F444901

General Info

Members Datasets Scaffolds Average Seq Length
442 224 884 435

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10013108|Ga0265338_100131086
Length 447
Sequence VSGCRTVPSRRRLCGLFAVAVLCTTSGCAPRQGPVEITLQRFFGACDAEYGNSTDVGAAEGECGIITTLINRFNAENPDVHVKVNIVFWPGYDQLSAELAAGDPPDLVTMHESVISDYRARHLIMPLDQGLKSVGIDPASFTRAAREGVIRDGHVYGLPFDNWAPLWHINMNLFRAAGLVRGGRPVLPRSPEELLAQARQFKRANGKPYFVQSTVNEPAAYARNLFTFLLQQNANAFPDPHHIRLRTPEARRVLQLFKTIYDEGLTTKNQDYTAATSGFLNGQGGVYLVGTWMIGDYEKASKQPGSPLAGGYAVVPYPQLYPGRDATYADGHSWVVPTAKRSPQKQRAIFRLLRYLKDNDFEWSRTGHLPAYQAVIESARWRALPHRQEIERLVDVAEPPPPGVQRQFIIQQIVSEEMESAISGQKPIDTALTDAERRVNDVLFNLL

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
206 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
207 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
218 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
219 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
220 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
221 2643221584 Caulobacter sp. Root656 Isolate Unclassified
222 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
223 2818991435 Caulobacter henricii 536 Isolate Unclassified
224 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0.45
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.66
Nodule 0
Rhizoplane 3.62
Rhizosphere 86.88
Stem 0
Stem Tuber 0
Unclassified 2.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10013108 3300028800 Bacteria 9394
2 JGI24740J21852_10001232 3300001979 Bacteria 11577
3 JGI24739J22299_10001570 3300001989 Bacteria 8641
4 JGI24735J21928_10004846 3300002067 Bacteria 4491
5 JGI24735J21928_10009735 3300002067 Bacteria 3078
6 JGI24744J21845_10000200 3300002077 Bacteria 9234
7 rootH1_10061404 3300003323 Bacteria 18023
8 rootH1_10100938 3300003323 Bacteria 10599
9 Ga0055537_1000646 3300003773 Bacteria 18512
10 Ga0055524_1009262 3300003775 Bacteria 4026
11 Ga0055528_1002895 3300003790 Bacteria 8922
12 Ga0055531_10020935 3300003794 Bacteria 2562
13 Ga0070658_10000033 3300005327 Bacteria 147380
14 Ga0070658_10010021 3300005327 Bacteria 7611
15 Ga0070658_10021683 3300005327 Bacteria 5149
16 Ga0070658_10103398 3300005327 Bacteria 2356
17 Ga0070658_10158468 3300005327 Bacteria 1898
18 Ga0070683_100005325 3300005329 Bacteria 10726
19 Ga0070683_100056151 3300005329 Bacteria 3656
20 Ga0070683_100075480 3300005329 Bacteria 3149
21 Ga0070683_100128874 3300005329 Bacteria 2393
22 Ga0070690_100004330 3300005330 Bacteria 7872
23 Ga0070670_100063395 3300005331 Bacteria 3172
24 Ga0068869_100029535 3300005334 Bacteria 3842
25 Ga0070666_10007359 3300005335 Bacteria 6784
26 Ga0070666_10054341 3300005335 Bacteria 2702
27 Ga0070680_100000896 3300005336 Bacteria 21045
28 Ga0070682_100022916 3300005337 Bacteria 3705
29 Ga0070682_100042480 3300005337 Bacteria 2806
30 Ga0068868_100057557 3300005338 Bacteria 3071
31 Ga0070660_100012465 3300005339 Bacteria 6072
32 Ga0070660_100012474 3300005339 Bacteria 6070
33 Ga0070660_100032761 3300005339 Bacteria 3913
34 Ga0070691_10000243 3300005341 Bacteria 18635
35 Ga0070661_100000114 3300005344 Bacteria 67216
36 Ga0070661_100007497 3300005344 Bacteria 7528
37 Ga0070661_100017301 3300005344 Bacteria 5112
38 Ga0070661_100113006 3300005344 Bacteria 2029
39 Ga0070692_10003275 3300005345 Bacteria 6532
40 Ga0070692_10039632 3300005345 Bacteria 2406
41 Ga0070669_100142650 3300005353 Bacteria 1848
42 Ga0070675_100004750 3300005354 Bacteria 10371
43 Ga0070675_100145237 3300005354 Bacteria 2031
44 Ga0070671_100013084 3300005355 Bacteria 6686
45 Ga0070671_100065478 3300005355 Bacteria 3027
46 Ga0070674_100009553 3300005356 Bacteria 5809
47 Ga0070673_100011648 3300005364 Bacteria 6008
48 Ga0070673_100040963 3300005364 Bacteria 3557
49 Ga0070659_100006154 3300005366 Bacteria 8662
50 Ga0070659_100027988 3300005366 Bacteria 4348
51 Ga0070659_100029874 3300005366 Bacteria 4214
52 Ga0070659_100031973 3300005366 Bacteria 4079
53 Ga0070659_100036187 3300005366 Bacteria 3847
54 Ga0070667_100197026 3300005367 Bacteria 1786
55 Ga0070663_100002987 3300005455 Bacteria 9646
56 Ga0070663_100058770 3300005455 Bacteria 2762
57 Ga0070678_100011116 3300005456 Bacteria 5538
58 Ga0070678_100026944 3300005456 Bacteria 3894
59 Ga0070662_100005842 3300005457 Bacteria 7898
60 Ga0070662_100016262 3300005457 Bacteria 4993
61 Ga0070662_100041712 3300005457 Bacteria 3275
62 Ga0070681_10001905 3300005458 Bacteria 18821
63 Ga0070681_10023086 3300005458 Bacteria 6255
64 Ga0070679_100000084 3300005530 Bacteria 70823
65 Ga0070679_100065796 3300005530 Bacteria 3613
66 Ga0070684_100022778 3300005535 Bacteria 5230
67 Ga0068853_100007461 3300005539 Bacteria 8754
68 Ga0068853_100028801 3300005539 Bacteria 4674
69 Ga0068853_100156852 3300005539 Bacteria 2051
70 Ga0070672_100001479 3300005543 Bacteria 14586
71 Ga0070672_100027362 3300005543 Bacteria 4252
72 Ga0070686_100056317 3300005544 Bacteria 2521
73 Ga0070665_100004829 3300005548 Bacteria 14002
74 Ga0068855_100000047 3300005563 Bacteria 145355
75 Ga0068855_100013185 3300005563 Bacteria 9971
76 Ga0068855_100193640 3300005563 Bacteria 2291
77 Ga0070664_100005462 3300005564 Bacteria 10202
78 Ga0070664_100014140 3300005564 Bacteria 6511
79 Ga0070664_100062223 3300005564 Bacteria 3182
80 Ga0068857_100012566 3300005577 Bacteria 7375
81 Ga0068854_100003724 3300005578 Bacteria 9537
82 Ga0068854_100005539 3300005578 Bacteria 7978
83 Ga0068854_100058860 3300005578 Bacteria 2775
84 Ga0068856_100024453 3300005614 Bacteria 5881
85 Ga0068856_100077106 3300005614 Bacteria 3302
86 Ga0068856_100082409 3300005614 Bacteria 3192
87 Ga0068852_100005727 3300005616 Bacteria 8912
88 Ga0068852_100007056 3300005616 Bacteria 8182
89 Ga0068852_100036049 3300005616 Bacteria 4135
90 Ga0068859_100018135 3300005617 Bacteria 7073
91 Ga0068859_100040456 3300005617 Bacteria 4679
92 Ga0068864_100000487 3300005618 Bacteria 34323
93 Ga0068864_100071953 3300005618 Bacteria 3012
94 Ga0068851_10009633 3300005834 Bacteria 4497
95 Ga0068851_10050095 3300005834 Bacteria 2120
96 Ga0068863_100016694 3300005841 Bacteria 7044
97 Ga0068863_100033822 3300005841 Bacteria 4870
98 Ga0068863_100060266 3300005841 Bacteria 3589
99 Ga0068858_100030052 3300005842 Bacteria 5045
100 Ga0081539_10000038 3300005985 Bacteria 296079
101 Ga0081539_10018266 3300005985 Bacteria 4875
102 Ga0075370_10066102 3300006353 Bacteria 2063
103 Ga0097620_100018135 3300006931 Bacteria 7073
104 Ga0097620_100040456 3300006931 Bacteria 4679
105 Ga0105240_10000647 3300009093 Bacteria 64299
106 Ga0105240_10021229 3300009093 Bacteria 8644
107 Ga0105240_10092822 3300009093 Bacteria 3685
108 Ga0105243_10022964 3300009148 Bacteria 4744
109 Ga0105241_10090800 3300009174 Bacteria 2409
110 Ga0105241_10101119 3300009174 Bacteria 2292
111 Ga0105242_10130007 3300009176 Bacteria 2172
112 Ga0105248_10001528 3300009177 Bacteria 25762
113 Ga0105248_10019256 3300009177 Bacteria 7552
114 Ga0105248_10027431 3300009177 Bacteria 6341
115 Ga0105248_10464021 3300009177 Bacteria 1428
116 Ga0105237_10053612 3300009545 Bacteria 4044
117 Ga0105238_10006858 3300009551 Bacteria 11373
118 Ga0105238_10073791 3300009551 Bacteria 3406
119 Ga0105238_10100336 3300009551 Bacteria 2878
120 Ga0105239_10001683 3300010375 Bacteria 29162
121 Ga0105239_10039797 3300010375 Bacteria 5151
122 Ga0105239_10136742 3300010375 Bacteria 2728
123 Ga0157373_10024884 3300013100 Bacteria 4335
124 Ga0157373_10095568 3300013100 Bacteria 2092
125 Ga0157371_10005645 3300013102 Bacteria 10503
126 Ga0157370_10005211 3300013104 Bacteria 14650
127 Ga0157370_10102902 3300013104 Bacteria 2673
128 Ga0157370_10278219 3300013104 Unclassified 1546
129 Ga0157369_10010073 3300013105 Bacteria 10792
130 Ga0157369_10022111 3300013105 Bacteria 7104
131 Ga0157374_10003450 3300013296 Bacteria 13284
132 Ga0157374_10128247 3300013296 Bacteria 2453
133 Ga0157374_10226226 3300013296 Bacteria 1837
134 Ga0157378_10058402 3300013297 Bacteria 3441
135 Ga0163162_10107573 3300013306 Bacteria 2884
136 Ga0157372_10026759 3300013307 Bacteria 6278
137 Ga0157372_10035515 3300013307 Bacteria 5488
138 Ga0157375_10061597 3300013308 Bacteria 3726
139 Ga0157375_10161334 3300013308 Bacteria 2383
140 Ga0163163_10047514 3300014325 Bacteria 4220
141 Ga0163163_10142302 3300014325 Bacteria 2441
142 Ga0157376_10048842 3300014969 Bacteria 3503
143 Ga0206354_11177839 3300020081 Bacteria 3772
144 Ga0206353_10393260 3300020082 Bacteria 4094
145 Ga0213873_10000013 3300021358 Bacteria 206227
146 Ga0213876_10000072 3300021384 Bacteria 123469
147 Ga0213876_10000310 3300021384 Bacteria 42816
148 Ga0213876_10010220 3300021384 Bacteria 5041
149 Ga0209565_1000118 3300025263 Bacteria 113196
150 Ga0209673_1001150 3300025273 Bacteria 28906
151 Ga0209758_1000835 3300025297 Bacteria 42973
152 Ga0209758_1011719 3300025297 Bacteria 5034
153 Ga0209256_1011665 3300025299 Bacteria 3480
154 Ga0209257_1000506 3300025304 Bacteria 68402
155 Ga0207697_10012061 3300025315 Bacteria 3637
156 Ga0207697_10027588 3300025315 Bacteria 2322
157 Ga0207656_10007905 3300025321 Bacteria 3896
158 Ga0207656_10059712 3300025321 Unclassified 1670
159 Ga0207688_10025940 3300025901 Bacteria 3221
160 Ga0207680_10005418 3300025903 Bacteria 6097
161 Ga0207647_10000769 3300025904 Bacteria 25007
162 Ga0207647_10021746 3300025904 Bacteria 4275
163 Ga0207645_10091193 3300025907 Bacteria 1960
164 Ga0207705_10000002 3300025909 Bacteria 2046852
165 Ga0207705_10009397 3300025909 Bacteria 7110
166 Ga0207705_10012299 3300025909 Bacteria 6183
167 Ga0207705_10012359 3300025909 Bacteria 6169
168 Ga0207705_10016966 3300025909 Bacteria 5215
169 Ga0207705_10086738 3300025909 Bacteria 2288
170 Ga0207707_10005427 3300025912 Bacteria 11146
171 Ga0207707_10022978 3300025912 Bacteria 5454
172 Ga0207707_10024266 3300025912 Bacteria 5306
173 Ga0207695_10000003 3300025913 Bacteria 1368691
174 Ga0207695_10009389 3300025913 Bacteria 12098
175 Ga0207695_10096280 3300025913 Bacteria 2962
176 Ga0207671_10127133 3300025914 Bacteria 1953
177 Ga0207660_10000951 3300025917 Bacteria 19171
178 Ga0207660_10011228 3300025917 Bacteria 5826
179 Ga0207657_10003509 3300025919 Bacteria 16744
180 Ga0207657_10007321 3300025919 Bacteria 11322
181 Ga0207657_10017290 3300025919 Bacteria 6922
182 Ga0207657_10021119 3300025919 Bacteria 6134
183 Ga0207657_10061560 3300025919 Bacteria 3217
184 Ga0207657_10070369 3300025919 Bacteria 2966
185 Ga0207657_10071475 3300025919 Bacteria 2938
186 Ga0207657_10083170 3300025919 Bacteria 2686
187 Ga0207657_10114754 3300025919 Unclassified 2221
188 Ga0207657_10174613 3300025919 Unclassified 1739
189 Ga0207649_10000011 3300025920 Bacteria 266219
190 Ga0207649_10005260 3300025920 Bacteria 6996
191 Ga0207649_10010641 3300025920 Bacteria 5058
192 Ga0207652_10000001 3300025921 Bacteria 1006643
193 Ga0207652_10000002 3300025921 Bacteria 878035
194 Ga0207652_10113440 3300025921 Bacteria 2406
195 Ga0207652_10208429 3300025921 Bacteria 1760
196 Ga0207694_10000011 3300025924 Bacteria 417640
197 Ga0207694_10012853 3300025924 Bacteria 6305
198 Ga0207694_10026522 3300025924 Bacteria 4408
199 Ga0207659_10019430 3300025926 Bacteria 4473
200 Ga0207644_10001523 3300025931 Bacteria 14942
201 Ga0207644_10013384 3300025931 Bacteria 5467
202 Ga0207690_10001973 3300025932 Bacteria 12564
203 Ga0207690_10005548 3300025932 Bacteria 7449
204 Ga0207690_10014564 3300025932 Bacteria 4750
205 Ga0207690_10031951 3300025932 Bacteria 3374
206 Ga0207706_10002853 3300025933 Bacteria 16775
207 Ga0207706_10016430 3300025933 Bacteria 6681
208 Ga0207706_10024238 3300025933 Bacteria 5440
209 Ga0207706_10025153 3300025933 Bacteria 5337
210 Ga0207706_10063370 3300025933 Bacteria 3255
211 Ga0207686_10010042 3300025934 Bacteria 5150
212 Ga0207669_10016893 3300025937 Bacteria 3726
213 Ga0207704_10136676 3300025938 Unclassified 1707
214 Ga0207691_10004286 3300025940 Bacteria 13860
215 Ga0207691_10012677 3300025940 Bacteria 8074
216 Ga0207691_10013663 3300025940 Bacteria 7758
217 Ga0207691_10045971 3300025940 Bacteria 4013
218 Ga0207711_10000345 3300025941 Bacteria 49338
219 Ga0207711_10004198 3300025941 Bacteria 12335
220 Ga0207711_10051289 3300025941 Bacteria 3533
221 Ga0207661_10014283 3300025944 Bacteria 5816
222 Ga0207661_10026248 3300025944 Bacteria 4435
223 Ga0207661_10027319 3300025944 Bacteria 4358
224 Ga0207679_10013785 3300025945 Bacteria 5301
225 Ga0207679_10056492 3300025945 Bacteria 2898
226 Ga0207679_10143875 3300025945 Bacteria 1931
227 Ga0207667_10000050 3300025949 Bacteria 234390
228 Ga0207667_10016893 3300025949 Bacteria 8233
229 Ga0207651_10017450 3300025960 Bacteria 4243
230 Ga0207640_10002725 3300025981 Bacteria 9449
231 Ga0207640_10115670 3300025981 Bacteria 1910
232 Ga0207658_10108578 3300025986 Bacteria 2189
233 Ga0207658_10121403 3300025986 Bacteria 2084
234 Ga0207677_10036297 3300026023 Bacteria 3211
235 Ga0207703_10038455 3300026035 Bacteria 3818
236 Ga0207639_10009043 3300026041 Bacteria 6863
237 Ga0207678_10002237 3300026067 Bacteria 17496
238 Ga0207678_10020591 3300026067 Bacteria 5783
239 Ga0207678_10136008 3300026067 Bacteria 2097
240 Ga0207702_10017005 3300026078 Bacteria 6019
241 Ga0207702_10133835 3300026078 Bacteria 2234
242 Ga0207702_10137257 3300026078 Bacteria 2208
243 Ga0207702_10201761 3300026078 Bacteria 1844
244 Ga0207641_10140279 3300026088 Bacteria 2180
245 Ga0207641_10277246 3300026088 Unclassified 1575
246 Ga0207648_10005937 3300026089 Bacteria 12213
247 Ga0207648_10016189 3300026089 Bacteria 6824
248 Ga0207676_10014056 3300026095 Bacteria 5750
249 Ga0207676_10017609 3300026095 Bacteria 5180
250 Ga0207676_10056717 3300026095 Bacteria 3081
251 Ga0207674_10005682 3300026116 Bacteria 14788
252 Ga0207683_10024569 3300026121 Bacteria 5190
253 Ga0207683_10040908 3300026121 Bacteria 4047
254 Ga0207683_10098074 3300026121 Bacteria 2615
255 Ga0207698_10005661 3300026142 Bacteria 7738
256 Ga0207698_10025811 3300026142 Bacteria 4147
257 Ga0268266_10062450 3300028379 Bacteria 3215
258 Ga0268266_10066237 3300028379 Bacteria 3123
259 Ga0268264_10145895 3300028381 Bacteria 2116
260 Ga0265318_10000072 3300028577 Bacteria 96797
261 Ga0307408_100024962 3300031548 Bacteria 4088
262 Ga0307516_10009375 3300031730 Bacteria 10920
263 Ga0307405_10103109 3300031731 Bacteria 1917
264 Ga0307405_10107934 3300031731 Bacteria 1880
265 Ga0307413_10079945 3300031824 Bacteria 2091
266 Ga0307413_10161763 3300031824 Bacteria 1574
267 Ga0307410_10000658 3300031852 Bacteria 14276
268 Ga0307410_10003486 3300031852 Bacteria 7899
269 Ga0307410_10060502 3300031852 Bacteria 2588
270 Ga0307410_10072856 3300031852 Bacteria 2387
271 Ga0307410_10086041 3300031852 Bacteria 2220
272 Ga0307406_10007490 3300031901 Bacteria 6055
273 Ga0307407_10032811 3300031903 Bacteria 2827
274 Ga0307412_10027830 3300031911 Bacteria 3530
275 Ga0307412_10040067 3300031911 Bacteria 3030
276 Ga0307409_100016764 3300031995 Bacteria 4860
277 Ga0307409_100046793 3300031995 Bacteria 3277
278 Ga0307409_100145315 3300031995 Bacteria 2050
279 Ga0307409_100161443 3300031995 Bacteria 1960
280 Ga0307409_100178217 3300031995 Bacteria 1878
281 Ga0307409_100292722 3300031995 Bacteria 1510
282 Ga0307416_100059236 3300032002 Bacteria 3110
283 Ga0307414_10020719 3300032004 Bacteria 4105
284 Ga0307414_10042867 3300032004 Bacteria 3078
285 Ga0307414_10055569 3300032004 Bacteria 2773
286 Ga0307414_10078994 3300032004 Bacteria 2400
287 Ga0307414_10127837 3300032004 Bacteria 1967
288 Ga0307414_10236089 3300032004 Bacteria 1510
289 Ga0307411_10003235 3300032005 Bacteria 7505
290 Ga0307411_10005043 3300032005 Bacteria 6427
291 Ga0307411_10007485 3300032005 Bacteria 5569
292 Ga0307411_10021611 3300032005 Bacteria 3770
293 Ga0307411_10032696 3300032005 Bacteria 3217
294 Ga0307411_10068593 3300032005 Bacteria 2391
295 Ga0307411_10084974 3300032005 Bacteria 2190
296 Ga0307415_100003615 3300032126 Bacteria 7900
297 Ga0307415_100012747 3300032126 Bacteria 4874
298 Ga0307415_100047691 3300032126 Bacteria 2885
299 Ga0307510_10000007 3300033180 Bacteria 558582
300 Ga0373931_0042749 3300035691 Bacteria 2384
301 Ga0395899_0050070 3300037312 Bacteria 3102
302 Ga0395899_0050565 3300037312 Bacteria 3085
303 Ga0395899_0066082 3300037312 Bacteria 2656
304 Ga0395900_0000849 3300037418 Bacteria 40245
305 Ga0395900_0012721 3300037418 Bacteria 8600
306 Ga0395900_0019842 3300037418 Bacteria 6852
307 Ga0395900_0020627 3300037418 Bacteria 6733
308 Ga0395900_0029935 3300037418 Bacteria 5587
309 Ga0395900_0057163 3300037418 Bacteria 4016
310 Ga0395900_0123764 3300037418 Bacteria 2652
311 Ga0395900_0128884 3300037418 Bacteria 2593
312 Ga0395900_0166992 3300037418 Bacteria 2242
313 Ga0395900_0292088 3300037418 Unclassified 1618
314 Ga0395898_0075569 3300037466 Bacteria 3254
315 Ga0395898_0229200 3300037466 Bacteria 1772
316 Ga0395905_0000519 3300037471 Bacteria 52760
317 Ga0395905_0013679 3300037471 Bacteria 7772
318 Ga0395905_0037929 3300037471 Bacteria 4522
319 Ga0395905_0047940 3300037471 Bacteria 4003
320 Ga0395905_0111374 3300037471 Bacteria 2570
321 Ga0395905_0119903 3300037471 Bacteria 2472
322 Ga0395905_0162108 3300037471 Bacteria 2101
323 Ga0395905_0183015 3300037471 Bacteria 1967
324 Ga0395905_0205955 3300037471 Bacteria 1843
325 Ga0395905_0311438 3300037471 Bacteria 1463
326 Ga0395901_0000041 3300038443 Bacteria 202314
327 Ga0395901_0000782 3300038443 Bacteria 35570
328 Ga0395901_0060245 3300038443 Bacteria 3949
329 Ga0395901_0109737 3300038443 Bacteria 2897
330 Ga0395901_0145331 3300038443 Bacteria 2493
331 Ga0395901_0193144 3300038443 Bacteria 2135
332 Ga0395901_0274587 3300038443 Bacteria 1752
333 Ga0395901_0343195 3300038443 Bacteria 1542
334 Ga0395901_0345085 3300038443 Bacteria 1537
335 Ga0436365_0044388 3300039437 Bacteria 123489
336 Ga0436365_0132877 3300039437 Bacteria 2533
337 Ga0436365_0256427 3300039437 Bacteria 9558
338 Ga0436365_1654841 3300039437 Bacteria 47529
339 Ga0436363_1460569 3300039450 Bacteria 1618
340 Ga0436362_1051662 3300039453 Bacteria 138391
341 Ga0439435_0023665 3300042436 Bacteria 1615
342 Ga0439459_0006608 3300042438 Bacteria 1936
343 Ga0466969_0001617 3300044656 Bacteria 12070
344 Ga0466966_0000492 3300044684 Bacteria 25352
345 Ga0466966_0033607 3300044684 Bacteria 3320
346 Ga0466961_0000868 3300044693 Bacteria 18843
347 Ga0466961_0065794 3300044693 Bacteria 2303
348 Ga0466961_0080089 3300044693 Bacteria 2068
349 Ga0466963_0007629 3300044694 Bacteria 6457
350 Ga0466963_0016451 3300044694 Unclassified 4599
351 Ga0466963_0029718 3300044694 Bacteria 3520
352 Ga0466963_0039798 3300044694 Bacteria 3080
353 Ga0466963_0133310 3300044694 Bacteria 1717
354 Ga0466964_0007585 3300044706 Bacteria 4059
355 Ga0466964_0008782 3300044706 Bacteria 3799
356 Ga0466971_0000632 3300044719 Bacteria 14039
357 Ga0466971_0086669 3300044719 Bacteria 1431
358 Ga0466968_0002118 3300044735 Bacteria 7228
359 Ga0466970_0053128 3300044765 Bacteria 2163
360 Ga0466970_0085134 3300044765 Bacteria 1712
361 Ga0466957_0013744 3300044842 Bacteria 4702
362 Ga0466957_0038833 3300044842 Bacteria 2870
363 Ga0466957_0095646 3300044842 Bacteria 1866
364 Ga0466960_0033341 3300044901 Bacteria 2392
365 Ga0466959_0000511 3300045049 Bacteria 22572
366 Ga0466959_0067777 3300045049 Bacteria 2586
367 Ga0466958_0000818 3300045836 Bacteria 13744
368 Ga0466958_0092415 3300045836 Bacteria 1873
369 Ga0466967_0014978 3300045976 Bacteria 6063
370 Ga0466967_0016590 3300045976 Bacteria 5816
371 Ga0466967_0046786 3300045976 Bacteria 3769
372 Ga0466967_0150781 3300045976 Bacteria 2173
373 Ga0495638_0001206 3300046460 Bacteria 24684
374 Ga0495650_0000069 3300046471 Bacteria 261124
375 Ga0495664_0047491 3300046477 Bacteria 2548
376 Ga0495606_0004031 3300046507 Bacteria 14979
377 Ga0495610_0000378 3300046512 Bacteria 45991
378 Ga0495616_0064258 3300046513 Bacteria 1791
379 Ga0495620_0005035 3300046515 Bacteria 7406
380 Ga0495643_0034138 3300046522 Bacteria 2809
381 Ga0495642_0012724 3300046528 Bacteria 3247
382 Ga0495654_0000285 3300046530 Bacteria 46016
383 Ga0495621_0034825 3300046539 Unclassified 1741
384 Ga0495645_0020534 3300046543 Bacteria 4768
385 Ga0495625_0003460 3300046660 Bacteria 15720
386 Ga0495625_0014409 3300046660 Bacteria 6311
387 Ga0495625_0050255 3300046660 Bacteria 2992
388 Ga0495669_0014086 3300046684 Bacteria 3417
389 Ga0495669_0040236 3300046684 Bacteria 2072
390 Ga0495660_0004120 3300046810 Bacteria 8859
391 Ga0495672_0000663 3300047320 Bacteria 38282
392 Ga0495675_0006836 3300047444 Bacteria 7001
393 Ga0495673_0001751 3300047469 Bacteria 16546
394 Ga0495686_0026577 3300047472 Bacteria 3786
395 Ga0495686_0085704 3300047472 Bacteria 1917
396 Ga0496100_0008563 3300048903 Bacteria 5708
397 Ga0496101_0001508 3300048904 Bacteria 13943
398 Ga0496101_0003840 3300048904 Bacteria 9392
399 Ga0496102_0104242 3300048905 Bacteria 2638
400 Ga0496104_0132887 3300048907 Bacteria 2391
401 Ga0496106_0001460 3300048909 Bacteria 17764
402 Ga0496106_0022804 3300048909 Bacteria 4650
403 Ga0496107_0004134 3300048910 Bacteria 9785
404 Ga0496107_0022881 3300048910 Bacteria 4418
405 Ga0496108_0015084 3300048911 Bacteria 6308
406 Ga0496109_0001761 3300048912 Bacteria 17994
407 Ga0496109_0009942 3300048912 Bacteria 8124
408 Ga0496110_0009390 3300048913 Bacteria 7919
409 Ga0496111_0003665 3300048914 Bacteria 9538
410 Ga0496113_0012540 3300048916 Bacteria 5702
411 Ga0496115_0001431 3300048918 Bacteria 17100
412 Ga0495682_0001113 3300049460 Bacteria 15638
413 Ga0501033_0002610 3300049570 Bacteria 15185
414 Ga0501034_0005456 3300049571 Bacteria 13890
415 Ga0501046_0230908 3300049580 Bacteria 1367
416 Ga0501067_0048068 3300049583 Bacteria 2366
417 Ga0501068_0097652 3300049584 Bacteria 1818
418 Ga0501044_0004321 3300049823 Bacteria 15928
419 nmdc:mga0k408_17241_c1 3300050493 Bacteria 4020
420 Ga0500583_0017161 3300053092 Bacteria 2908
421 Ga0500554_001873 3300053102 Bacteria 4071
422 Ga0500562_001283 3300053108 Bacteria 6203
423 Ga0500591_031250 3300053115 Bacteria 2567
424 Ga0500618_000071 3300053125 Bacteria 85596
425 Ga0500655_007968 3300053133 Bacteria 1907
426 Ga0500559_0000031 3300053136 Bacteria 114782
427 Ga0500568_0000245 3300053139 Bacteria 46212
428 Ga0500616_0000140 3300053153 Bacteria 122250
429 Ga0500622_0005146 3300053156 Bacteria 7932
430 Ga0500622_0008310 3300053156 Bacteria 5817
431 Ga0500627_0003986 3300053158 Bacteria 4667
432 Ga0500637_0000887 3300053178 Bacteria 12034
433 Ga0466962_0000509 3300061719 Bacteria 16925
434 Ga0466962_0004059 3300061719 Bacteria 7006
435 2585155359 2582581280 Bacteria 5994497
436 2585198923 2582581293 Bacteria 5907401
437 2643748262 2643221545 Bacteria 5083237
438 2643779076 2643221552 Bacteria 5708754
439 2643927643 2643221584 Bacteria 5511711
440 2644508007 2643221691 Bacteria 5093099
441 2819539584 2818991435 Bacteria 5433759
442 2819648792 2818991454 Bacteria 5563326
443 Ga0265338_10013108
444 JGI24740J21852_10001232
445 JGI24739J22299_10001570
446 JGI24735J21928_10004846
447 JGI24735J21928_10009735
448 JGI24744J21845_10000200
449 rootH1_10061404
450 rootH1_10100938
451 Ga0055537_1000646
452 Ga0055524_1009262
453 Ga0055528_1002895
454 Ga0055531_10020935
455 Ga0070658_10000033
456 Ga0070658_10010021
457 Ga0070658_10021683
458 Ga0070658_10103398
459 Ga0070658_10158468
460 Ga0070683_100005325
461 Ga0070683_100056151
462 Ga0070683_100075480
463 Ga0070683_100128874
464 Ga0070690_100004330
465 Ga0070670_100063395
466 Ga0068869_100029535
467 Ga0070666_10007359
468 Ga0070666_10054341
469 Ga0070680_100000896
470 Ga0070682_100022916
471 Ga0070682_100042480
472 Ga0068868_100057557
473 Ga0070660_100012465
474 Ga0070660_100012474
475 Ga0070660_100032761
476 Ga0070691_10000243
477 Ga0070661_100000114
478 Ga0070661_100007497
479 Ga0070661_100017301
480 Ga0070661_100113006
481 Ga0070692_10003275
482 Ga0070692_10039632
483 Ga0070669_100142650
484 Ga0070675_100004750
485 Ga0070675_100145237
486 Ga0070671_100013084
487 Ga0070671_100065478
488 Ga0070674_100009553
489 Ga0070673_100011648
490 Ga0070673_100040963
491 Ga0070659_100006154
492 Ga0070659_100027988
493 Ga0070659_100029874
494 Ga0070659_100031973
495 Ga0070659_100036187
496 Ga0070667_100197026
497 Ga0070663_100002987
498 Ga0070663_100058770
499 Ga0070678_100011116
500 Ga0070678_100026944
501 Ga0070662_100005842
502 Ga0070662_100016262
503 Ga0070662_100041712
504 Ga0070681_10001905
505 Ga0070681_10023086
506 Ga0070679_100000084
507 Ga0070679_100065796
508 Ga0070684_100022778
509 Ga0068853_100007461
510 Ga0068853_100028801
511 Ga0068853_100156852
512 Ga0070672_100001479
513 Ga0070672_100027362
514 Ga0070686_100056317
515 Ga0070665_100004829
516 Ga0068855_100000047
517 Ga0068855_100013185
518 Ga0068855_100193640
519 Ga0070664_100005462
520 Ga0070664_100014140
521 Ga0070664_100062223
522 Ga0068857_100012566
523 Ga0068854_100003724
524 Ga0068854_100005539
525 Ga0068854_100058860
526 Ga0068856_100024453
527 Ga0068856_100077106
528 Ga0068856_100082409
529 Ga0068852_100005727
530 Ga0068852_100007056
531 Ga0068852_100036049
532 Ga0068859_100018135
533 Ga0068859_100040456
534 Ga0068864_100000487
535 Ga0068864_100071953
536 Ga0068851_10009633
537 Ga0068851_10050095
538 Ga0068863_100016694
539 Ga0068863_100033822
540 Ga0068863_100060266
541 Ga0068858_100030052
542 Ga0081539_10000038
543 Ga0081539_10018266
544 Ga0075370_10066102
545 Ga0097620_100018135
546 Ga0097620_100040456
547 Ga0105240_10000647
548 Ga0105240_10021229
549 Ga0105240_10092822
550 Ga0105243_10022964
551 Ga0105241_10090800
552 Ga0105241_10101119
553 Ga0105242_10130007
554 Ga0105248_10001528
555 Ga0105248_10019256
556 Ga0105248_10027431
557 Ga0105248_10464021
558 Ga0105237_10053612
559 Ga0105238_10006858
560 Ga0105238_10073791
561 Ga0105238_10100336
562 Ga0105239_10001683
563 Ga0105239_10039797
564 Ga0105239_10136742
565 Ga0157373_10024884
566 Ga0157373_10095568
567 Ga0157371_10005645
568 Ga0157370_10005211
569 Ga0157370_10102902
570 Ga0157370_10278219
571 Ga0157369_10010073
572 Ga0157369_10022111
573 Ga0157374_10003450
574 Ga0157374_10128247
575 Ga0157374_10226226
576 Ga0157378_10058402
577 Ga0163162_10107573
578 Ga0157372_10026759
579 Ga0157372_10035515
580 Ga0157375_10061597
581 Ga0157375_10161334
582 Ga0163163_10047514
583 Ga0163163_10142302
584 Ga0157376_10048842
585 Ga0206354_11177839
586 Ga0206353_10393260
587 Ga0213873_10000013
588 Ga0213876_10000072
589 Ga0213876_10000310
590 Ga0213876_10010220
591 Ga0209565_1000118
592 Ga0209673_1001150
593 Ga0209758_1000835
594 Ga0209758_1011719
595 Ga0209256_1011665
596 Ga0209257_1000506
597 Ga0207697_10012061
598 Ga0207697_10027588
599 Ga0207656_10007905
600 Ga0207656_10059712
601 Ga0207688_10025940
602 Ga0207680_10005418
603 Ga0207647_10000769
604 Ga0207647_10021746
605 Ga0207645_10091193
606 Ga0207705_10000002
607 Ga0207705_10009397
608 Ga0207705_10012299
609 Ga0207705_10012359
610 Ga0207705_10016966
611 Ga0207705_10086738
612 Ga0207707_10005427
613 Ga0207707_10022978
614 Ga0207707_10024266
615 Ga0207695_10000003
616 Ga0207695_10009389
617 Ga0207695_10096280
618 Ga0207671_10127133
619 Ga0207660_10000951
620 Ga0207660_10011228
621 Ga0207657_10003509
622 Ga0207657_10007321
623 Ga0207657_10017290
624 Ga0207657_10021119
625 Ga0207657_10061560
626 Ga0207657_10070369
627 Ga0207657_10071475
628 Ga0207657_10083170
629 Ga0207657_10114754
630 Ga0207657_10174613
631 Ga0207649_10000011
632 Ga0207649_10005260
633 Ga0207649_10010641
634 Ga0207652_10000001
635 Ga0207652_10000002
636 Ga0207652_10113440
637 Ga0207652_10208429
638 Ga0207694_10000011
639 Ga0207694_10012853
640 Ga0207694_10026522
641 Ga0207659_10019430
642 Ga0207644_10001523
643 Ga0207644_10013384
644 Ga0207690_10001973
645 Ga0207690_10005548
646 Ga0207690_10014564
647 Ga0207690_10031951
648 Ga0207706_10002853
649 Ga0207706_10016430
650 Ga0207706_10024238
651 Ga0207706_10025153
652 Ga0207706_10063370
653 Ga0207686_10010042
654 Ga0207669_10016893
655 Ga0207704_10136676
656 Ga0207691_10004286
657 Ga0207691_10012677
658 Ga0207691_10013663
659 Ga0207691_10045971
660 Ga0207711_10000345
661 Ga0207711_10004198
662 Ga0207711_10051289
663 Ga0207661_10014283
664 Ga0207661_10026248
665 Ga0207661_10027319
666 Ga0207679_10013785
667 Ga0207679_10056492
668 Ga0207679_10143875
669 Ga0207667_10000050
670 Ga0207667_10016893
671 Ga0207651_10017450
672 Ga0207640_10002725
673 Ga0207640_10115670
674 Ga0207658_10108578
675 Ga0207658_10121403
676 Ga0207677_10036297
677 Ga0207703_10038455
678 Ga0207639_10009043
679 Ga0207678_10002237
680 Ga0207678_10020591
681 Ga0207678_10136008
682 Ga0207702_10017005
683 Ga0207702_10133835
684 Ga0207702_10137257
685 Ga0207702_10201761
686 Ga0207641_10140279
687 Ga0207641_10277246
688 Ga0207648_10005937
689 Ga0207648_10016189
690 Ga0207676_10014056
691 Ga0207676_10017609
692 Ga0207676_10056717
693 Ga0207674_10005682
694 Ga0207683_10024569
695 Ga0207683_10040908
696 Ga0207683_10098074
697 Ga0207698_10005661
698 Ga0207698_10025811
699 Ga0268266_10062450
700 Ga0268266_10066237
701 Ga0268264_10145895
702 Ga0265318_10000072
703 Ga0307408_100024962
704 Ga0307516_10009375
705 Ga0307405_10103109
706 Ga0307405_10107934
707 Ga0307413_10079945
708 Ga0307413_10161763
709 Ga0307410_10000658
710 Ga0307410_10003486
711 Ga0307410_10060502
712 Ga0307410_10072856
713 Ga0307410_10086041
714 Ga0307406_10007490
715 Ga0307407_10032811
716 Ga0307412_10027830
717 Ga0307412_10040067
718 Ga0307409_100016764
719 Ga0307409_100046793
720 Ga0307409_100145315
721 Ga0307409_100161443
722 Ga0307409_100178217
723 Ga0307409_100292722
724 Ga0307416_100059236
725 Ga0307414_10020719
726 Ga0307414_10042867
727 Ga0307414_10055569
728 Ga0307414_10078994
729 Ga0307414_10127837
730 Ga0307414_10236089
731 Ga0307411_10003235
732 Ga0307411_10005043
733 Ga0307411_10007485
734 Ga0307411_10021611
735 Ga0307411_10032696
736 Ga0307411_10068593
737 Ga0307411_10084974
738 Ga0307415_100003615
739 Ga0307415_100012747
740 Ga0307415_100047691
741 Ga0307510_10000007
742 Ga0373931_0042749
743 Ga0395899_0050070
744 Ga0395899_0050565
745 Ga0395899_0066082
746 Ga0395900_0000849
747 Ga0395900_0012721
748 Ga0395900_0019842
749 Ga0395900_0020627
750 Ga0395900_0029935
751 Ga0395900_0057163
752 Ga0395900_0123764
753 Ga0395900_0128884
754 Ga0395900_0166992
755 Ga0395900_0292088
756 Ga0395898_0075569
757 Ga0395898_0229200
758 Ga0395905_0000519
759 Ga0395905_0013679
760 Ga0395905_0037929
761 Ga0395905_0047940
762 Ga0395905_0111374
763 Ga0395905_0119903
764 Ga0395905_0162108
765 Ga0395905_0183015
766 Ga0395905_0205955
767 Ga0395905_0311438
768 Ga0395901_0000041
769 Ga0395901_0000782
770 Ga0395901_0060245
771 Ga0395901_0109737
772 Ga0395901_0145331
773 Ga0395901_0193144
774 Ga0395901_0274587
775 Ga0395901_0343195
776 Ga0395901_0345085
777 Ga0436365_0044388
778 Ga0436365_0132877
779 Ga0436365_0256427
780 Ga0436365_1654841
781 Ga0436363_1460569
782 Ga0436362_1051662
783 Ga0439435_0023665
784 Ga0439459_0006608
785 Ga0466969_0001617
786 Ga0466966_0000492
787 Ga0466966_0033607
788 Ga0466961_0000868
789 Ga0466961_0065794
790 Ga0466961_0080089
791 Ga0466963_0007629
792 Ga0466963_0016451
793 Ga0466963_0029718
794 Ga0466963_0039798
795 Ga0466963_0133310
796 Ga0466964_0007585
797 Ga0466964_0008782
798 Ga0466971_0000632
799 Ga0466971_0086669
800 Ga0466968_0002118
801 Ga0466970_0053128
802 Ga0466970_0085134
803 Ga0466957_0013744
804 Ga0466957_0038833
805 Ga0466957_0095646
806 Ga0466960_0033341
807 Ga0466959_0000511
808 Ga0466959_0067777
809 Ga0466958_0000818
810 Ga0466958_0092415
811 Ga0466967_0014978
812 Ga0466967_0016590
813 Ga0466967_0046786
814 Ga0466967_0150781
815 Ga0495638_0001206
816 Ga0495650_0000069
817 Ga0495664_0047491
818 Ga0495606_0004031
819 Ga0495610_0000378
820 Ga0495616_0064258
821 Ga0495620_0005035
822 Ga0495643_0034138
823 Ga0495642_0012724
824 Ga0495654_0000285
825 Ga0495621_0034825
826 Ga0495645_0020534
827 Ga0495625_0003460
828 Ga0495625_0014409
829 Ga0495625_0050255
830 Ga0495669_0014086
831 Ga0495669_0040236
832 Ga0495660_0004120
833 Ga0495672_0000663
834 Ga0495675_0006836
835 Ga0495673_0001751
836 Ga0495686_0026577
837 Ga0495686_0085704
838 Ga0496100_0008563
839 Ga0496101_0001508
840 Ga0496101_0003840
841 Ga0496102_0104242
842 Ga0496104_0132887
843 Ga0496106_0001460
844 Ga0496106_0022804
845 Ga0496107_0004134
846 Ga0496107_0022881
847 Ga0496108_0015084
848 Ga0496109_0001761
849 Ga0496109_0009942
850 Ga0496110_0009390
851 Ga0496111_0003665
852 Ga0496113_0012540
853 Ga0496115_0001431
854 Ga0495682_0001113
855 Ga0501033_0002610
856 Ga0501034_0005456
857 Ga0501046_0230908
858 Ga0501067_0048068
859 Ga0501068_0097652
860 Ga0501044_0004321
861 nmdc:mga0k408_17241_c1
862 Ga0500583_0017161
863 Ga0500554_001873
864 Ga0500562_001283
865 Ga0500591_031250
866 Ga0500618_000071
867 Ga0500655_007968
868 Ga0500559_0000031
869 Ga0500568_0000245
870 Ga0500616_0000140
871 Ga0500622_0005146
872 Ga0500622_0008310
873 Ga0500627_0003986
874 Ga0500637_0000887
875 Ga0466962_0000509
876 Ga0466962_0004059
877 2585155359
878 2585198923
879 2643748262
880 2643779076
881 2643927643
882 2644508007
883 2819539584
884 2819648792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

64

361

0.82

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

68

389

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c0t-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (n81a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine 0.8735 23 433
7c15-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (q274a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) 0.8716 23 431
3uor-assembly2.cif.gz_B the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri 0.8684 24 433
7c19-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (y224a/y246a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) 0.8658 23 431
7c0s-assembly1.cif.gz_A crystal structure of a dinucleotide-binding protein (f79a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) 0.8636 23 433
ID Description Score Start End Superfamily
4r9gB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9021 23 151 3.40.190.10
3uorB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.873 24 150 3.40.190.10
3k02A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.845 23 371 3.40.190.10
4rjzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8397 24 150 3.40.190.10
1eljA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8262 22 150 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A841L4J2-F1-model_v4 Multiple sugar transport system substrate-binding protein 0.9819 14 435 GO:0042597
AF-A0A841L4J2-F1-model_v4 Multiple sugar transport system substrate-binding protein 0.9705 14 435 GO:0042597
AF-A0A1R4B6D9-F1-model_v4 Maltose ABC transporter periplasmic protein 0.9664 16 434
AF-X5QAE2-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9582 24 434 GO:0042597
AF-A0A1R4B6D9-F1-model_v4 Maltose ABC transporter periplasmic protein 0.9294 16 434

Map