bacteria 15879
387 Ga0495681_0004114 3300047470 Bacteria 10002
388 Ga0495626_0000364 3300048091 Bacteria 47517
389 Ga0496102_0375683 3300048905 Bacteria 1338
390 Ga0496110_0077412 3300048913 Bacteria 2959
391 Ga0496113_0209222 3300048916 Bacteria 1552
392 Ga0496115_0259384 3300048918 Bacteria 1430
393 Ga0496116_0022976 3300048919 Bacteria 4655
394 Ga0496124_0027485 3300048927 Bacteria 5106
395 Ga0496124_0146518 3300048927 Bacteria 1857
396 Ga0495678_002149 3300049459 Bacteria 13932
397 Ga0501031_0142607 3300049568 Bacteria 1566
398 Ga0501034_0051718 3300049571 Bacteria 4142
399 Ga0501036_0145630 3300049572 Bacteria 1998
400 Ga0501038_0165245 3300049574 Bacteria 1796
401 Ga0501039_0617164 3300049575 Bacteria 850
402 Ga0501043_0268102 3300049579 Bacteria 1311
403 Ga0501046_0040347 3300049580 Bacteria 3731
404 Ga0501047_0228903 3300049581 Bacteria 1713
405 Ga0501067_0135417 3300049583 Bacteria 1372
406 Ga0501073_0177134 3300049589 Bacteria 1476
407 Ga0501198_000033 3300049649 Bacteria 56683
408 Ga0501222_000016 3300049662 Bacteria 80046
409 Ga0501035_0044988 3300049822 Bacteria 3973
410 Ga0501035_0054941 3300049822 Bacteria 3556
411 Ga0501035_0348121 3300049822 Bacteria 1240
412 Ga0501044_0146830 3300049823 Bacteria 2343
413 Ga0501044_0215010 3300049823 Bacteria 1875
414 nmdc:mga03683_36001_c1 3300050489 Bacteria 2011
415 nmdc:mga03683_65322_c1 3300050489 Bacteria 1545
416 nmdc:mga0yw44_165072_c1 3300050492 Bacteria 1451
417 nmdc:mga0k408_393440_c1 3300050493 Bacteria 825
418 nmdc:mga0k408_52525_c1 3300050493 Bacteria 2362
419 nmdc:mga06z11_191113_c1 3300050494 Bacteria 1185
420 nmdc:mga05p37_474102_c1 3300050507 Bacteria 1443
421 nmdc:mga09592_46740_c1 3300050508 Bacteria 3646
422 nmdc:mga0qj67_715928_c1 3300050509 Bacteria 796
423 nmdc:mga06r32_1016990_c1 3300050510 Bacteria 781
424 nmdc:mga08y16_346151_c1 3300050511 Bacteria 1527
425 nmdc:mga0n895_599947_c1 3300050512 Bacteria 1103
426 nmdc:mga0rr50_656528_c1 3300050513 Bacteria 895
427 Ga0500562_069250 3300053108 Bacteria 951
428 Ga0500594_0142383 3300053118 Bacteria 766
429 Ga0500561_0059569 3300053137 Bacteria 1066
430 Ga0500622_0035554 3300053156 Bacteria 2607
431 Ga0466962_0305151 3300061719 Bacteria 788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0009002 Ga0495650_0009002_4847_5419 172
2 3300006844 Ga0075428_101268658 Ga0075428_1012686581 190
3 3300025944 Ga0207661_10172045 Ga0207661_101720453 190
4 iso_pu_bacteria 2511231026 2511383335 195
5 iso_pu_bacteria 2526164512 2526213296 197
6 iso_pu_bacteria 2547132512 2548847744 197
7 iso_pu_bacteria 2501025501 2501070944 198
8 iso_pu_bacteria 2501025502 2501078908 198
9 iso_pu_bacteria 2501025504 2501413775 198
10 iso_pu_bacteria 2510917013 2511089546 198
11 iso_pu_bacteria 2510917014 2511094956 198
12 iso_pu_bacteria 2510917015 2511104615 198
13 iso_pu_bacteria 2515154189 2516016930 198
14 iso_pu_bacteria 2883087390 2883094688 198
15 3300009093 Ga0105240_10593469 Ga0105240_105934692 199
16 3300017792 Ga0163161_10010630 Ga0163161_100106307 199
17 3300032004 Ga0307414_10173489 Ga0307414_101734892 199
18 3300046453 Ga0495627_000007 Ga0495627_000007_273261_273881 199
19 3300046474 Ga0495605_0001617 Ga0495605_0001617_5764_6384 199
20 3300046474 Ga0495605_0001777 Ga0495605_0001777_7656_8276 199
21 3300046491 Ga0495584_0001462 Ga0495584_0001462_5913_6533 199
22 3300046491 Ga0495584_0024722 Ga0495584_0024722_299_919 199
23 3300046492 Ga0495585_0020862 Ga0495585_0020862_2741_3361 199
24 3300046500 Ga0495596_0001420 Ga0495596_0001420_5490_6110 199
25 3300046501 Ga0495607_0007314 Ga0495607_0007314_5096_5716 199
26 3300046506 Ga0495583_0000060 Ga0495583_0000060_37654_38274 199
27 3300046513 Ga0495616_0006711 Ga0495616_0006711_3092_3712 199
28 3300046518 Ga0495631_0003039 Ga0495631_0003039_2615_3235 199
29 3300046519 Ga0495632_0000750 Ga0495632_0000750_15306_15926 199
30 3300046520 Ga0495637_0061942 Ga0495637_0061942_440_1060 199
31 3300046523 Ga0495644_0003522 Ga0495644_0003522_4208_4828 199
32 3300046523 Ga0495644_0017777 Ga0495644_0017777_428_1048 199
33 3300046528 Ga0495642_0017515 Ga0495642_0017515_1376_1996 199
34 3300046538 Ga0495609_0000055 Ga0495609_0000055_84789_85409 199
35 3300046538 Ga0495609_0013520 Ga0495609_0013520_1444_2064 199
36 3300046558 Ga0495633_0015841 Ga0495633_0015841_2576_3196 199
37 3300046615 Ga0495656_0196314 Ga0495656_0196314_137_757 199
38 3300046616 Ga0495668_0009474 Ga0495668_0009474_1503_2123 199
39 3300046648 Ga0495611_0003537 Ga0495611_0003537_3863_4483 199
40 3300046665 Ga0495661_0027704 Ga0495661_0027704_1237_1857 199
41 3300046684 Ga0495669_0015279 Ga0495669_0015279_417_1037 199
42 3300046694 Ga0495649_0029676 Ga0495649_0029676_1141_1761 199
43 3300046794 Ga0495589_0010929 Ga0495589_0010929_2306_2926 199
44 3300046810 Ga0495660_0000091 Ga0495660_0000091_87796_88416 199
45 3300046810 Ga0495660_0002081 Ga0495660_0002081_8885_9505 199
46 3300046810 Ga0495660_0014872 Ga0495660_0014872_1502_2122 199
47 3300047320 Ga0495672_0003337 Ga0495672_0003337_5569_6189 199
48 3300047323 Ga0495683_0003166 Ga0495683_0003166_4097_4717 199
49 3300047445 Ga0495677_0000375 Ga0495677_0000375_13085_13705 199
50 3300047446 Ga0495679_011019 Ga0495679_011019_910_1530 199
51 3300047469 Ga0495673_0000113 Ga0495673_0000113_47869_48489 199
52 3300047470 Ga0495681_0001779 Ga0495681_0001779_5417_6037 199
53 3300047470 Ga0495681_0004114 Ga0495681_0004114_5936_6556 199
54 3300048091 Ga0495626_0000364 Ga0495626_0000364_24258_24878 199
55 3300048919 Ga0496116_0022976 Ga0496116_0022976_3704_4324 199
56 3300048927 Ga0496124_0027485 Ga0496124_0027485_3294_3914 199
57 3300048927 Ga0496124_0146518 Ga0496124_0146518_525_1145 199
58 3300049459 Ga0495678_002149 Ga0495678_002149_8332_8952 199
59 3300005366 Ga0070659_100078481 Ga0070659_1000784812 201
60 3300005458 Ga0070681_10744858 Ga0070681_107448582 201
61 3300005530 Ga0070679_100109390 Ga0070679_1001093902 201
62 3300005535 Ga0070684_100396948 Ga0070684_1003969481 201
63 3300005539 Ga0068853_100137498 Ga0068853_1001374982 201
64 3300005546 Ga0070696_100383884 Ga0070696_1003838842 201
65 3300005549 Ga0070704_100135181 Ga0070704_1001351812 201
66 3300005563 Ga0068855_100313765 Ga0068855_1003137652 201
67 3300005577 Ga0068857_100009087 Ga0068857_1000090878 201
68 3300005615 Ga0070702_100182463 Ga0070702_1001824632 201
69 3300006237 Ga0097621_100366017 Ga0097621_1003660172 201
70 3300009545 Ga0105237_10007206 Ga0105237_100072064 201
71 3300009551 Ga0105238_10181049 Ga0105238_101810492 201
72 3300010375 Ga0105239_10709759 Ga0105239_107097592 201
73 3300014325 Ga0163163_10020142 Ga0163163_100201423 201
74 3300025912 Ga0207707_10048305 Ga0207707_100483054 201
75 3300025914 Ga0207671_10017207 Ga0207671_100172076 201
76 3300025921 Ga0207652_10113141 Ga0207652_101131412 201
77 3300025949 Ga0207667_10426388 Ga0207667_104263882 201
78 3300026041 Ga0207639_10039642 Ga0207639_100396422 201
79 3300026116 Ga0207674_10058558 Ga0207674_100585584 201
80 3300029957 Ga0265324_10026466 Ga0265324_100264662 201
81 3300031238 Ga0265332_10000004 Ga0265332_1000000456 201
82 3300031251 Ga0265327_10060132 Ga0265327_100601322 201
83 3300031711 Ga0265314_10125412 Ga0265314_101254122 201
84 3300035084 Ga0373928_0032500 Ga0373928_0032500_308_916 201
85 3300042876 Ga0451577_0048719 Ga0451577_0048719_969_1577 201
86 3300048905 Ga0496102_0375683 Ga0496102_0375683_109_729 201
87 3300005329 Ga0070683_100103219 Ga0070683_1001032192 202
88 3300005330 Ga0070690_100126581 Ga0070690_1001265812 202
89 3300005331 Ga0070670_100106488 Ga0070670_1001064882 202
90 3300005331 Ga0070670_100587776 Ga0070670_1005877761 202
91 3300005331 Ga0070670_100635965 Ga0070670_1006359652 202
92 3300005333 Ga0070677_10022168 Ga0070677_100221684 202
93 3300005334 Ga0068869_100157188 Ga0068869_1001571881 202
94 3300005338 Ga0068868_100434152 Ga0068868_1004341522 202
95 3300005340 Ga0070689_100279873 Ga0070689_1002798732 202
96 3300005340 Ga0070689_100379212 Ga0070689_1003792122 202
97 3300005343 Ga0070687_100311439 Ga0070687_1003114392 202
98 3300005345 Ga0070692_10173057 Ga0070692_101730572 202
99 3300005347 Ga0070668_100039023 Ga0070668_1000390233 202
100 3300005347 Ga0070668_100461220 Ga0070668_1004612201 202
101 3300005354 Ga0070675_100186954 Ga0070675_1001869542 202
102 3300005354 Ga0070675_100304647 Ga0070675_1003046472 202
103 3300005355 Ga0070671_100299733 Ga0070671_1002997331 202
104 3300005356 Ga0070674_100017035 Ga0070674_1000170351 202
105 3300005356 Ga0070674_100018234 Ga0070674_1000182342 202
106 3300005364 Ga0070673_100066421 Ga0070673_1000664214 202
107 3300005366 Ga0070659_100563466 Ga0070659_1005634661 202
108 3300005459 Ga0068867_100213374 Ga0068867_1002133742 202
109 3300005543 Ga0070672_100236545 Ga0070672_1002365452 202
110 3300005543 Ga0070672_100280548 Ga0070672_1002805482 202
111 3300005543 Ga0070672_100694915 Ga0070672_1006949151 202
112 3300005544 Ga0070686_100805230 Ga0070686_1008052301 202
113 3300005548 Ga0070665_100296405 Ga0070665_1002964051 202
114 3300005549 Ga0070704_100185198 Ga0070704_1001851981 202
115 3300005564 Ga0070664_100337726 Ga0070664_1003377261 202
116 3300005577 Ga0068857_100080298 Ga0068857_1000802983 202
117 3300005577 Ga0068857_101328635 Ga0068857_1013286351 202
118 3300005578 Ga0068854_100570574 Ga0068854_1005705741 202
119 3300005617 Ga0068859_100254164 Ga0068859_1002541642 202
120 3300005617 Ga0068859_100471940 Ga0068859_1004719402 202
121 3300005618 Ga0068864_100052156 Ga0068864_1000521562 202
122 3300005618 Ga0068864_100782934 Ga0068864_1007829342 202
123 3300005718 Ga0068866_10446444 Ga0068866_104464441 202
124 3300005719 Ga0068861_100322036 Ga0068861_1003220362 202
125 3300005840 Ga0068870_10168645 Ga0068870_101686452 202
126 3300005841 Ga0068863_100124845 Ga0068863_1001248452 202
127 3300005842 Ga0068858_100100429 Ga0068858_1001004291 202
128 3300005842 Ga0068858_100185812 Ga0068858_1001858122 202
129 3300005843 Ga0068860_100294331 Ga0068860_1002943312 202
130 3300005844 Ga0068862_100191911 Ga0068862_1001919111 202
131 3300005844 Ga0068862_100377456 Ga0068862_1003774561 202
132 3300006237 Ga0097621_100342685 Ga0097621_1003426852 202
133 3300006358 Ga0068871_100041736 Ga0068871_1000417365 202
134 3300006358 Ga0068871_100042413 Ga0068871_1000424133 202
135 3300006881 Ga0068865_100337846 Ga0068865_1003378461 202
136 3300006931 Ga0097620_100254167 Ga0097620_1002541672 202
137 3300006931 Ga0097620_100471888 Ga0097620_1004718882 202
138 3300009094 Ga0111539_10361201 Ga0111539_103612012 202
139 3300009098 Ga0105245_10235905 Ga0105245_102359052 202
140 3300009148 Ga0105243_10177497 Ga0105243_101774972 202
141 3300009176 Ga0105242_10077242 Ga0105242_100772424 202
142 3300009176 Ga0105242_10200343 Ga0105242_102003432 202
143 3300009177 Ga0105248_10038120 Ga0105248_100381205 202
144 3300009553 Ga0105249_10296333 Ga0105249_102963332 202
145 3300010375 Ga0105239_10367280 Ga0105239_103672802 202
146 3300013296 Ga0157374_10136348 Ga0157374_101363483 202
147 3300013296 Ga0157374_10282946 Ga0157374_102829462 202
148 3300013297 Ga0157378_10421247 Ga0157378_104212472 202
149 3300013306 Ga0163162_10285152 Ga0163162_102851522 202
150 3300013306 Ga0163162_11101077 Ga0163162_111010771 202
151 3300013308 Ga0157375_10138648 Ga0157375_101386482 202
152 3300013308 Ga0157375_10411203 Ga0157375_104112032 202
153 3300014325 Ga0163163_11543511 Ga0163163_115435111 202
154 3300014745 Ga0157377_10181625 Ga0157377_101816252 202
155 3300014968 Ga0157379_10361461 Ga0157379_103614612 202
156 3300014969 Ga0157376_10131339 Ga0157376_101313392 202
157 3300014969 Ga0157376_10458794 Ga0157376_104587942 202
158 3300025893 Ga0207682_10001068 Ga0207682_100010683 202
159 3300025899 Ga0207642_10120935 Ga0207642_101209352 202
160 3300025899 Ga0207642_10323562 Ga0207642_103235622 202
161 3300025901 Ga0207688_10033843 Ga0207688_100338434 202
162 3300025907 Ga0207645_10012872 Ga0207645_100128722 202
163 3300025918 Ga0207662_10015271 Ga0207662_100152715 202
164 3300025923 Ga0207681_10340461 Ga0207681_103404611 202
165 3300025925 Ga0207650_10007896 Ga0207650_100078967 202
166 3300025926 Ga0207659_10057211 Ga0207659_100572112 202
167 3300025926 Ga0207659_10134104 Ga0207659_101341042 202
168 3300025927 Ga0207687_10973206 Ga0207687_109732061 202
169 3300025931 Ga0207644_10115095 Ga0207644_101150951 202
170 3300025934 Ga0207686_10159651 Ga0207686_101596512 202
171 3300025937 Ga0207669_10303589 Ga0207669_103035892 202
172 3300025938 Ga0207704_10429242 Ga0207704_104292421 202
173 3300025940 Ga0207691_10072113 Ga0207691_100721134 202
174 3300025940 Ga0207691_10244361 Ga0207691_102443612 202
175 3300025940 Ga0207691_10424977 Ga0207691_104249771 202
176 3300025942 Ga0207689_10075995 Ga0207689_100759952 202
177 3300025960 Ga0207651_10034290 Ga0207651_100342902 202
178 3300025972 Ga0207668_10296762 Ga0207668_102967621 202
179 3300026035 Ga0207703_10160378 Ga0207703_101603783 202
180 3300026075 Ga0207708_10042148 Ga0207708_100421486 202
181 3300026075 Ga0207708_10288121 Ga0207708_102881211 202
182 3300026088 Ga0207641_10154282 Ga0207641_101542821 202
183 3300026089 Ga0207648_10011312 Ga0207648_100113125 202
184 3300026089 Ga0207648_10556186 Ga0207648_105561862 202
185 3300026116 Ga0207674_10032484 Ga0207674_100324845 202
186 3300026118 Ga0207675_100111423 Ga0207675_1001114233 202
187 3300026121 Ga0207683_10015792 Ga0207683_100157925 202
188 3300028379 Ga0268266_10515395 Ga0268266_105153951 202
189 3300028381 Ga0268264_10401286 Ga0268264_104012862 202
190 3300028800 Ga0265338_10000113 Ga0265338_1000011338 202
191 3300031238 Ga0265332_10017342 Ga0265332_100173422 202
192 3300031239 Ga0265328_10057245 Ga0265328_100572451 202
193 3300031240 Ga0265320_10043733 Ga0265320_100437333 202
194 3300031241 Ga0265325_10153123 Ga0265325_101531232 202
195 3300031595 Ga0265313_10197283 Ga0265313_101972832 202
196 3300031711 Ga0265314_10000960 Ga0265314_1000096015 202
197 3300031712 Ga0265342_10067859 Ga0265342_100678592 202
198 3300039438 Ga0436360_0276311 Ga0436360_0276311_208_855 202
199 3300046474 Ga0495605_0216044 Ga0495605_0216044_136_747 202
200 3300046528 Ga0495642_0110354 Ga0495642_0110354_188_799 202
201 3300047318 Ga0495636_0131165 Ga0495636_0131165_166_777 202
202 3300048913 Ga0496110_0077412 Ga0496110_0077412_114_734 202
203 3300048918 Ga0496115_0259384 Ga0496115_0259384_311_922 202
204 3300050511 nmdc:mga08y16_346151_c1 nmdc:mga08y16_346151_c1_456_1067 202
205 3300050512 nmdc:mga0n895_599947_c1 nmdc:mga0n895_599947_c1_177_797 202
206 3300003792 Ga0055540_1020591 Ga0055540_10205912 203
207 3300003794 Ga0055531_10000333 Ga0055531_1000033319 203
208 3300005327 Ga0070658_10159985 Ga0070658_101599852 203
209 3300005327 Ga0070658_10210006 Ga0070658_102100061 203
210 3300005327 Ga0070658_10528907 Ga0070658_105289072 203
211 3300005330 Ga0070690_100347415 Ga0070690_1003474151 203
212 3300005337 Ga0070682_100099504 Ga0070682_1000995043 203
213 3300005343 Ga0070687_100714162 Ga0070687_1007141621 203
214 3300005438 Ga0070701_10283865 Ga0070701_102838651 203
215 3300005530 Ga0070679_100083376 Ga0070679_1000833763 203
216 3300005563 Ga0068855_100219994 Ga0068855_1002199942 203
217 3300005563 Ga0068855_100236568 Ga0068855_1002365682 203
218 3300005614 Ga0068856_100279896 Ga0068856_1002798962 203
219 3300005841 Ga0068863_100133824 Ga0068863_1001338242 203
220 3300006038 Ga0075365_10216108 Ga0075365_102161082 203
221 3300006038 Ga0075365_10226327 Ga0075365_102263271 203
222 3300006038 Ga0075365_10693435 Ga0075365_106934351 203
223 3300006048 Ga0075363_100107043 Ga0075363_1001070432 203
224 3300006048 Ga0075363_100358400 Ga0075363_1003584001 203
225 3300006177 Ga0075362_10039117 Ga0075362_100391172 203
226 3300006195 Ga0075366_10180638 Ga0075366_101806382 203
227 3300006195 Ga0075366_10517788 Ga0075366_105177881 203
228 3300006844 Ga0075428_100061373 Ga0075428_1000613733 203
229 3300006844 Ga0075428_100550672 Ga0075428_1005506721 203
230 3300006846 Ga0075430_100039475 Ga0075430_1000394753 203
231 3300006847 Ga0075431_101019399 Ga0075431_1010193991 203
232 3300006880 Ga0075429_100142563 Ga0075429_1001425632 203
233 3300006880 Ga0075429_100704502 Ga0075429_1007045021 203
234 3300006931 Ga0097620_100806912 Ga0097620_1008069122 203
235 3300009093 Ga0105240_10012435 Ga0105240_1001243512 203
236 3300009093 Ga0105240_10445964 Ga0105240_104459641 203
237 3300009094 Ga0111539_10026639 Ga0111539_100266396 203
238 3300009098 Ga0105245_10007063 Ga0105245_100070637 203
239 3300009147 Ga0114129_10330496 Ga0114129_103304962 203
240 3300009174 Ga0105241_10050428 Ga0105241_100504282 203
241 3300009177 Ga0105248_10859542 Ga0105248_108595421 203
242 3300009551 Ga0105238_10079743 Ga0105238_100797433 203
243 3300013296 Ga0157374_10897704 Ga0157374_108977041 203
244 3300014326 Ga0157380_10209302 Ga0157380_102093023 203
245 3300014969 Ga0157376_10004513 Ga0157376_100045137 203
246 3300025273 Ga0209673_1011484 Ga0209673_10114842 203
247 3300025273 Ga0209673_1024619 Ga0209673_10246192 203
248 3300025284 Ga0209130_1017550 Ga0209130_10175502 203
249 3300025303 Ga0209051_1000214 Ga0209051_100021444 203
250 3300025304 Ga0209257_1000015 Ga0209257_1000015349 203
251 3300025909 Ga0207705_10353125 Ga0207705_103531251 203
252 3300025909 Ga0207705_10380505 Ga0207705_103805052 203
253 3300025911 Ga0207654_10538426 Ga0207654_105384262 203
254 3300025913 Ga0207695_10074404 Ga0207695_100744043 203
255 3300025919 Ga0207657_10011675 Ga0207657_100116752 203
256 3300025919 Ga0207657_10659520 Ga0207657_106595201 203
257 3300025921 Ga0207652_10028160 Ga0207652_100281604 203
258 3300025921 Ga0207652_10184636 Ga0207652_101846361 203
259 3300025924 Ga0207694_10092064 Ga0207694_100920642 203
260 3300025941 Ga0207711_10986907 Ga0207711_109869071 203
261 3300025942 Ga0207689_10065764 Ga0207689_100657643 203
262 3300025949 Ga0207667_10229165 Ga0207667_102291652 203
263 3300026023 Ga0207677_10612282 Ga0207677_106122821 203
264 3300026116 Ga0207674_10387340 Ga0207674_103873402 203
265 3300028381 Ga0268264_10816037 Ga0268264_108160371 203
266 3300031238 Ga0265332_10000006 Ga0265332_1000000686 203
267 3300031239 Ga0265328_10035886 Ga0265328_100358862 203
268 3300031242 Ga0265329_10022323 Ga0265329_100223232 203
269 3300031250 Ga0265331_10053698 Ga0265331_100536982 203
270 3300031344 Ga0265316_10220401 Ga0265316_102204011 203
271 3300031344 Ga0265316_10613112 Ga0265316_106131121 203
272 3300031548 Ga0307408_100403511 Ga0307408_1004035112 203
273 3300031711 Ga0265314_10014690 Ga0265314_100146902 203
274 3300031711 Ga0265314_10025776 Ga0265314_100257764 203
275 3300031911 Ga0307412_10032019 Ga0307412_100320192 203
276 3300031911 Ga0307412_10259273 Ga0307412_102592732 203
277 3300032002 Ga0307416_100329196 Ga0307416_1003291962 203
278 3300032005 Ga0307411_11246506 Ga0307411_112465061 203
279 3300035088 Ga0373940_0158973 Ga0373940_0158973_64_678 203
280 3300037312 Ga0395899_0003555 Ga0395899_0003555_2351_2965 203
281 3300037312 Ga0395899_0044364 Ga0395899_0044364_1503_2117 203
282 3300037418 Ga0395900_0005229 Ga0395900_0005229_5113_5727 203
283 3300037418 Ga0395900_0040082 Ga0395900_0040082_2259_2873 203
284 3300037418 Ga0395900_0090018 Ga0395900_0090018_688_1302 203
285 3300037418 Ga0395900_0175952 Ga0395900_0175952_454_1068 203
286 3300037418 Ga0395900_0658762 Ga0395900_0658762_203_817 203
287 3300037466 Ga0395898_0029810 Ga0395898_0029810_1637_2251 203
288 3300037466 Ga0395898_0058007 Ga0395898_0058007_928_1542 203
289 3300037466 Ga0395898_0058632 Ga0395898_0058632_1201_1821 203
290 3300037466 Ga0395898_0072472 Ga0395898_0072472_1865_2479 203
291 3300037471 Ga0395905_0000047 Ga0395905_0000047_200493_201107 203
292 3300037471 Ga0395905_0001133 Ga0395905_0001133_7437_8051 203
293 3300037471 Ga0395905_0008913 Ga0395905_0008913_5419_6033 203
294 3300037471 Ga0395905_0015524 Ga0395905_0015524_3975_4589 203
295 3300037471 Ga0395905_0029583 Ga0395905_0029583_3657_4271 203
296 3300037471 Ga0395905_0039142 Ga0395905_0039142_3080_3694 203
297 3300037471 Ga0395905_0114328 Ga0395905_0114328_1582_2196 203
298 3300037471 Ga0395905_0145539 Ga0395905_0145539_1042_1656 203
299 3300037471 Ga0395905_0204600 Ga0395905_0204600_413_1027 203
300 3300037471 Ga0395905_0238791 Ga0395905_0238791_166_780 203
301 3300037471 Ga0395905_0260120 Ga0395905_0260120_674_1288 203
302 3300037471 Ga0395905_0500067 Ga0395905_0500067_459_1073 203
303 3300038443 Ga0395901_0009451 Ga0395901_0009451_1867_2481 203
304 3300038443 Ga0395901_0010842 Ga0395901_0010842_3489_4103 203
305 3300038443 Ga0395901_0011724 Ga0395901_0011724_4137_4751 203
306 3300038443 Ga0395901_0021623 Ga0395901_0021623_5125_5739 203
307 3300038443 Ga0395901_0112741 Ga0395901_0112741_1688_2302 203
308 3300038443 Ga0395901_0163178 Ga0395901_0163178_1341_1955 203
309 3300038443 Ga0395901_0219268 Ga0395901_0219268_1022_1636 203
310 3300041406 Ga0439439_0043404 Ga0439439_0043404_416_1030 203
311 3300041999 Ga0439433_0034959 Ga0439433_0034959_132_746 203
312 3300041999 Ga0439433_0039105 Ga0439433_0039105_61_675 203
313 3300042007 Ga0439449_0000317 Ga0439449_0000317_8755_9369 203
314 3300042014 Ga0439457_023412 Ga0439457_023412_538_1152 203
315 3300042015 Ga0439462_0036882 Ga0439462_0036882_247_861 203
316 3300042125 Ga0450923_014715 Ga0450923_014715_162_776 203
317 3300042156 Ga0439446_0007493 Ga0439446_0007493_796_1410 203
318 3300042157 Ga0439458_0029747 Ga0439458_0029747_203_817 203
319 3300042435 Ga0439434_0162507 Ga0439434_0162507_84_698 203
320 3300042439 Ga0439464_0009508 Ga0439464_0009508_1428_2042 203
321 3300042876 Ga0451577_0017496 Ga0451577_0017496_4565_5179 203
322 3300042876 Ga0451577_0067682 Ga0451577_0067682_264_920 203
323 3300042876 Ga0451577_0958089 Ga0451577_0958089_51_707 203
324 3300044656 Ga0466969_0008374 Ga0466969_0008374_2301_2915 203
325 3300044673 Ga0453683_0001138 Ga0453683_0001138_4545_5159 203
326 3300044673 Ga0453683_0026745 Ga0453683_0026745_993_1607 203
327 3300044683 Ga0466965_0086805 Ga0466965_0086805_698_1312 203
328 3300044684 Ga0466966_0021246 Ga0466966_0021246_2249_2863 203
329 3300044693 Ga0466961_0031263 Ga0466961_0031263_896_1510 203
330 3300044693 Ga0466961_0156318 Ga0466961_0156318_762_1376 203
331 3300044712 Ga0453684_0342383 Ga0453684_0342383_575_1189 203
332 3300044712 Ga0453684_0926497 Ga0453684_0926497_69_725 203
333 3300044719 Ga0466971_0103715 Ga0466971_0103715_640_1254 203
334 3300044719 Ga0466971_0129720 Ga0466971_0129720_385_999 203
335 3300044765 Ga0466970_0459516 Ga0466970_0459516_99_713 203
336 3300044901 Ga0466960_0017714 Ga0466960_0017714_466_1080 203
337 3300045049 Ga0466959_0025103 Ga0466959_0025103_1410_2024 203
338 3300045049 Ga0466959_0296523 Ga0466959_0296523_333_947 203
339 3300045051 Ga0451576_0006791 Ga0451576_0006791_9153_9767 203
340 3300045051 Ga0451576_0056022 Ga0451576_0056022_2892_3506 203
341 3300045051 Ga0451576_0233699 Ga0451576_0233699_133_747 203
342 3300045051 Ga0451576_0621434 Ga0451576_0621434_453_1109 203
343 3300046660 Ga0495625_0401830 Ga0495625_0401830_51_665 203
344 3300046674 Ga0495588_0151227 Ga0495588_0151227_372_986 203
345 3300046684 Ga0495669_0135359 Ga0495669_0135359_463_1077 203
346 3300047447 Ga0495685_005674 Ga0495685_005674_309_923 203
347 3300049568 Ga0501031_0142607 Ga0501031_0142607_780_1394 203
348 3300049571 Ga0501034_0051718 Ga0501034_0051718_1436_2050 203
349 3300049572 Ga0501036_0145630 Ga0501036_0145630_1040_1654 203
350 3300049574 Ga0501038_0165245 Ga0501038_0165245_241_855 203
351 3300049575 Ga0501039_0617164 Ga0501039_0617164_111_725 203
352 3300049579 Ga0501043_0268102 Ga0501043_0268102_363_977 203
353 3300049580 Ga0501046_0040347 Ga0501046_0040347_1811_2425 203
354 3300049581 Ga0501047_0228903 Ga0501047_0228903_839_1453 203
355 3300049583 Ga0501067_0135417 Ga0501067_0135417_122_736 203
356 3300049589 Ga0501073_0177134 Ga0501073_0177134_222_836 203
357 3300049822 Ga0501035_0054941 Ga0501035_0054941_2137_2751 203
358 3300049822 Ga0501035_0348121 Ga0501035_0348121_67_681 203
359 3300049823 Ga0501044_0146830 Ga0501044_0146830_1221_1835 203
360 3300049823 Ga0501044_0215010 Ga0501044_0215010_1241_1855 203
361 3300050489 nmdc:mga03683_36001_c1 nmdc:mga03683_36001_c1_655_1269 203
362 3300050489 nmdc:mga03683_65322_c1 nmdc:mga03683_65322_c1_117_731 203
363 3300050492 nmdc:mga0yw44_165072_c1 nmdc:mga0yw44_165072_c1_64_678 203
364 3300050493 nmdc:mga0k408_393440_c1 nmdc:mga0k408_393440_c1_68_682 203
365 3300050493 nmdc:mga0k408_52525_c1 nmdc:mga0k408_52525_c1_723_1337 203
366 3300050494 nmdc:mga06z11_191113_c1 nmdc:mga06z11_191113_c1_116_730 203
367 3300050507 nmdc:mga05p37_474102_c1 nmdc:mga05p37_474102_c1_717_1331 203
368 3300050508 nmdc:mga09592_46740_c1 nmdc:mga09592_46740_c1_714_1328 203
369 3300050509 nmdc:mga0qj67_715928_c1 nmdc:mga0qj67_715928_c1_95_751 203
370 3300050510 nmdc:mga06r32_1016990_c1 nmdc:mga06r32_1016990_c1_52_708 203
371 3300050513 nmdc:mga0rr50_656528_c1 nmdc:mga0rr50_656528_c1_60_674 203
372 3300061719 Ga0466962_0305151 Ga0466962_0305151_78_692 203
373 3300042876 Ga0451577_0000126 Ga0451577_0000126_71325_71942 204
374 3300042876 Ga0451577_0001338 Ga0451577_0001338_24949_25563 204
375 3300044712 Ga0453684_0000365 Ga0453684_0000365_78650_79267 204
376 3300045051 Ga0451576_0000627 Ga0451576_0000627_72322_72939 204
377 3300049649 Ga0501198_000033 Ga0501198_000033_55727_56341 204
378 3300049662 Ga0501222_000016 Ga0501222_000016_23716_24330 204
379 3300002738 JGI25154J39366_1002086 JGI25154J39366_10020862 205
380 3300002741 JGI25157J39369_1000341 JGI25157J39369_100034127 205
381 3300003752 Ga0055539_1000813 Ga0055539_10008134 205
382 3300005329 Ga0070683_100178286 Ga0070683_1001782862 205
383 3300005339 Ga0070660_100076788 Ga0070660_1000767882 205
384 3300005344 Ga0070661_100152080 Ga0070661_1001520802 205
385 3300005455 Ga0070663_100000730 Ga0070663_10000073017 205
386 3300005459 Ga0068867_100000076 Ga0068867_10000007638 205
387 3300005535 Ga0070684_100903757 Ga0070684_1009037571 205
388 3300005539 Ga0068853_100412959 Ga0068853_1004129591 205
389 3300005563 Ga0068855_100032493 Ga0068855_1000324932 205
390 3300005563 Ga0068855_100099397 Ga0068855_1000993972 205
391 3300005577 Ga0068857_100030365 Ga0068857_1000303652 205
392 3300005578 Ga0068854_100145135 Ga0068854_1001451352 205
393 3300005614 Ga0068856_100003535 Ga0068856_10000353515 205
394 3300005616 Ga0068852_100050911 Ga0068852_1000509112 205
395 3300005616 Ga0068852_100051638 Ga0068852_1000516382 205
396 3300005616 Ga0068852_100109179 Ga0068852_1001091792 205
397 3300009148 Ga0105243_10001449 Ga0105243_100014498 205
398 3300009551 Ga0105238_10031327 Ga0105238_100313273 205
399 3300010375 Ga0105239_10038998 Ga0105239_100389982 205
400 3300013100 Ga0157373_10217299 Ga0157373_102172992 205
401 3300013105 Ga0157369_10081455 Ga0157369_100814552 205
402 3300014745 Ga0157377_10000006 Ga0157377_10000006132 205
403 3300025246 Ga0209646_1000012 Ga0209646_1000012195 205
404 3300025250 Ga0209026_1000004 Ga0209026_1000004423 205
405 3300025253 Ga0209677_100150 Ga0209677_10015026 205
406 3300025256 Ga0209759_1000003 Ga0209759_1000003303 205
407 3300025256 Ga0209759_1000067 Ga0209759_1000067112 205
408 3300025911 Ga0207654_10087740 Ga0207654_100877402 205
409 3300025919 Ga0207657_10058343 Ga0207657_100583432 205
410 3300025920 Ga0207649_10084544 Ga0207649_100845442 205
411 3300025924 Ga0207694_10024111 Ga0207694_100241114 205
412 3300025935 Ga0207709_10001013 Ga0207709_100010138 205
413 3300025949 Ga0207667_10017442 Ga0207667_100174426 205
414 3300025949 Ga0207667_10194554 Ga0207667_101945542 205
415 3300026041 Ga0207639_10291723 Ga0207639_102917232 205
416 3300026067 Ga0207678_10000060 Ga0207678_1000006047 205
417 3300026067 Ga0207678_10417624 Ga0207678_104176241 205
418 3300026078 Ga0207702_10001911 Ga0207702_100019115 205
419 3300026089 Ga0207648_10008141 Ga0207648_100081417 205
420 3300026116 Ga0207674_10049178 Ga0207674_100491783 205
421 3300026142 Ga0207698_10005394 Ga0207698_100053949 205
422 3300026142 Ga0207698_10014920 Ga0207698_100149202 205
423 3300026142 Ga0207698_10094205 Ga0207698_100942052 205
424 3300028794 Ga0307515_10001320 Ga0307515_1000132017 205
425 3300028794 Ga0307515_10021749 Ga0307515_100217494 205
426 3300031730 Ga0307516_10000973 Ga0307516_100009732 205
427 3300034957 Ga0373938_0012359 Ga0373938_0012359_272_889 205
428 3300037471 Ga0395905_0288917 Ga0395905_0288917_724_1341 205
429 3300044684 Ga0466966_0003980 Ga0466966_0003980_8510_9139 205
430 3300044693 Ga0466961_0002664 Ga0466961_0002664_1911_2540 205
431 3300044706 Ga0466964_0012225 Ga0466964_0012225_1749_2378 205
432 3300044712 Ga0453684_0031332 Ga0453684_0031332_488_1108 205
433 3300044842 Ga0466957_0026889 Ga0466957_0026889_1183_1812 205
434 3300045049 Ga0466959_0000517 Ga0466959_0000517_5204_5833 205
435 3300045836 Ga0466958_0094282 Ga0466958_0094282_720_1349 205
436 3300046507 Ga0495606_0212391 Ga0495606_0212391_345_962 205
437 3300048916 Ga0496113_0209222 Ga0496113_0209222_91_708 205
438 3300049822 Ga0501035_0044988 Ga0501035_0044988_2107_2736 205
439 3300053108 Ga0500562_069250 Ga0500562_069250_45_662 205
440 3300053118 Ga0500594_0142383 Ga0500594_0142383_19_636 205
441 3300053137 Ga0500561_0059569 Ga0500561_0059569_83_700 205
442 3300053156 Ga0500622_0035554 Ga0500622_0035554_190_807 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

146

214

0.96

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

29

107

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

34

99

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

25

98

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

122

219

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tou-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound 0.9808 2 202
4mk3-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h) 0.9792 1 203
4mk3-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h) 0.9697 1 203
3tou-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound 0.9664 2 202
4glt-assembly2.cif.gz_C crystal structure of glutathione s-transferase mfla_2116 (target efi-507160) from methylobacillus flagellatus kt with gsh bound 0.9592 2 203
ID Description Score Start End Superfamily
3touB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9823 2 76 3.40.30.10
3totA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9797 79 194 1.20.1050.10
3touA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9779 2 76 3.40.30.10
4gltD02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9671 79 194 1.20.1050.10
af_P0ACA1_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9652 1 72 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7S9CBS3-F1-model_v4 Glutathione S-transferase 0.9922 1 205 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A4Q3J6T0-F1-model_v4 Glutathione S-transferase 0.9887 1 80 GO:0005737
GO:0016740
AF-A0A7S9CBS3-F1-model_v4 Glutathione S-transferase 0.9874 1 205 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A6N3S2I5-F1-model_v4 deleted 0.9854 2 205
AF-S6B1S8-F1-model_v4 Glutathione S-transferase-like protein 0.9837 1 205 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
94.82 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map