metagRoot

F444906

General Info

Members	Datasets	Scaffolds	Average Seq Length
442	272	436	615

Family's Representative Sequence

Representative Sequence	3300033180\|Ga0307510_10017217\|Ga0307510_100172175
Length	646
Sequence	MNETDAGPPQGGLDPLGGSDAVHRGRGAPIRPRIEATNDFVVKFANVNGSGSASANELFARSLLRMGVPVSPRNIFPSNIQGLPTWYEVRVNEKGWLGRRGGVDLMVAMNPQTWNQDVAEIEPGGYLMYDSSKPLPHASAGKFRDDIHVLGVPLTDLCATRYTDPRERQLLKNIVYVGVLAAMLGVEPEVIATLLGEQYKGKAKLIQPNLDAFMMGLHHGQEYLGDVLGLKVERRDAVGQKIFMEGNAAAALGCVYGGATVCAWYPITPSSSVAEAFQKYCSKLRVDKASGKHKFAIVQAEDEIASIGIVTGAGWNGARAFTCTSGPGVSLMTEFLGLAYFAEIPVTIINVQRGGPSTGMPTRTQQADVISCAYASHGDTKHVLLFPEDPKECFEFGAACLDLADRLQTPIFLMTDLDIGMNHRLCDPLEWDDLRQLDRGKVMTAADLDAGKNFGRYLDVDGDGIPYRTYPGTHPDKGAYFTRGTTRDAYARYSEAGPDYLYNVQRLLTKFETAKQLVPQPVVRQAAKPTKFGAIYYGSTSPAMNEAFEALQAQGVHVDTLRIRAFPFSAAVDLFLASHETVFVIEQNRDAQLRTLITTEQEVNPAKLEPILHYDGTPITARFITAAIAKHVAAHKVAPIKKGQAA

Samples

	Sample ID	Description	Type	Environment
1	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
2	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
3	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
4	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
5	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
6	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
9	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
13	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
14	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
15	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
16	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
17	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
18	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
21	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
24	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
25	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
26	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
27	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
28	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
29	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
30	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
31	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
32	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
33	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
34	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
35	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
36	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
37	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
38	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
39	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
40	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
41	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
42	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
43	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
44	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
45	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
46	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
47	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
48	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
49	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
50	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
51	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
52	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
53	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
54	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
55	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
56	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
57	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
58	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
59	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
60	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
61	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
62	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
63	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
64	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
65	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
66	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
67	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
68	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
69	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
70	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
72	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
73	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
75	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
77	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
78	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
79	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
80	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
81	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
82	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
83	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
84	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
85	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
86	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
87	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
88	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
89	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
90	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
91	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
92	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
93	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
94	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
141	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
145	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
146	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
147	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
148	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
149	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
150	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
151	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
152	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
153	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
154	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
155	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
156	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
157	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
158	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
159	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
160	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
161	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
162	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
163	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
164	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
165	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
166	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
167	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
168	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
169	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
170	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
171	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
172	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
173	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
175	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
176	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
177	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
178	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
179	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
180	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
181	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
182	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
183	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
184	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
185	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
186	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
187	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
188	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
189	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
190	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
191	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
192	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
193	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
194	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
195	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
196	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
197	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
198	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
199	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
200	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
201	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
202	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
203	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
204	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
205	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
206	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
207	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
208	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
209	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
210	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
211	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
212	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
213	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
214	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
215	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
216	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
217	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
218	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
219	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
220	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
221	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
222	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
223	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
224	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
225	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
226	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
227	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
228	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
229	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
232	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
233	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
234	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
237	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
239	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
240	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
241	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
242	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
243	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
244	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
247	3300049757	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control	Metagenome	Rhizosphere
248	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
249	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
251	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
252	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
253	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
254	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
255	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
256	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
257	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
258	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
259	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
260	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
261	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
262	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
263	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
264	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
265	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
266	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
267	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
268	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
269	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
270	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
271	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
272	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.64
Metatranscriptomes	0
Isolates	1.36

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.47
Nodule	0
Rhizoplane	3.62
Rhizosphere	83.03
Stem	0
Stem Tuber	0
Unclassified	5.88

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070690_100016168	3300005330	Bacteria	4464
2	Ga0068869_100034069	3300005334	Bacteria	3600
3	Ga0070666_10001885	3300005335	Bacteria	12762
4	Ga0070666_10007780	3300005335	Bacteria	6620
5	Ga0070680_100006908	3300005336	Bacteria	8650
6	Ga0068868_100006706	3300005338	Bacteria	8170
7	Ga0068868_100045343	3300005338	Bacteria	3439
8	Ga0068868_100076709	3300005338	Bacteria	2672
9	Ga0070661_100002745	3300005344	Bacteria	12070
10	Ga0070661_100055706	3300005344	Bacteria	2895
11	Ga0070668_100018126	3300005347	Bacteria	5282
12	Ga0070669_100070758	3300005353	Bacteria	2579
13	Ga0070675_100000234	3300005354	Bacteria	35700
14	Ga0070675_100001074	3300005354	Bacteria	19712
15	Ga0070671_100001342	3300005355	Bacteria	18434
16	Ga0070671_100006863	3300005355	Bacteria	9116
17	Ga0070671_100011847	3300005355	Bacteria	7014
18	Ga0070671_100012181	3300005355	Bacteria	6921
19	Ga0070674_100000930	3300005356	Bacteria	15278
20	Ga0070674_100002036	3300005356	Bacteria	11079
21	Ga0070674_100002586	3300005356	Bacteria	10017
22	Ga0070674_100018882	3300005356	Bacteria	4369
23	Ga0070673_100002987	3300005364	Bacteria	10440
24	Ga0070673_100010668	3300005364	Bacteria	6230
25	Ga0070673_100016278	3300005364	Bacteria	5253
26	Ga0070659_100081731	3300005366	Bacteria	2580
27	Ga0070667_100000011	3300005367	Bacteria	269772
28	Ga0070667_100000790	3300005367	Bacteria	29685
29	Ga0070667_100002896	3300005367	Bacteria	14740
30	Ga0070667_100037254	3300005367	Bacteria	4078
31	Ga0070713_100001126	3300005436	Bacteria	17067
32	Ga0070711_100000322	3300005439	Bacteria	24746
33	Ga0070705_100000010	3300005440	Bacteria	102079
34	Ga0070700_100012270	3300005441	Bacteria	4775
35	Ga0070694_100050829	3300005444	Bacteria	2795
36	Ga0070694_100096537	3300005444	Bacteria	2083
37	Ga0070708_100014686	3300005445	Bacteria	6452
38	Ga0070678_100004674	3300005456	Bacteria	7791
39	Ga0070678_100019812	3300005456	Bacteria	4397
40	Ga0070678_100041682	3300005456	Bacteria	3256
41	Ga0070662_100072775	3300005457	Bacteria	2538
42	Ga0068867_100000016	3300005459	Bacteria	108420
43	Ga0068867_100000720	3300005459	Bacteria	22110
44	Ga0068867_100108348	3300005459	Bacteria	2131
45	Ga0070685_10003624	3300005466	Bacteria	7839
46	Ga0070685_10007927	3300005466	Bacteria	5442
47	Ga0070706_100015649	3300005467	Bacteria	7007
48	Ga0070706_100061844	3300005467	Bacteria	3458
49	Ga0070706_100135181	3300005467	Bacteria	2302
50	Ga0070698_100087356	3300005471	Bacteria	3104
51	Ga0070699_100002037	3300005518	Bacteria	18262
52	Ga0070697_100026147	3300005536	Bacteria	4659
53	Ga0068853_100040469	3300005539	Bacteria	3976
54	Ga0068853_100094250	3300005539	Bacteria	2637
55	Ga0070672_100002586	3300005543	Bacteria	11559
56	Ga0070695_100000497	3300005545	Bacteria	20541
57	Ga0070695_100017948	3300005545	Bacteria	4293
58	Ga0070696_100000451	3300005546	Bacteria	25739
59	Ga0070693_100000467	3300005547	Bacteria	18138
60	Ga0070665_100034526	3300005548	Bacteria	5086
61	Ga0070665_100169667	3300005548	Bacteria	2183
62	Ga0070704_100001333	3300005549	Bacteria	13084
63	Ga0068855_100031833	3300005563	Bacteria	6296
64	Ga0068856_100031307	3300005614	Bacteria	5204
65	Ga0068856_100035423	3300005614	Bacteria	4892
66	Ga0070702_100028007	3300005615	Bacteria	3048
67	Ga0068852_100017328	3300005616	Bacteria	5649
68	Ga0068852_100020448	3300005616	Bacteria	5265
69	Ga0068852_100026292	3300005616	Bacteria	4729
70	Ga0068852_100056691	3300005616	Bacteria	3387
71	Ga0068859_100020519	3300005617	Bacteria	6631
72	Ga0068859_100082079	3300005617	Bacteria	3266
73	Ga0068864_100000653	3300005618	Bacteria	28926
74	Ga0068864_100023467	3300005618	Bacteria	5180
75	Ga0068864_100041847	3300005618	Bacteria	3919
76	Ga0068861_100024872	3300005719	Bacteria	4336
77	Ga0068851_10013748	3300005834	Bacteria	3832
78	Ga0068863_100036364	3300005841	Bacteria	4691
79	Ga0068858_100001111	3300005842	Bacteria	27838
80	Ga0068858_100002455	3300005842	Bacteria	18716
81	Ga0068860_100031816	3300005843	Bacteria	5072
82	Ga0068860_100035843	3300005843	Bacteria	4757
83	Ga0068860_100076373	3300005843	Bacteria	3186
84	Ga0068862_100008060	3300005844	Bacteria	8722
85	Ga0068862_100057047	3300005844	Bacteria	3348
86	Ga0068862_100103905	3300005844	Bacteria	2489
87	Ga0081455_10000833	3300005937	Bacteria	39733
88	Ga0081540_1000066	3300005983	Bacteria	115420
89	Ga0075368_10014442	3300006042	Bacteria	2917
90	Ga0075363_100009747	3300006048	Bacteria	4524
91	Ga0075364_10000639	3300006051	Bacteria	18086
92	Ga0070715_10001636	3300006163	Bacteria	6628
93	Ga0070716_100018719	3300006173	Bacteria	3611
94	Ga0070716_100025217	3300006173	Bacteria	3171
95	Ga0070716_100025791	3300006173	Bacteria	3141
96	Ga0075367_10000965	3300006178	Bacteria	11742
97	Ga0075367_10011153	3300006178	Bacteria	4742
98	Ga0075366_10000437	3300006195	Bacteria	19473
99	Ga0075366_10017637	3300006195	Bacteria	4111
100	Ga0075366_10036794	3300006195	Bacteria	2886
101	Ga0075366_10041237	3300006195	Bacteria	2733
102	Ga0075370_10001650	3300006353	Bacteria	9855
103	Ga0075370_10001681	3300006353	Bacteria	9802
104	Ga0075370_10005122	3300006353	Bacteria	6462
105	Ga0075370_10032531	3300006353	Bacteria	2917
106	Ga0068871_100022566	3300006358	Bacteria	4854
107	Ga0068871_100023606	3300006358	Bacteria	4760
108	Ga0075428_100016873	3300006844	Bacteria	8064
109	Ga0075430_100010822	3300006846	Bacteria	7729
110	Ga0075431_100000050	3300006847	Bacteria	63805
111	Ga0075431_100005221	3300006847	Bacteria	12793
112	Ga0075431_100080368	3300006847	Bacteria	3366
113	Ga0075431_100184408	3300006847	Bacteria	2141
114	Ga0075433_10000404	3300006852	Bacteria	27547
115	Ga0075433_10007165	3300006852	Bacteria	8832
116	Ga0075434_100001846	3300006871	Bacteria	18283
117	Ga0097620_100020518	3300006931	Bacteria	6631
118	Ga0097620_100082080	3300006931	Bacteria	3266
119	Ga0075435_100013997	3300007076	Bacteria	5983
120	Ga0105240_10012961	3300009093	Bacteria	11484
121	Ga0105240_10083195	3300009093	Bacteria	3928
122	Ga0105240_10095994	3300009093	Bacteria	3614
123	Ga0111539_10006919	3300009094	Bacteria	14564
124	Ga0111539_10009333	3300009094	Bacteria	12392
125	Ga0105247_10016159	3300009101	Bacteria	4472
126	Ga0114129_10045800	3300009147	Bacteria	6148
127	Ga0105243_10004596	3300009148	Bacteria	10880
128	Ga0105248_10168452	3300009177	Bacteria	2469
129	Ga0105237_10026101	3300009545	Bacteria	5970
130	Ga0105237_10029159	3300009545	Bacteria	5613
131	Ga0105238_10061810	3300009551	Bacteria	3747
132	Ga0105238_10133691	3300009551	Bacteria	2458
133	Ga0105249_10007181	3300009553	Bacteria	9731
134	Ga0105239_10018069	3300010375	Bacteria	7800
135	Ga0105239_10032275	3300010375	Bacteria	5756
136	Ga0105239_10037001	3300010375	Bacteria	5354
137	Ga0105239_10082167	3300010375	Bacteria	3547
138	Ga0157370_10047867	3300013104	Bacteria	4097
139	Ga0157369_10025205	3300013105	Bacteria	6603
140	Ga0157369_10030896	3300013105	Bacteria	5904
141	Ga0157374_10004289	3300013296	Bacteria	11986
142	Ga0157372_10002463	3300013307	Bacteria	20056
143	Ga0157375_10013141	3300013308	Bacteria	7356
144	Ga0163163_10000601	3300014325	Bacteria	31448
145	Ga0163163_10000625	3300014325	Bacteria	30463
146	Ga0163163_10007006	3300014325	Bacteria	9903
147	Ga0163163_10020890	3300014325	Bacteria	6174
148	Ga0157380_10027399	3300014326	Bacteria	4334
149	Ga0157377_10000006	3300014745	Bacteria	419853
150	Ga0157379_10003126	3300014968	Bacteria	14018
151	Ga0157376_10068849	3300014969	Bacteria	2998
152	Ga0213876_10002613	3300021384	Bacteria	10520
153	Ga0209050_1004580	3300025298	Bacteria	9269
154	Ga0209257_1000061	3300025304	Bacteria	367698
155	Ga0207697_10020069	3300025315	Bacteria	2737
156	Ga0207682_10006912	3300025893	Bacteria	4549
157	Ga0207680_10003399	3300025903	Bacteria	7504
158	Ga0207680_10019767	3300025903	Bacteria	3609
159	Ga0207645_10046049	3300025907	Bacteria	2787
160	Ga0207684_10041093	3300025910	Bacteria	3922
161	Ga0207684_10043672	3300025910	Bacteria	3801
162	Ga0207695_10000182	3300025913	Bacteria	184125
163	Ga0207695_10066953	3300025913	Bacteria	3686
164	Ga0207671_10008600	3300025914	Bacteria	8630
165	Ga0207649_10002096	3300025920	Bacteria	11317
166	Ga0207649_10002609	3300025920	Bacteria	10011
167	Ga0207652_10017552	3300025921	Bacteria	5857
168	Ga0207646_10007506	3300025922	Bacteria	11065
169	Ga0207646_10013753	3300025922	Bacteria	7726
170	Ga0207681_10025172	3300025923	Bacteria	3825
171	Ga0207694_10002041	3300025924	Bacteria	16724
172	Ga0207650_10002445	3300025925	Bacteria	12935
173	Ga0207650_10040637	3300025925	Bacteria	3404
174	Ga0207650_10091613	3300025925	Bacteria	2323
175	Ga0207659_10000679	3300025926	Bacteria	20195
176	Ga0207659_10005586	3300025926	Bacteria	7634
177	Ga0207687_10034025	3300025927	Bacteria	3459
178	Ga0207700_10024637	3300025928	Bacteria	4167
179	Ga0207664_10017108	3300025929	Bacteria	5305
180	Ga0207644_10001367	3300025931	Bacteria	15702
181	Ga0207644_10004240	3300025931	Bacteria	9305
182	Ga0207644_10006374	3300025931	Bacteria	7685
183	Ga0207644_10034183	3300025931	Bacteria	3556
184	Ga0207706_10018541	3300025933	Bacteria	6261
185	Ga0207686_10009124	3300025934	Bacteria	5377
186	Ga0207709_10006939	3300025935	Bacteria	6333
187	Ga0207670_10009034	3300025936	Bacteria	5657
188	Ga0207669_10001470	3300025937	Bacteria	10059
189	Ga0207704_10069978	3300025938	Bacteria	2220
190	Ga0207665_10034251	3300025939	Bacteria	3370
191	Ga0207691_10001319	3300025940	Bacteria	24755
192	Ga0207711_10000292	3300025941	Bacteria	53498
193	Ga0207689_10008439	3300025942	Bacteria	8973
194	Ga0207667_10019841	3300025949	Bacteria	7491
195	Ga0207651_10000764	3300025960	Bacteria	13832
196	Ga0207651_10016308	3300025960	Bacteria	4347
197	Ga0207668_10014879	3300025972	Bacteria	4824
198	Ga0207658_10000046	3300025986	Bacteria	130772
199	Ga0207658_10003143	3300025986	Bacteria	11814
200	Ga0207658_10010845	3300025986	Bacteria	6199
201	Ga0207677_10001297	3300026023	Bacteria	13413
202	Ga0207677_10001922	3300026023	Bacteria	10987
203	Ga0207703_10001978	3300026035	Bacteria	18093
204	Ga0207703_10002152	3300026035	Bacteria	17313
205	Ga0207678_10006510	3300026067	Bacteria	10366
206	Ga0207708_10002581	3300026075	Bacteria	13329
207	Ga0207708_10014050	3300026075	Bacteria	5982
208	Ga0207702_10015581	3300026078	Bacteria	6292
209	Ga0207702_10031159	3300026078	Bacteria	4444
210	Ga0207641_10001478	3300026088	Bacteria	23038
211	Ga0207641_10005725	3300026088	Bacteria	10557
212	Ga0207641_10009214	3300026088	Bacteria	8140
213	Ga0207648_10000023	3300026089	Bacteria	134519
214	Ga0207648_10007133	3300026089	Bacteria	11021
215	Ga0207648_10027350	3300026089	Bacteria	5063
216	Ga0207648_10097638	3300026089	Bacteria	2571
217	Ga0207676_10001976	3300026095	Bacteria	14926
218	Ga0207676_10024190	3300026095	Bacteria	4492
219	Ga0207676_10038546	3300026095	Bacteria	3649
220	Ga0207674_10006283	3300026116	Bacteria	14004
221	Ga0207675_100026190	3300026118	Bacteria	5429
222	Ga0207675_100048962	3300026118	Bacteria	3945
223	Ga0207683_10014697	3300026121	Bacteria	6666
224	Ga0207683_10057752	3300026121	Bacteria	3406
225	Ga0207698_10009304	3300026142	Bacteria	6256
226	Ga0207698_10047060	3300026142	Bacteria	3263
227	Ga0209999_1002054	3300027543	Bacteria	3517
228	Ga0207428_10005087	3300027907	Bacteria	12351
229	Ga0207428_10016839	3300027907	Bacteria	6281
230	Ga0207428_10025988	3300027907	Bacteria	4892
231	Ga0268266_10004281	3300028379	Bacteria	13736
232	Ga0268266_10054625	3300028379	Bacteria	3432
233	Ga0268265_10003838	3300028380	Bacteria	10638
234	Ga0268265_10032021	3300028380	Bacteria	3804
235	Ga0268264_10001219	3300028381	Bacteria	24727
236	Ga0268264_10132971	3300028381	Bacteria	2208
237	Ga0265334_10009576	3300028573	Bacteria	4098
238	Ga0307517_10001409	3300028786	Bacteria	40436
239	Ga0307515_10018569	3300028794	Bacteria	12568
240	Ga0307515_10085277	3300028794	Bacteria	4044
241	Ga0265338_10009627	3300028800	Bacteria	11473
242	Ga0265338_10011236	3300028800	Bacteria	10371
243	Ga0265338_10017651	3300028800	Bacteria	7677
244	Ga0307512_10030320	3300030522	Bacteria	4707
245	Ga0265331_10001211	3300031250	Bacteria	19448
246	Ga0265327_10000002	3300031251	Bacteria	856593
247	Ga0265327_10000691	3300031251	Bacteria	53812
248	Ga0265327_10002297	3300031251	Bacteria	20489
249	Ga0307513_10000006	3300031456	Bacteria	470848
250	Ga0307509_10000139	3300031507	Bacteria	108589
251	Ga0307509_10012326	3300031507	Bacteria	10237
252	Ga0307509_10044151	3300031507	Bacteria	4817
253	Ga0307509_10044650	3300031507	Bacteria	4786
254	Ga0307408_100000012	3300031548	Bacteria	408153
255	Ga0307508_10000523	3300031616	Bacteria	45545
256	Ga0307508_10001986	3300031616	Bacteria	22354
257	Ga0307514_10008893	3300031649	Bacteria	8490
258	Ga0265314_10004671	3300031711	Bacteria	12580
259	Ga0316576_10000536	3300031727	Bacteria	17801
260	Ga0316576_10007116	3300031727	Bacteria	7015
261	Ga0307516_10010435	3300031730	Bacteria	10210
262	Ga0307406_10038016	3300031901	Bacteria	2977
263	Ga0307416_100008764	3300032002	Bacteria	6555
264	Ga0307510_10000600	3300033180	Bacteria	36430
265	Ga0307510_10017217	3300033180	Bacteria	8527
266	Ga0373934_0000260	3300035086	Bacteria	18932
267	Ga0373936_0027319	3300035113	Bacteria	2239
268	Ga0373939_0006162	3300035114	Bacteria	2883
269	Ga0373954_0009424	3300035118	Bacteria	4294
270	Ga0373956_0002820	3300035119	Bacteria	7023
271	Ga0373955_0002986	3300035172	Bacteria	7410
272	Ga0373955_0007225	3300035172	Bacteria	5094
273	Ga0316574_0028793	3300035398	Bacteria	3352
274	Ga0373935_0047386	3300035692	Bacteria	2717
275	Ga0373933_0001186	3300035724	Bacteria	15449
276	Ga0373933_0046992	3300035724	Bacteria	2566
277	Ga0373947_0073043	3300035725	Bacteria	2107
278	Ga0373937_0000803	3300036401	Bacteria	26850
279	Ga0373937_0023677	3300036401	Bacteria	5534
280	Ga0373937_0024701	3300036401	Bacteria	5422
281	Ga0373937_0026301	3300036401	Bacteria	5259
282	Ga0373925_0139175	3300037068	Bacteria	1899
283	Ga0400483_030588	3300039062	Bacteria	16153
284	Ga0400483_134009	3300039062	Bacteria	204879
285	Ga0436365_1315716	3300039437	Bacteria	37907
286	Ga0436365_1574898	3300039437	Bacteria	3020
287	Ga0436361_0108001	3300039447	Bacteria	112244
288	Ga0436361_0645654	3300039447	Bacteria	13213
289	Ga0451577_0038752	3300042876	Bacteria	4285
290	Ga0453684_0003383	3300044712	Bacteria	36067
291	Ga0453684_0003536	3300044712	Bacteria	34953
292	Ga0453684_0005462	3300044712	Bacteria	25166
293	Ga0453684_0006787	3300044712	Bacteria	21536
294	Ga0453684_0010319	3300044712	Bacteria	15992
295	Ga0453684_0101085	3300044712	Bacteria	3528
296	Ga0453684_0117363	3300044712	Unclassified	3221
297	Ga0453684_0122067	3300044712	Bacteria	3144
298	Ga0451576_0000239	3300045051	Bacteria	134323
299	Ga0451576_0003479	3300045051	Bacteria	21553
300	Ga0451576_0052429	3300045051	Bacteria	4274
301	Ga0451576_0064447	3300045051	Bacteria	3817
302	Ga0495592_0000412	3300046454	Bacteria	32712
303	Ga0495629_0064481	3300046459	Bacteria	2558
304	Ga0495629_0067742	3300046459	Bacteria	2491
305	Ga0495651_0001207	3300046462	Bacteria	19939
306	Ga0495651_0029976	3300046462	Bacteria	4242
307	Ga0495651_0045503	3300046462	Bacteria	3400
308	Ga0495653_0038813	3300046463	Bacteria	3736
309	Ga0495580_0026120	3300046472	Bacteria	4260
310	Ga0495582_0004965	3300046473	Bacteria	7452
311	Ga0495639_0000329	3300046475	Bacteria	22843
312	Ga0495662_0010291	3300046476	Bacteria	4585
313	Ga0495628_0016085	3300046516	Bacteria	6243
314	Ga0495648_0077623	3300046524	Bacteria	1903
315	Ga0495666_0024572	3300046526	Bacteria	2977
316	Ga0495665_0028330	3300046531	Bacteria	3003
317	Ga0495640_0007829	3300046533	Bacteria	8405
318	Ga0495586_0040320	3300046535	Bacteria	2512
319	Ga0495587_0021252	3300046536	Bacteria	4002
320	Ga0495621_0004226	3300046539	Bacteria	4014
321	Ga0495597_0004672	3300046542	Bacteria	7444
322	Ga0495645_0051716	3300046543	Bacteria	2989
323	Ga0495667_0061493	3300046559	Bacteria	2462
324	Ga0495635_0003870	3300046663	Bacteria	10404
325	Ga0495635_0037361	3300046663	Bacteria	3362
326	Ga0495659_0006507	3300046664	Bacteria	3689
327	Ga0495657_0004623	3300046675	Bacteria	10992
328	Ga0495657_0059564	3300046675	Bacteria	2533
329	Ga0495647_0006626	3300046681	Bacteria	3844
330	Ga0495658_0007741	3300046683	Bacteria	5323
331	Ga0495658_0019576	3300046683	Bacteria	3535
332	Ga0495613_0025259	3300046689	Bacteria	4427
333	Ga0495613_0042382	3300046689	Bacteria	3368
334	Ga0495624_0019861	3300046690	Bacteria	4477
335	Ga0495649_0001514	3300046694	Bacteria	17457
336	Ga0495600_0008768	3300046809	Bacteria	6225
337	Ga0495600_0026077	3300046809	Bacteria	3769
338	Ga0495581_0005048	3300047315	Bacteria	7640
339	Ga0495674_0046615	3300047319	Bacteria	3846
340	Ga0495680_0019231	3300047322	Bacteria	5774
341	Ga0495680_0031255	3300047322	Bacteria	4336
342	Ga0495687_000070	3300047443	Bacteria	159227
343	Ga0495687_004368	3300047443	Bacteria	9613
344	Ga0495684_0005008	3300047471	Bacteria	10332
345	Ga0495593_0016771	3300047673	Bacteria	4126
346	Ga0495626_0033624	3300048091	Bacteria	2456
347	Ga0496100_0061295	3300048903	Bacteria	2479
348	Ga0496101_0020414	3300048904	Bacteria	4535
349	Ga0496102_0002445	3300048905	Bacteria	15846
350	Ga0496104_0001855	3300048907	Bacteria	18289
351	Ga0496104_0009175	3300048907	Bacteria	8796
352	Ga0496104_0081149	3300048907	Bacteria	3093
353	Ga0496105_0002037	3300048908	Bacteria	14626
354	Ga0496105_0002905	3300048908	Bacteria	12571
355	Ga0496106_0000314	3300048909	Bacteria	34036
356	Ga0496107_0006974	3300048910	Bacteria	7786
357	Ga0496108_0027285	3300048911	Bacteria	4714
358	Ga0496109_0052347	3300048912	Bacteria	3721
359	Ga0496112_0012506	3300048915	Bacteria	7799
360	Ga0496113_0001470	3300048916	Bacteria	13145
361	Ga0496115_0013197	3300048918	Bacteria	6241
362	Ga0496115_0031334	3300048918	Bacteria	4190
363	Ga0501032_0000348	3300049569	Bacteria	38624
364	Ga0501039_0005373	3300049575	Bacteria	9688
365	Ga0501039_0046021	3300049575	Bacteria	3371
366	Ga0501042_0005508	3300049578	Bacteria	8161
367	Ga0501043_0000018	3300049579	Bacteria	161101
368	Ga0501043_0016874	3300049579	Bacteria	5723
369	Ga0501046_0000042	3300049580	Bacteria	151850
370	Ga0501046_0066260	3300049580	Bacteria	2815
371	Ga0501047_0000052	3300049581	Bacteria	153448
372	Ga0501047_0001570	3300049581	Bacteria	22334
373	Ga0501047_0027647	3300049581	Bacteria	5465
374	Ga0501047_0056826	3300049581	Bacteria	3785
375	Ga0501048_0000459	3300049582	Bacteria	28550
376	Ga0501048_0012216	3300049582	Bacteria	6395
377	Ga0501067_0000083	3300049583	Bacteria	54765
378	Ga0501068_0017141	3300049584	Bacteria	4185
379	Ga0501068_0021679	3300049584	Bacteria	3754
380	Ga0501070_0020910	3300049586	Bacteria	5490
381	Ga0501070_0039102	3300049586	Bacteria	3958
382	Ga0501071_0001882	3300049587	Bacteria	12464
383	Ga0501072_0113401	3300049588	Bacteria	2158
384	Ga0501073_0000021	3300049589	Bacteria	135534
385	Ga0501074_0014429	3300049590	Bacteria	5749
386	Ga0501075_0000518	3300049591	Bacteria	23318
387	Ga0501076_0003207	3300049592	Bacteria	11417
388	Ga0501076_0005674	3300049592	Bacteria	8999
389	Ga0501076_0016985	3300049592	Bacteria	5525
390	Ga0501076_0028619	3300049592	Bacteria	4328
391	Ga0501229_000884	3300049706	Bacteria	3390
392	Ga0501079_0026109	3300049741	Bacteria	4479
393	Ga0501079_0057457	3300049741	Bacteria	3002
394	Ga0501080_0017504	3300049742	Bacteria	6627
395	Ga0501083_0000978	3300049744	Bacteria	18944
396	Ga0501232_000252	3300049757	Bacteria	3302
397	Ga0501267_001170	3300049764	Bacteria	2200
398	Ga0501044_0017544	3300049823	Bacteria	7680
399	Ga0501045_0003314	3300049824	Bacteria	11012
400	nmdc:mga00v17_845_c1	3300050491	Bacteria	16594
401	nmdc:mga0yw44_28895_c1	3300050492	Bacteria	3195
402	nmdc:mga0yw44_30371_c1	3300050492	Bacteria	3130
403	nmdc:mga0k408_1413_c1	3300050493	Bacteria	12972
404	nmdc:mga0k408_2176_c1	3300050493	Bacteria	10515
405	nmdc:mga0k408_222_c1	3300050493	Bacteria	30212
406	nmdc:mga0k408_45765_c1	3300050493	Bacteria	2526
407	nmdc:mga06z11_14526_c1	3300050494	Bacteria	3490
408	nmdc:mga06z11_2478_c1	3300050494	Bacteria	7058
409	nmdc:mga04h51_1742_c1	3300050495	Bacteria	5095
410	nmdc:mga07m45_258_c1	3300050496	Bacteria	21595
411	nmdc:mga07m45_30533_c1	3300050496	Bacteria	2985
412	nmdc:mga07m45_642_c1	3300050496	Bacteria	14867
413	nmdc:mga05p37_46807_c1	3300050507	Bacteria	5318
414	nmdc:mga09592_45985_c1	3300050508	Bacteria	3677
415	nmdc:mga0qj67_66735_c1	3300050509	Bacteria	2866
416	nmdc:mga06r32_326_c1	3300050510	Bacteria	39903
417	nmdc:mga06r32_5620_c1	3300050510	Bacteria	11275
418	nmdc:mga08y16_69700_c1	3300050511	Bacteria	3666
419	nmdc:mga0n895_17023_c1	3300050512	Bacteria	6689
420	nmdc:mga0rr50_11594_c1	3300050513	Bacteria	5652
421	nmdc:mga0a205_148162_c1	3300050515	Bacteria	2247
422	nmdc:mga0a205_2396_c1	3300050515	Bacteria	16542
423	nmdc:mga0a205_6500_c2	3300050515	Bacteria	10152
424	nmdc:mga0sz30_19809_c1	3300050516	Bacteria	2707
425	nmdc:mga0sz30_24705_c1	3300050516	Bacteria	2454
426	Ga0495619_0014917	3300053085	Bacteria	4907
427	Ga0495619_0036439	3300053085	Bacteria	3203
428	Ga0500658_0001470	3300053134	Bacteria	9426
429	Ga0500559_0000114	3300053136	Bacteria	63472
430	Ga0500604_0016848	3300053151	Bacteria	2016
431	Ga0501084_0013388	3300054114	Bacteria	6786
432	Ga0501082_0004638	3300060353	Bacteria	11995
433	Ga0501082_0041293	3300060353	Bacteria	3977
434	Ga0501082_0131073	3300060353	Bacteria	2175
435	Ga0530510_0003425	3300061734	Bacteria	10907
436	Ga0530510_0067072	3300061734	Bacteria	2603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049586	Ga0501070_0039102	Ga0501070_0039102_16_1593	525
2	3300049578	Ga0501042_0005508	Ga0501042_0005508_27_1643	538
3	3300025922	Ga0207646_10007506	Ga0207646_100075068	573
4	3300049581	Ga0501047_0056826	Ga0501047_0056826_1999_3729	576
5	3300005937	Ga0081455_10000833	Ga0081455_100008339	578
6	3300026118	Ga0207675_100048962	Ga0207675_1000489622	579
7	3300050515	nmdc:mga0a205_148162_c1	nmdc:mga0a205_148162_c1_358_2178	579
8	3300037068	Ga0373925_0139175	Ga0373925_0139175_120_1868	580
9	3300046524	Ga0495648_0077623	Ga0495648_0077623_96_1865	586
10	3300045051	Ga0451576_0052429	Ga0451576_0052429_293_2116	590
11	3300031251	Ga0265327_10000002	Ga0265327_10000002816	591
12	3300044712	Ga0453684_0122067	Ga0453684_0122067_979_2781	593
13	3300031727	Ga0316576_10000536	Ga0316576_1000053614	594
14	3300044712	Ga0453684_0101085	Ga0453684_0101085_1397_3223	596
15	3300044712	Ga0453684_0117363	Ga0453684_0117363_445_2268	596
16	3300005440	Ga0070705_100000010	Ga0070705_10000001073	598
17	3300005441	Ga0070700_100012270	Ga0070700_1000122704	598
18	3300005444	Ga0070694_100050829	Ga0070694_1000508292	598
19	3300005445	Ga0070708_100014686	Ga0070708_1000146864	598
20	3300005518	Ga0070699_100002037	Ga0070699_1000020377	598
21	3300005545	Ga0070695_100000497	Ga0070695_1000004979	598
22	3300005545	Ga0070695_100017948	Ga0070695_1000179483	598
23	3300005546	Ga0070696_100000451	Ga0070696_10000045110	598
24	3300005549	Ga0070704_100001333	Ga0070704_10000133310	598
25	3300005617	Ga0068859_100020519	Ga0068859_1000205192	598
26	3300005618	Ga0068864_100041847	Ga0068864_1000418472	598
27	3300005719	Ga0068861_100024872	Ga0068861_1000248721	598
28	3300005843	Ga0068860_100031816	Ga0068860_1000318163	598
29	3300005844	Ga0068862_100008060	Ga0068862_1000080607	598
30	3300005983	Ga0081540_1000066	Ga0081540_100006615	598
31	3300006042	Ga0075368_10014442	Ga0075368_100144422	598
32	3300006048	Ga0075363_100009747	Ga0075363_1000097473	598
33	3300006051	Ga0075364_10000639	Ga0075364_100006397	598
34	3300006178	Ga0075367_10011153	Ga0075367_100111533	598
35	3300006844	Ga0075428_100016873	Ga0075428_1000168734	598
36	3300006846	Ga0075430_100010822	Ga0075430_1000108222	598
37	3300006847	Ga0075431_100000050	Ga0075431_10000005021	598
38	3300006847	Ga0075431_100005221	Ga0075431_10000522111	598
39	3300006847	Ga0075431_100184408	Ga0075431_1001844082	598
40	3300006852	Ga0075433_10000404	Ga0075433_100004045	598
41	3300006871	Ga0075434_100001846	Ga0075434_10000184612	598
42	3300006931	Ga0097620_100020518	Ga0097620_1000205185	598
43	3300007076	Ga0075435_100013997	Ga0075435_1000139973	598
44	3300009094	Ga0111539_10006919	Ga0111539_100069197	598
45	3300009147	Ga0114129_10045800	Ga0114129_100458003	598
46	3300009553	Ga0105249_10007181	Ga0105249_100071812	598
47	3300026067	Ga0207678_10006510	Ga0207678_100065107	598
48	3300026075	Ga0207708_10002581	Ga0207708_100025819	598
49	3300026095	Ga0207676_10038546	Ga0207676_100385462	598
50	3300026116	Ga0207674_10006283	Ga0207674_1000628311	598
51	3300026118	Ga0207675_100026190	Ga0207675_1000261902	598
52	3300027907	Ga0207428_10005087	Ga0207428_100050879	598
53	3300027907	Ga0207428_10016839	Ga0207428_100168392	598
54	3300027907	Ga0207428_10025988	Ga0207428_100259882	598
55	3300028380	Ga0268265_10003838	Ga0268265_100038382	598
56	3300028381	Ga0268264_10001219	Ga0268264_1000121914	598
57	3300048903	Ga0496100_0061295	Ga0496100_0061295_630_2450	598
58	3300048905	Ga0496102_0002445	Ga0496102_0002445_14002_15822	598
59	3300048907	Ga0496104_0001855	Ga0496104_0001855_8278_10098	598
60	3300048908	Ga0496105_0002037	Ga0496105_0002037_1923_3743	598
61	3300048909	Ga0496106_0000314	Ga0496106_0000314_12534_14354	598
62	3300048910	Ga0496107_0006974	Ga0496107_0006974_3821_5641	598
63	3300048916	Ga0496113_0001470	Ga0496113_0001470_485_2305	598
64	3300048918	Ga0496115_0013197	Ga0496115_0013197_2340_4160	598
65	3300048918	Ga0496115_0031334	Ga0496115_0031334_398_2218	598
66	3300049575	Ga0501039_0046021	Ga0501039_0046021_837_2657	598
67	3300049580	Ga0501046_0066260	Ga0501046_0066260_464_2284	598
68	3300049588	Ga0501072_0113401	Ga0501072_0113401_15_1835	598
69	3300049590	Ga0501074_0014429	Ga0501074_0014429_1393_3213	598
70	3300049592	Ga0501076_0005674	Ga0501076_0005674_2436_4256	598
71	3300049741	Ga0501079_0026109	Ga0501079_0026109_2420_4240	598
72	3300050491	nmdc:mga00v17_845_c1	nmdc:mga00v17_845_c1_8860_10680	598
73	3300050492	nmdc:mga0yw44_28895_c1	nmdc:mga0yw44_28895_c1_63_1883	598
74	3300050492	nmdc:mga0yw44_30371_c1	nmdc:mga0yw44_30371_c1_657_2477	598
75	3300050495	nmdc:mga04h51_1742_c1	nmdc:mga04h51_1742_c1_2822_4642	598
76	3300050507	nmdc:mga05p37_46807_c1	nmdc:mga05p37_46807_c1_796_2616	598
77	3300050510	nmdc:mga06r32_326_c1	nmdc:mga06r32_326_c1_20074_21894	598
78	3300050510	nmdc:mga06r32_5620_c1	nmdc:mga06r32_5620_c1_4641_6461	598
79	3300050511	nmdc:mga08y16_69700_c1	nmdc:mga08y16_69700_c1_1417_3237	598
80	3300050512	nmdc:mga0n895_17023_c1	nmdc:mga0n895_17023_c1_3619_5439	598
81	3300050513	nmdc:mga0rr50_11594_c1	nmdc:mga0rr50_11594_c1_706_2526	598
82	3300054114	Ga0501084_0013388	Ga0501084_0013388_3008_4828	598
83	3300061734	Ga0530510_0067072	Ga0530510_0067072_574_2394	598
84	3300006847	Ga0075431_100080368	Ga0075431_1000803683	599
85	3300049592	Ga0501076_0028619	Ga0501076_0028619_1391_3214	599
86	3300050508	nmdc:mga09592_45985_c1	nmdc:mga09592_45985_c1_1605_3428	599
87	3300009094	Ga0111539_10009333	Ga0111539_100093337	601
88	3300035114	Ga0373939_0006162	Ga0373939_0006162_82_1938	601
89	3300050515	nmdc:mga0a205_2396_c1	nmdc:mga0a205_2396_c1_5553_7409	601
90	3300044712	Ga0453684_0005462	Ga0453684_0005462_11798_13633	603
91	3300039062	Ga0400483_030588	Ga0400483_030588_4816_6657	604
92	3300044712	Ga0453684_0003383	Ga0453684_0003383_8530_10380	604
93	3300009545	Ga0105237_10029159	Ga0105237_100291594	606
94	3300010375	Ga0105239_10032275	Ga0105239_100322754	606
95	iso_pu_bacteria	2643221544	2643744186	606
96	iso_pu_bacteria	2643221585	2643934172	606
97	iso_pu_bacteria	2643221639	2644219610	606
98	iso_pu_bacteria	2643221646	2644256043	606
99	iso_pu_bacteria	2643221656	2644315659	606
100	3300031250	Ga0265331_10001211	Ga0265331_1000121117	607
101	3300031251	Ga0265327_10000691	Ga0265327_1000069131	607
102	3300039062	Ga0400483_134009	Ga0400483_134009_173665_175515	607
103	3300044712	Ga0453684_0003536	Ga0453684_0003536_15019_16854	607
104	3300049581	Ga0501047_0001570	Ga0501047_0001570_16535_18364	608
105	3300049742	Ga0501080_0017504	Ga0501080_0017504_1293_3122	608
106	3300049744	Ga0501083_0000978	Ga0501083_0000978_12733_14562	608
107	3300060353	Ga0501082_0004638	Ga0501082_0004638_3952_5781	608
108	3300028800	Ga0265338_10011236	Ga0265338_100112363	609
109	3300005614	Ga0068856_100035423	Ga0068856_1000354232	610
110	3300005844	Ga0068862_100103905	Ga0068862_1001039052	610
111	3300009093	Ga0105240_10012961	Ga0105240_100129614	610
112	3300021384	Ga0213876_10002613	Ga0213876_100026132	610
113	3300025298	Ga0209050_1004580	Ga0209050_10045808	610
114	3300025304	Ga0209257_1000061	Ga0209257_1000061102	610
115	3300025924	Ga0207694_10002041	Ga0207694_1000204112	610
116	3300028380	Ga0268265_10032021	Ga0268265_100320214	610
117	3300028573	Ga0265334_10009576	Ga0265334_100095761	610
118	3300028794	Ga0307515_10085277	Ga0307515_100852772	610
119	3300028800	Ga0265338_10009627	Ga0265338_100096275	610
120	3300031251	Ga0265327_10002297	Ga0265327_100022975	610
121	3300031548	Ga0307408_100000012	Ga0307408_100000012137	610
122	3300031711	Ga0265314_10004671	Ga0265314_100046712	610
123	3300039437	Ga0436365_1315716	Ga0436365_1315716_17501_19336	610
124	3300039447	Ga0436361_0645654	Ga0436361_0645654_571_2406	610
125	3300049706	Ga0501229_000884	Ga0501229_000884_1442_3289	610
126	3300049757	Ga0501232_000252	Ga0501232_000252_843_2690	610
127	3300049764	Ga0501267_001170	Ga0501267_001170_263_2110	610
128	3300009093	Ga0105240_10095994	Ga0105240_100959942	611
129	3300010375	Ga0105239_10037001	Ga0105239_100370014	611
130	3300028379	Ga0268266_10004281	Ga0268266_100042818	611
131	3300028800	Ga0265338_10017651	Ga0265338_100176516	611
132	3300039437	Ga0436365_1574898	Ga0436365_1574898_1133_2974	611
133	3300044712	Ga0453684_0006787	Ga0453684_0006787_12683_14521	611
134	3300045051	Ga0451576_0003479	Ga0451576_0003479_7033_8871	611
135	3300049579	Ga0501043_0016874	Ga0501043_0016874_3488_5383	611
136	3300049584	Ga0501068_0021679	Ga0501068_0021679_1656_3551	611
137	3300060353	Ga0501082_0041293	Ga0501082_0041293_1042_2937	611
138	3300045051	Ga0451576_0064447	Ga0451576_0064447_136_1977	612
139	3300005335	Ga0070666_10001885	Ga0070666_100018858	613
140	3300005344	Ga0070661_100002745	Ga0070661_1000027453	613
141	3300005467	Ga0070706_100061844	Ga0070706_1000618443	613
142	3300005536	Ga0070697_100026147	Ga0070697_1000261472	613
143	3300005539	Ga0068853_100094250	Ga0068853_1000942503	613
144	3300005563	Ga0068855_100031833	Ga0068855_1000318332	613
145	3300005614	Ga0068856_100031307	Ga0068856_1000313072	613
146	3300005616	Ga0068852_100026292	Ga0068852_1000262923	613
147	3300009093	Ga0105240_10083195	Ga0105240_100831954	613
148	3300009545	Ga0105237_10026101	Ga0105237_100261015	613
149	3300009551	Ga0105238_10061810	Ga0105238_100618103	613
150	3300010375	Ga0105239_10082167	Ga0105239_100821672	613
151	3300013104	Ga0157370_10047867	Ga0157370_100478672	613
152	3300013105	Ga0157369_10030896	Ga0157369_100308962	613
153	3300013307	Ga0157372_10002463	Ga0157372_100024636	613
154	3300014325	Ga0163163_10000601	Ga0163163_1000060128	613
155	3300025903	Ga0207680_10003399	Ga0207680_100033992	613
156	3300025910	Ga0207684_10041093	Ga0207684_100410934	613
157	3300025913	Ga0207695_10000182	Ga0207695_10000182140	613
158	3300025914	Ga0207671_10008600	Ga0207671_100086003	613
159	3300025920	Ga0207649_10002096	Ga0207649_100020967	613
160	3300025922	Ga0207646_10013753	Ga0207646_100137534	613
161	3300025928	Ga0207700_10024637	Ga0207700_100246373	613
162	3300025929	Ga0207664_10017108	Ga0207664_100171082	613
163	3300025949	Ga0207667_10019841	Ga0207667_100198413	613
164	3300026078	Ga0207702_10015581	Ga0207702_100155816	613
165	3300026142	Ga0207698_10047060	Ga0207698_100470602	613
166	3300035113	Ga0373936_0027319	Ga0373936_0027319_289_2130	613
167	3300044712	Ga0453684_0010319	Ga0453684_0010319_7349_9193	613
168	3300046472	Ga0495580_0026120	Ga0495580_0026120_1575_3416	613
169	3300048907	Ga0496104_0081149	Ga0496104_0081149_313_2154	613
170	3300050509	nmdc:mga0qj67_66735_c1	nmdc:mga0qj67_66735_c1_961_2802	613
171	3300050516	nmdc:mga0sz30_19809_c1	nmdc:mga0sz30_19809_c1_437_2290	613
172	3300005335	Ga0070666_10007780	Ga0070666_100077806	614
173	3300005367	Ga0070667_100000011	Ga0070667_100000011225	614
174	3300005444	Ga0070694_100096537	Ga0070694_1000965371	614
175	3300006173	Ga0070716_100025217	Ga0070716_1000252172	614
176	3300014325	Ga0163163_10020890	Ga0163163_100208902	614
177	3300025986	Ga0207658_10000046	Ga0207658_1000004683	614
178	3300027543	Ga0209999_1002054	Ga0209999_10020541	614
179	3300028786	Ga0307517_10001409	Ga0307517_1000140923	614
180	3300030522	Ga0307512_10030320	Ga0307512_100303203	614
181	3300031456	Ga0307513_10000006	Ga0307513_10000006102	614
182	3300031507	Ga0307509_10000139	Ga0307509_1000013928	614
183	3300031507	Ga0307509_10012326	Ga0307509_1001232611	614
184	3300031507	Ga0307509_10044151	Ga0307509_100441512	614
185	3300031507	Ga0307509_10044650	Ga0307509_100446502	614
186	3300031616	Ga0307508_10000523	Ga0307508_1000052331	614
187	3300031616	Ga0307508_10001986	Ga0307508_1000198614	614
188	3300031649	Ga0307514_10008893	Ga0307514_100088934	614
189	3300035086	Ga0373934_0000260	Ga0373934_0000260_13813_15699	614
190	3300035119	Ga0373956_0002820	Ga0373956_0002820_2367_4226	614
191	3300035172	Ga0373955_0007225	Ga0373955_0007225_793_2652	614
192	3300035724	Ga0373933_0001186	Ga0373933_0001186_1078_2964	614
193	3300036401	Ga0373937_0000803	Ga0373937_0000803_14859_16745	614
194	3300036401	Ga0373937_0024701	Ga0373937_0024701_1947_3806	614
195	3300039447	Ga0436361_0108001	Ga0436361_0108001_73886_75730	614
196	3300046454	Ga0495592_0000412	Ga0495592_0000412_15047_16900	614
197	3300046459	Ga0495629_0064481	Ga0495629_0064481_137_1996	614
198	3300046462	Ga0495651_0001207	Ga0495651_0001207_16373_18259	614
199	3300046462	Ga0495651_0029976	Ga0495651_0029976_897_2756	614
200	3300046516	Ga0495628_0016085	Ga0495628_0016085_353_2212	614
201	3300046526	Ga0495666_0024572	Ga0495666_0024572_813_2666	614
202	3300046531	Ga0495665_0028330	Ga0495665_0028330_15_1874	614
203	3300046533	Ga0495640_0007829	Ga0495640_0007829_321_2180	614
204	3300046536	Ga0495587_0021252	Ga0495587_0021252_837_2696	614
205	3300046663	Ga0495635_0037361	Ga0495635_0037361_1179_3038	614
206	3300046675	Ga0495657_0004623	Ga0495657_0004623_8105_9964	614
207	3300046681	Ga0495647_0006626	Ga0495647_0006626_1111_2970	614
208	3300046683	Ga0495658_0007741	Ga0495658_0007741_1517_3376	614
209	3300046689	Ga0495613_0042382	Ga0495613_0042382_1416_3275	614
210	3300046690	Ga0495624_0019861	Ga0495624_0019861_12_1865	614
211	3300046809	Ga0495600_0026077	Ga0495600_0026077_1574_3433	614
212	3300047319	Ga0495674_0046615	Ga0495674_0046615_975_2834	614
213	3300047322	Ga0495680_0019231	Ga0495680_0019231_808_2667	614
214	3300049575	Ga0501039_0005373	Ga0501039_0005373_304_2148	614
215	3300049582	Ga0501048_0012216	Ga0501048_0012216_3462_5306	614
216	3300049587	Ga0501071_0001882	Ga0501071_0001882_3339_5183	614
217	3300049591	Ga0501075_0000518	Ga0501075_0000518_14529_16373	614
218	3300049592	Ga0501076_0003207	Ga0501076_0003207_2160_4004	614
219	3300049592	Ga0501076_0016985	Ga0501076_0016985_1247_3091	614
220	3300049741	Ga0501079_0057457	Ga0501079_0057457_965_2809	614
221	3300053085	Ga0495619_0036439	Ga0495619_0036439_1117_2976	614
222	3300060353	Ga0501082_0131073	Ga0501082_0131073_115_1959	614
223	3300061734	Ga0530510_0003425	Ga0530510_0003425_2524_4368	614
224	iso_pu_bacteria	2643221654	2644303682	614
225	3300045051	Ga0451576_0000239	Ga0451576_0000239_106707_108557	615
226	3300046535	Ga0495586_0040320	Ga0495586_0040320_327_2177	615
227	3300050493	nmdc:mga0k408_1413_c1	nmdc:mga0k408_1413_c1_924_2777	615
228	3300005338	Ga0068868_100045343	Ga0068868_1000453432	616
229	3300005338	Ga0068868_100076709	Ga0068868_1000767092	616
230	3300005355	Ga0070671_100001342	Ga0070671_10000134220	616
231	3300005356	Ga0070674_100002036	Ga0070674_1000020362	616
232	3300005364	Ga0070673_100010668	Ga0070673_1000106682	616
233	3300005364	Ga0070673_100016278	Ga0070673_1000162782	616
234	3300005436	Ga0070713_100001126	Ga0070713_10000112619	616
235	3300005439	Ga0070711_100000322	Ga0070711_10000032213	616
236	3300005459	Ga0068867_100000016	Ga0068867_10000001611	616
237	3300005459	Ga0068867_100108348	Ga0068867_1001083482	616
238	3300005466	Ga0070685_10007927	Ga0070685_100079273	616
239	3300005467	Ga0070706_100015649	Ga0070706_1000156495	616
240	3300005467	Ga0070706_100135181	Ga0070706_1001351812	616
241	3300005471	Ga0070698_100087356	Ga0070698_1000873562	616
242	3300005539	Ga0068853_100040469	Ga0068853_1000404693	616
243	3300005547	Ga0070693_100000467	Ga0070693_1000004672	616
244	3300005548	Ga0070665_100034526	Ga0070665_1000345263	616
245	3300005548	Ga0070665_100169667	Ga0070665_1001696672	616
246	3300005615	Ga0070702_100028007	Ga0070702_1000280071	616
247	3300005616	Ga0068852_100017328	Ga0068852_1000173282	616
248	3300005617	Ga0068859_100082079	Ga0068859_1000820792	616
249	3300005618	Ga0068864_100000653	Ga0068864_10000065310	616
250	3300005842	Ga0068858_100001111	Ga0068858_10000111112	616
251	3300005843	Ga0068860_100076373	Ga0068860_1000763732	616
252	3300006163	Ga0070715_10001636	Ga0070715_100016364	616
253	3300006173	Ga0070716_100018719	Ga0070716_1000187192	616
254	3300006173	Ga0070716_100025791	Ga0070716_1000257912	616
255	3300006195	Ga0075366_10000437	Ga0075366_100004377	616
256	3300006195	Ga0075366_10036794	Ga0075366_100367942	616
257	3300006195	Ga0075366_10041237	Ga0075366_100412372	616
258	3300006353	Ga0075370_10001650	Ga0075370_100016506	616
259	3300006852	Ga0075433_10007165	Ga0075433_100071652	616
260	3300006931	Ga0097620_100082080	Ga0097620_1000820801	616
261	3300009101	Ga0105247_10016159	Ga0105247_100161592	616
262	3300009148	Ga0105243_10004596	Ga0105243_100045968	616
263	3300009551	Ga0105238_10133691	Ga0105238_101336911	616
264	3300013296	Ga0157374_10004289	Ga0157374_100042893	616
265	3300014325	Ga0163163_10000625	Ga0163163_1000062514	616
266	3300014745	Ga0157377_10000006	Ga0157377_10000006181	616
267	3300014968	Ga0157379_10003126	Ga0157379_1000312610	616
268	3300025903	Ga0207680_10019767	Ga0207680_100197672	616
269	3300025907	Ga0207645_10046049	Ga0207645_100460492	616
270	3300025910	Ga0207684_10043672	Ga0207684_100436722	616
271	3300025925	Ga0207650_10040637	Ga0207650_100406372	616
272	3300025927	Ga0207687_10034025	Ga0207687_100340252	616
273	3300025931	Ga0207644_10034183	Ga0207644_100341832	616
274	3300025933	Ga0207706_10018541	Ga0207706_100185412	616
275	3300025935	Ga0207709_10006939	Ga0207709_100069392	616
276	3300025939	Ga0207665_10034251	Ga0207665_100342512	616
277	3300025941	Ga0207711_10000292	Ga0207711_1000029216	616
278	3300026023	Ga0207677_10001297	Ga0207677_100012974	616
279	3300026035	Ga0207703_10001978	Ga0207703_1000197814	616
280	3300026088	Ga0207641_10005725	Ga0207641_100057255	616
281	3300026089	Ga0207648_10000023	Ga0207648_1000002342	616
282	3300026095	Ga0207676_10001976	Ga0207676_100019765	616
283	3300028379	Ga0268266_10054625	Ga0268266_100546253	616
284	3300028381	Ga0268264_10132971	Ga0268264_101329711	616
285	3300031730	Ga0307516_10010435	Ga0307516_100104352	616
286	3300033180	Ga0307510_10000600	Ga0307510_100006009	616
287	3300035118	Ga0373954_0009424	Ga0373954_0009424_1370_3220	616
288	3300035172	Ga0373955_0002986	Ga0373955_0002986_4750_6600	616
289	3300035692	Ga0373935_0047386	Ga0373935_0047386_534_2384	616
290	3300035724	Ga0373933_0046992	Ga0373933_0046992_342_2192	616
291	3300035725	Ga0373947_0073043	Ga0373947_0073043_84_1934	616
292	3300036401	Ga0373937_0023677	Ga0373937_0023677_1002_2852	616
293	3300036401	Ga0373937_0026301	Ga0373937_0026301_1466_3316	616
294	3300046462	Ga0495651_0045503	Ga0495651_0045503_158_2008	616
295	3300046463	Ga0495653_0038813	Ga0495653_0038813_482_2332	616
296	3300046473	Ga0495582_0004965	Ga0495582_0004965_4371_6221	616
297	3300046475	Ga0495639_0000329	Ga0495639_0000329_1273_3123	616
298	3300046476	Ga0495662_0010291	Ga0495662_0010291_2000_3850	616
299	3300046539	Ga0495621_0004226	Ga0495621_0004226_1284_3134	616
300	3300046559	Ga0495667_0061493	Ga0495667_0061493_234_2084	616
301	3300046663	Ga0495635_0003870	Ga0495635_0003870_2084_3934	616
302	3300046664	Ga0495659_0006507	Ga0495659_0006507_1372_3222	616
303	3300046675	Ga0495657_0059564	Ga0495657_0059564_463_2313	616
304	3300046683	Ga0495658_0019576	Ga0495658_0019576_211_2061	616
305	3300046689	Ga0495613_0025259	Ga0495613_0025259_2449_4299	616
306	3300046809	Ga0495600_0008768	Ga0495600_0008768_2270_4120	616
307	3300047315	Ga0495581_0005048	Ga0495581_0005048_2562_4412	616
308	3300047322	Ga0495680_0031255	Ga0495680_0031255_990_2840	616
309	3300047471	Ga0495684_0005008	Ga0495684_0005008_4724_6574	616
310	3300047673	Ga0495593_0016771	Ga0495593_0016771_2247_4097	616
311	3300048904	Ga0496101_0020414	Ga0496101_0020414_2597_4447	616
312	3300048907	Ga0496104_0009175	Ga0496104_0009175_3921_5771	616
313	3300048908	Ga0496105_0002905	Ga0496105_0002905_5268_7118	616
314	3300048912	Ga0496109_0052347	Ga0496109_0052347_788_2638	616
315	3300048915	Ga0496112_0012506	Ga0496112_0012506_1028_2878	616
316	3300050493	nmdc:mga0k408_2176_c1	nmdc:mga0k408_2176_c1_3965_5815	616
317	3300050493	nmdc:mga0k408_222_c1	nmdc:mga0k408_222_c1_5147_7003	616
318	3300050496	nmdc:mga07m45_258_c1	nmdc:mga07m45_258_c1_13307_15157	616
319	3300050515	nmdc:mga0a205_6500_c2	nmdc:mga0a205_6500_c2_1802_3652	616
320	3300053085	Ga0495619_0014917	Ga0495619_0014917_967_2817	616
321	3300006178	Ga0075367_10000965	Ga0075367_100009652	617
322	3300006195	Ga0075366_10017637	Ga0075366_100176372	617
323	3300006353	Ga0075370_10001681	Ga0075370_100016816	617
324	3300006353	Ga0075370_10005122	Ga0075370_100051222	617
325	3300006353	Ga0075370_10032531	Ga0075370_100325312	617
326	3300010375	Ga0105239_10018069	Ga0105239_100180694	617
327	3300025913	Ga0207695_10066953	Ga0207695_100669532	617
328	3300026089	Ga0207648_10097638	Ga0207648_100976382	617
329	3300028794	Ga0307515_10018569	Ga0307515_100185693	617
330	3300031727	Ga0316576_10007116	Ga0316576_100071166	617
331	3300035398	Ga0316574_0028793	Ga0316574_0028793_762_2627	617
332	3300046694	Ga0495649_0001514	Ga0495649_0001514_14921_16774	617
333	3300047443	Ga0495687_004368	Ga0495687_004368_275_2128	617
334	3300050493	nmdc:mga0k408_45765_c1	nmdc:mga0k408_45765_c1_462_2315	617
335	3300050494	nmdc:mga06z11_14526_c1	nmdc:mga06z11_14526_c1_436_2289	617
336	3300050494	nmdc:mga06z11_2478_c1	nmdc:mga06z11_2478_c1_2798_4651	617
337	3300050496	nmdc:mga07m45_30533_c1	nmdc:mga07m45_30533_c1_436_2289	617
338	3300050496	nmdc:mga07m45_642_c1	nmdc:mga07m45_642_c1_5523_7376	617
339	3300050516	nmdc:mga0sz30_24705_c1	nmdc:mga0sz30_24705_c1_188_2041	617
340	3300053134	Ga0500658_0001470	Ga0500658_0001470_7148_9001	617
341	3300042876	Ga0451577_0038752	Ga0451577_0038752_569_2449	618
342	3300046542	Ga0495597_0004672	Ga0495597_0004672_4431_6299	618
343	3300047443	Ga0495687_000070	Ga0495687_000070_146884_148752	618
344	3300048091	Ga0495626_0033624	Ga0495626_0033624_516_2384	618
345	3300049569	Ga0501032_0000348	Ga0501032_0000348_14324_16192	618
346	3300049579	Ga0501043_0000018	Ga0501043_0000018_50370_52226	618
347	3300049580	Ga0501046_0000042	Ga0501046_0000042_50370_52226	618
348	3300049581	Ga0501047_0000052	Ga0501047_0000052_101223_103079	618
349	3300049582	Ga0501048_0000459	Ga0501048_0000459_9911_11767	618
350	3300049583	Ga0501067_0000083	Ga0501067_0000083_5443_7311	618
351	3300049584	Ga0501068_0017141	Ga0501068_0017141_1095_2963	618
352	3300049589	Ga0501073_0000021	Ga0501073_0000021_82322_84190	618
353	3300049823	Ga0501044_0017544	Ga0501044_0017544_4692_6560	618
354	3300049824	Ga0501045_0003314	Ga0501045_0003314_2385_4241	618
355	3300005466	Ga0070685_10003624	Ga0070685_100036244	619
356	3300013308	Ga0157375_10013141	Ga0157375_100131412	619
357	3300049581	Ga0501047_0027647	Ga0501047_0027647_296_2191	619
358	3300049586	Ga0501070_0020910	Ga0501070_0020910_418_2301	619
359	3300005367	Ga0070667_100000790	Ga0070667_1000007904	620
360	3300025986	Ga0207658_10010845	Ga0207658_100108452	620
361	3300033180	Ga0307510_10017217	Ga0307510_100172175	622
362	3300053136	Ga0500559_0000114	Ga0500559_0000114_29676_31616	622
363	3300053151	Ga0500604_0016848	Ga0500604_0016848_60_2000	622
364	3300005336	Ga0070680_100006908	Ga0070680_1000069085	623
365	3300005344	Ga0070661_100055706	Ga0070661_1000557062	623
366	3300005354	Ga0070675_100000234	Ga0070675_10000023411	623
367	3300005355	Ga0070671_100011847	Ga0070671_1000118478	623
368	3300005356	Ga0070674_100000930	Ga0070674_1000009308	623
369	3300005356	Ga0070674_100002586	Ga0070674_10000258610	623
370	3300005364	Ga0070673_100002987	Ga0070673_10000298710	623
371	3300005367	Ga0070667_100037254	Ga0070667_1000372542	623
372	3300005456	Ga0070678_100041682	Ga0070678_1000416822	623
373	3300005459	Ga0068867_100000720	Ga0068867_10000072019	623
374	3300005616	Ga0068852_100020448	Ga0068852_1000204483	623
375	3300005843	Ga0068860_100035843	Ga0068860_1000358434	623
376	3300006358	Ga0068871_100023606	Ga0068871_1000236061	623
377	3300013105	Ga0157369_10025205	Ga0157369_100252055	623
378	3300025920	Ga0207649_10002609	Ga0207649_100026097	623
379	3300025921	Ga0207652_10017552	Ga0207652_100175523	623
380	3300025923	Ga0207681_10025172	Ga0207681_100251722	623
381	3300025925	Ga0207650_10002445	Ga0207650_1000244510	623
382	3300025926	Ga0207659_10000679	Ga0207659_1000067914	623
383	3300025931	Ga0207644_10004240	Ga0207644_100042406	623
384	3300025937	Ga0207669_10001470	Ga0207669_100014704	623
385	3300025938	Ga0207704_10069978	Ga0207704_100699782	623
386	3300025960	Ga0207651_10000764	Ga0207651_100007644	623
387	3300026078	Ga0207702_10031159	Ga0207702_100311593	623
388	3300026121	Ga0207683_10057752	Ga0207683_100577522	623
389	3300026142	Ga0207698_10009304	Ga0207698_100093045	623
390	3300031901	Ga0307406_10038016	Ga0307406_100380161	623
391	3300032002	Ga0307416_100008764	Ga0307416_1000087642	623
392	3300005338	Ga0068868_100006706	Ga0068868_1000067065	624
393	3300005354	Ga0070675_100001074	Ga0070675_1000010749	624
394	3300005355	Ga0070671_100012181	Ga0070671_1000121818	624
395	3300005367	Ga0070667_100002896	Ga0070667_10000289611	624
396	3300005456	Ga0070678_100004674	Ga0070678_1000046742	624
397	3300005457	Ga0070662_100072775	Ga0070662_1000727752	624
398	3300005841	Ga0068863_100036364	Ga0068863_1000363642	624
399	3300005842	Ga0068858_100002455	Ga0068858_1000024559	624
400	3300006358	Ga0068871_100022566	Ga0068871_1000225662	624
401	3300014325	Ga0163163_10007006	Ga0163163_100070069	624
402	3300025315	Ga0207697_10020069	Ga0207697_100200692	624
403	3300025926	Ga0207659_10005586	Ga0207659_100055866	624
404	3300025931	Ga0207644_10001367	Ga0207644_1000136711	624
405	3300025936	Ga0207670_10009034	Ga0207670_100090344	624
406	3300025960	Ga0207651_10016308	Ga0207651_100163082	624
407	3300025986	Ga0207658_10003143	Ga0207658_100031434	624
408	3300026023	Ga0207677_10001922	Ga0207677_100019223	624
409	3300026035	Ga0207703_10002152	Ga0207703_100021526	624
410	3300026088	Ga0207641_10001478	Ga0207641_1000147813	624
411	3300026121	Ga0207683_10014697	Ga0207683_100146972	624
412	3300046459	Ga0495629_0067742	Ga0495629_0067742_562_2436	624
413	3300046543	Ga0495645_0051716	Ga0495645_0051716_46_1923	625
414	3300005330	Ga0070690_100016168	Ga0070690_1000161682	626
415	3300005334	Ga0068869_100034069	Ga0068869_1000340692	626
416	3300005347	Ga0070668_100018126	Ga0070668_1000181262	626
417	3300005353	Ga0070669_100070758	Ga0070669_1000707582	626
418	3300005355	Ga0070671_100006863	Ga0070671_1000068633	626
419	3300005356	Ga0070674_100018882	Ga0070674_1000188823	626
420	3300005366	Ga0070659_100081731	Ga0070659_1000817311	626
421	3300005456	Ga0070678_100019812	Ga0070678_1000198123	626
422	3300005543	Ga0070672_100002586	Ga0070672_1000025866	626
423	3300005616	Ga0068852_100056691	Ga0068852_1000566912	626
424	3300005618	Ga0068864_100023467	Ga0068864_1000234672	626
425	3300005834	Ga0068851_10013748	Ga0068851_100137482	626
426	3300005844	Ga0068862_100057047	Ga0068862_1000570472	626
427	3300009177	Ga0105248_10168452	Ga0105248_101684522	626
428	3300014326	Ga0157380_10027399	Ga0157380_100273993	626
429	3300014969	Ga0157376_10068849	Ga0157376_100688492	626
430	3300025893	Ga0207682_10006912	Ga0207682_100069122	626
431	3300025925	Ga0207650_10091613	Ga0207650_100916132	626
432	3300025931	Ga0207644_10006374	Ga0207644_100063745	626
433	3300025934	Ga0207686_10009124	Ga0207686_100091243	626
434	3300025940	Ga0207691_10001319	Ga0207691_100013192	626
435	3300025942	Ga0207689_10008439	Ga0207689_100084393	626
436	3300025972	Ga0207668_10014879	Ga0207668_100148793	626
437	3300026075	Ga0207708_10014050	Ga0207708_100140504	626
438	3300026088	Ga0207641_10009214	Ga0207641_100092142	626
439	3300026089	Ga0207648_10007133	Ga0207648_1000713311	626
440	3300026089	Ga0207648_10027350	Ga0207648_100273504	626
441	3300026095	Ga0207676_10024190	Ga0207676_100241903	626
442	3300048911	Ga0496108_0027285	Ga0496108_0027285_1978_3861	626

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01855

POR_N

Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg

252

446

0.96 PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

48

218

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6n2o-assembly1.cif.gz_C	2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound	0.9043	17	606
6n2o-assembly1.cif.gz_C	2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound	0.8953	17	606
1yd7-assembly1.cif.gz_A	conserved hypothetical protein pfu-1647980-001 from pyrococcus furiosus	0.8733	215	406
5b48-assembly1.cif.gz_C	2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai	0.8432	19	611
5b48-assembly1.cif.gz_C	2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai	0.8304	19	611

ID	Description	Score	Start	End	Superfamily
af_Q2FZ05_192_386_3.40.50.970	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains	0.9492	217	406	3.40.50.970
af_O53182_522_626_3.40.50.920	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;	0.9156	505	606	3.40.50.920
af_Q57724_1_190_3.40.50.970	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains	0.9018	216	412	3.40.50.970
af_Q2FZ05_1_182_3.40.920.10	Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III	0.8934	17	198	3.40.920.10
af_O53182_237_440_3.40.50.970	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains	0.8883	215	406	3.40.50.970

ID	Description	Score	Start	End	GO Terms
AF-A0A521VQ06-F1-model_v4	2-oxoacid:acceptor oxidoreductase subunit alpha	0.9874	227	612	GO:0006979 GO:0016491
AF-A0A3D1JM13-F1-model_v4	2-oxoacid:acceptor oxidoreductase subunit alpha	0.9847	11	163	GO:0016903
AF-A0A534DJJ7-F1-model_v4	deleted	0.9781	512	607
AF-A0A2E6CB46-F1-model_v4	Ferredoxin oxidoreductase	0.9775	13	609	GO:0006979 GO:0016903
AF-A0A1J5RUS3-F1-model_v4	2-oxoglutarate oxidoreductase subunit KorA (EC 1.2.-.-)	0.9771	336	613	GO:0006979 GO:0016491

Feature Viewer

pLDDT	pTM	Quality
90.88	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F444906

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01855

POR_N

Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg

252

446

0.96

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

48

218

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map