F444908

General Info

Members Datasets Scaffolds Average Seq Length
442 221 884 128

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0298425|Ga0373936_0298425_231_680
Length 149
Sequence LTGIYGDDHSSTPKSGVHGDHGVRLALDTNRYTDFSRGEASIVKTLELADEVWLPFVVMGELRAGFAIGTQGPHNEALLRRFLLKPGTGVLYPDEQTTHHYAAIYRQLRKQGTPIPTNDMWIAALALQHSLALCDRDAHFDALPQLTRL

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
215 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
216 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
217 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.17
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 30.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0298425 3300035113 Unclassified 727
2 rootL2_10362052 3300003322 Bacteria 1569
3 rootH1_10136932 3300003323 Unclassified 2139
4 rootH1_10177467 3300003323 Bacteria 1279
5 Ga0070658_11082932 3300005327 Unclassified 697
6 Ga0070683_100117965 3300005329 Unclassified 2506
7 Ga0070690_100262464 3300005330 Bacteria 1226
8 Ga0070670_100520276 3300005331 Bacteria 1059
9 Ga0068869_100337729 3300005334 Bacteria 1225
10 Ga0070680_100052558 3300005336 Bacteria 3325
11 Ga0070680_101319042 3300005336 Unclassified 625
12 Ga0068868_100035526 3300005338 Bacteria 3853
13 Ga0068868_100568696 3300005338 Unclassified 1001
14 Ga0068868_101001519 3300005338 Unclassified 764
15 Ga0070660_100880944 3300005339 Unclassified 754
16 Ga0070689_100177028 3300005340 Unclassified 1731
17 Ga0070691_10015249 3300005341 Unclassified 3530
18 Ga0070687_100796624 3300005343 Unclassified 669
19 Ga0070661_100281000 3300005344 Bacteria 1291
20 Ga0070675_100034287 3300005354 Bacteria 4118
21 Ga0070673_101324325 3300005364 Unclassified 677
22 Ga0070659_100212031 3300005366 Bacteria 1596
23 Ga0070667_100126342 3300005367 Bacteria 2229
24 Ga0070709_10065325 3300005434 Bacteria 2329
25 Ga0070709_10172194 3300005434 Bacteria 1514
26 Ga0070709_10361101 3300005434 Bacteria 1076
27 Ga0070714_100003635 3300005435 Bacteria 11545
28 Ga0070714_100041115 3300005435 Unclassified 3900
29 Ga0070714_100516379 3300005435 Bacteria 1141
30 Ga0070714_101476163 3300005435 Unclassified 664
31 Ga0070713_100000788 3300005436 Bacteria 20250
32 Ga0070713_100029906 3300005436 Bacteria 4320
33 Ga0070713_100039396 3300005436 Bacteria 3835
34 Ga0070713_100162440 3300005436 Unclassified 1995
35 Ga0070713_100167130 3300005436 Bacteria 1968
36 Ga0070713_100390339 3300005436 Bacteria 1298
37 Ga0070710_10051673 3300005437 Unclassified 2309
38 Ga0070710_10098815 3300005437 Bacteria 1734
39 Ga0070710_10723538 3300005437 Bacteria 704
40 Ga0070711_100045861 3300005439 Bacteria 2976
41 Ga0070711_100210661 3300005439 Unclassified 1505
42 Ga0070711_100324162 3300005439 Unclassified 1232
43 Ga0070662_100475055 3300005457 Bacteria 1040
44 Ga0070681_10000775 3300005458 Bacteria 26562
45 Ga0070681_10198698 3300005458 Bacteria 1924
46 Ga0070681_10232464 3300005458 Bacteria 1758
47 Ga0068867_100261622 3300005459 Bacteria 1411
48 Ga0070685_10731089 3300005466 Unclassified 724
49 Ga0070706_100378522 3300005467 Bacteria 1318
50 Ga0070707_101372046 3300005468 Bacteria 673
51 Ga0070698_100361296 3300005471 Unclassified 1384
52 Ga0070679_100081209 3300005530 Unclassified 3231
53 Ga0070679_100154290 3300005530 Bacteria 2272
54 Ga0070679_100395231 3300005530 Bacteria 1329
55 Ga0070679_100597379 3300005530 Bacteria 1047
56 Ga0070684_100546464 3300005535 Bacteria 1075
57 Ga0068853_100021793 3300005539 Bacteria 5345
58 Ga0068853_100075957 3300005539 Bacteria 2933
59 Ga0068853_100559509 3300005539 Bacteria 1084
60 Ga0068853_101316916 3300005539 Unclassified 698
61 Ga0070686_100000037 3300005544 Bacteria 105422
62 Ga0070686_100792641 3300005544 Unclassified 763
63 Ga0070693_100071219 3300005547 Bacteria 2048
64 Ga0070693_100101707 3300005547 Bacteria 1752
65 Ga0070665_102128299 3300005548 Unclassified 565
66 Ga0068855_100003383 3300005563 Bacteria 19524
67 Ga0068855_100030624 3300005563 Bacteria 6433
68 Ga0068855_100039319 3300005563 Bacteria 5615
69 Ga0068855_100150357 3300005563 Bacteria 2648
70 Ga0068855_100528756 3300005563 Bacteria 1279
71 Ga0070664_100041076 3300005564 Bacteria 3902
72 Ga0070664_100193924 3300005564 Bacteria 1811
73 Ga0070664_100220268 3300005564 Bacteria 1698
74 Ga0070664_100396129 3300005564 Bacteria 1262
75 Ga0068857_100036835 3300005577 Unclassified 4334
76 Ga0068857_100280264 3300005577 Bacteria 1533
77 Ga0068857_100890703 3300005577 Unclassified 853
78 Ga0068857_101034586 3300005577 Bacteria 791
79 Ga0068854_100127068 3300005578 Bacteria 1943
80 Ga0068854_100258633 3300005578 Unclassified 1393
81 Ga0068856_100001663 3300005614 Bacteria 23300
82 Ga0068856_100002236 3300005614 Bacteria 19976
83 Ga0068856_100013595 3300005614 Bacteria 7878
84 Ga0068856_100168044 3300005614 Bacteria 2204
85 Ga0068856_100244676 3300005614 Bacteria 1809
86 Ga0068852_100012436 3300005616 Bacteria 6464
87 Ga0068852_100581248 3300005616 Unclassified 1123
88 Ga0068852_101238987 3300005616 Bacteria 767
89 Ga0068859_100792015 3300005617 Unclassified 1036
90 Ga0068864_100022318 3300005618 Bacteria 5307
91 Ga0068864_100303560 3300005618 Bacteria 1495
92 Ga0068866_10041386 3300005718 Bacteria 2286
93 Ga0068863_100262567 3300005841 Bacteria 1670
94 Ga0068858_100155690 3300005842 Bacteria 2150
95 Ga0081540_1067896 3300005983 Bacteria 1663
96 Ga0070717_10001879 3300006028 Bacteria 14674
97 Ga0070717_10002183 3300006028 Bacteria 13728
98 Ga0070717_10019552 3300006028 Bacteria 5314
99 Ga0070717_10081776 3300006028 Unclassified 2713
100 Ga0070717_10292019 3300006028 Unclassified 1448
101 Ga0070717_10548558 3300006028 Unclassified 1047
102 Ga0070717_10712746 3300006028 Bacteria 912
103 Ga0070717_11091658 3300006028 Unclassified 727
104 Ga0070717_11293482 3300006028 Unclassified 663
105 Ga0070717_11400140 3300006028 Unclassified 635
106 Ga0070715_10170389 3300006163 Bacteria 1084
107 Ga0070716_100007431 3300006173 Bacteria 5396
108 Ga0070716_100024960 3300006173 Bacteria 3183
109 Ga0070716_100376810 3300006173 Unclassified 1013
110 Ga0070716_100800973 3300006173 Unclassified 729
111 Ga0070712_100037469 3300006175 Bacteria 3306
112 Ga0070712_100059563 3300006175 Unclassified 2690
113 Ga0070712_100476472 3300006175 Unclassified 1043
114 Ga0070712_100542554 3300006175 Unclassified 979
115 Ga0070712_100906563 3300006175 Unclassified 760
116 Ga0097621_100000993 3300006237 Bacteria 19926
117 Ga0097621_100001095 3300006237 Bacteria 18946
118 Ga0097621_100172344 3300006237 Bacteria 1866
119 Ga0097621_100349043 3300006237 Bacteria 1315
120 Ga0097621_100904119 3300006237 Unclassified 822
121 Ga0068871_100001020 3300006358 Bacteria 18762
122 Ga0068871_100009193 3300006358 Bacteria 7147
123 Ga0068871_100013745 3300006358 Bacteria 6018
124 Ga0068871_100196387 3300006358 Bacteria 1740
125 Ga0068871_100214671 3300006358 Bacteria 1665
126 Ga0068871_100345079 3300006358 Bacteria 1316
127 Ga0068871_100784268 3300006358 Bacteria 877
128 Ga0068871_101703883 3300006358 Unclassified 598
129 Ga0075434_100056499 3300006871 Bacteria 3900
130 Ga0075434_100285657 3300006871 Bacteria 1669
131 Ga0075436_100000661 3300006914 Bacteria 22709
132 Ga0097620_100792076 3300006931 Unclassified 1036
133 Ga0075435_100025126 3300007076 Bacteria 4633
134 Ga0075435_100054469 3300007076 Bacteria 3228
135 Ga0075435_100180387 3300007076 Bacteria 1784
136 Ga0099794_10016191 3300007265 Bacteria 3303
137 Ga0105240_10012074 3300009093 Bacteria 11969
138 Ga0105240_10030544 3300009093 Bacteria 7002
139 Ga0105240_10083031 3300009093 Bacteria 3933
140 Ga0105240_10239522 3300009093 Bacteria 2104
141 Ga0105240_10270039 3300009093 Bacteria 1958
142 Ga0105240_10469767 3300009093 Bacteria 1404
143 Ga0105245_10375931 3300009098 Bacteria 1414
144 Ga0105247_10469914 3300009101 Unclassified 910
145 Ga0105241_10011118 3300009174 Bacteria 6602
146 Ga0105241_10032129 3300009174 Bacteria 3932
147 Ga0105241_10051487 3300009174 Unclassified 3140
148 Ga0105241_10234608 3300009174 Bacteria 1548
149 Ga0105248_10017323 3300009177 Bacteria 7940
150 Ga0105248_10061991 3300009177 Bacteria 4199
151 Ga0105237_10006850 3300009545 Bacteria 12557
152 Ga0105237_10044763 3300009545 Bacteria 4456
153 Ga0105237_10085947 3300009545 Bacteria 3135
154 Ga0105237_10453331 3300009545 Bacteria 1289
155 Ga0105238_10006313 3300009551 Bacteria 11782
156 Ga0105239_10295214 3300010375 Bacteria 1825
157 Ga0105239_10481169 3300010375 Bacteria 1410
158 Ga0105246_10952510 3300011119 Unclassified 774
159 Ga0157373_10017435 3300013100 Bacteria 5230
160 Ga0157371_10031072 3300013102 Unclassified 3848
161 Ga0157371_10135979 3300013102 Bacteria 1750
162 Ga0157370_10020283 3300013104 Bacteria 6639
163 Ga0157370_10521138 3300013104 Bacteria 1091
164 Ga0157370_10636952 3300013104 Bacteria 975
165 Ga0157370_11229823 3300013104 Bacteria 675
166 Ga0157369_10000269 3300013105 Bacteria 69979
167 Ga0157369_10010303 3300013105 Bacteria 10662
168 Ga0157369_10047206 3300013105 Bacteria 4677
169 Ga0157369_10147713 3300013105 Unclassified 2485
170 Ga0157369_10213955 3300013105 Bacteria 2019
171 Ga0157369_10948572 3300013105 Bacteria 882
172 Ga0157369_11596859 3300013105 Bacteria 663
173 Ga0157374_10001472 3300013296 Bacteria 19883
174 Ga0157374_10002373 3300013296 Bacteria 15864
175 Ga0157374_10057079 3300013296 Bacteria 3646
176 Ga0157374_11150826 3300013296 Unclassified 797
177 Ga0157374_11290855 3300013296 Unclassified 752
178 Ga0157378_10001696 3300013297 Bacteria 19840
179 Ga0157378_10008499 3300013297 Bacteria 8939
180 Ga0157378_10447377 3300013297 Bacteria 1281
181 Ga0163162_12419047 3300013306 Bacteria 604
182 Ga0157372_10002808 3300013307 Bacteria 18806
183 Ga0157372_10003752 3300013307 Bacteria 16311
184 Ga0157372_10033850 3300013307 Bacteria 5615
185 Ga0157372_10045293 3300013307 Bacteria 4879
186 Ga0157372_10118259 3300013307 Bacteria 3041
187 Ga0157372_10235753 3300013307 Unclassified 2122
188 Ga0157372_10272258 3300013307 Bacteria 1968
189 Ga0157372_10637751 3300013307 Bacteria 1241
190 Ga0157375_10185150 3300013308 Bacteria 2235
191 Ga0157375_10612998 3300013308 Unclassified 1247
192 Ga0157375_10617641 3300013308 Unclassified 1242
193 Ga0157375_12842007 3300013308 Unclassified 579
194 Ga0163163_10109821 3300014325 Bacteria 2785
195 Ga0163163_10138701 3300014325 Bacteria 2473
196 Ga0163163_13107322 3300014325 Unclassified 518
197 Ga0157377_10194189 3300014745 Bacteria 1285
198 Ga0157376_10090468 3300014969 Bacteria 2649
199 Ga0157376_10153756 3300014969 Unclassified 2078
200 Ga0157376_10450046 3300014969 Unclassified 1256
201 Ga0213873_10289485 3300021358 Unclassified 526
202 Ga0213874_10101029 3300021377 Unclassified 959
203 Ga0213876_10024504 3300021384 Bacteria 3185
204 Ga0213875_10004751 3300021388 Bacteria 7391
205 Ga0228598_1016366 3300024227 Unclassified 1463
206 Ga0207692_10030177 3300025898 Bacteria 2583
207 Ga0207692_10146916 3300025898 Bacteria 1346
208 Ga0207692_10565351 3300025898 Bacteria 728
209 Ga0207642_10098660 3300025899 Bacteria 1461
210 Ga0207685_10434190 3300025905 Unclassified 680
211 Ga0207699_10147506 3300025906 Bacteria 1553
212 Ga0207699_10521597 3300025906 Bacteria 859
213 Ga0207684_10263694 3300025910 Unclassified 1486
214 Ga0207654_10078643 3300025911 Bacteria 1979
215 Ga0207707_10009564 3300025912 Bacteria 8409
216 Ga0207707_10055518 3300025912 Unclassified 3445
217 Ga0207707_10245049 3300025912 Bacteria 1557
218 Ga0207707_10940968 3300025912 Bacteria 712
219 Ga0207695_10101879 3300025913 Bacteria 2865
220 Ga0207695_10124761 3300025913 Bacteria 2539
221 Ga0207695_11043212 3300025913 Bacteria 697
222 Ga0207695_11048442 3300025913 Unclassified 695
223 Ga0207671_10063606 3300025914 Unclassified 2742
224 Ga0207671_10422186 3300025914 Bacteria 1061
225 Ga0207693_10001883 3300025915 Bacteria 18348
226 Ga0207693_10052663 3300025915 Bacteria 3193
227 Ga0207693_10923605 3300025915 Unclassified 669
228 Ga0207663_10135228 3300025916 Bacteria 1710
229 Ga0207663_10202166 3300025916 Bacteria 1434
230 Ga0207663_10232065 3300025916 Unclassified 1349
231 Ga0207657_10213948 3300025919 Bacteria 1546
232 Ga0207649_10281732 3300025920 Bacteria 1209
233 Ga0207652_10051549 3300025921 Unclassified 3528
234 Ga0207646_10428170 3300025922 Bacteria 1194
235 Ga0207694_10000430 3300025924 Bacteria 39056
236 Ga0207659_10025839 3300025926 Bacteria 3953
237 Ga0207687_10231915 3300025927 Bacteria 1458
238 Ga0207700_10072396 3300025928 Bacteria 2657
239 Ga0207700_10129756 3300025928 Bacteria 2056
240 Ga0207700_10259624 3300025928 Bacteria 1487
241 Ga0207700_10291405 3300025928 Unclassified 1407
242 Ga0207700_10321077 3300025928 Bacteria 1342
243 Ga0207700_10870157 3300025928 Unclassified 806
244 Ga0207664_10007457 3300025929 Bacteria 7587
245 Ga0207664_10093476 3300025929 Bacteria 2470
246 Ga0207664_10121274 3300025929 Bacteria 2188
247 Ga0207664_10248873 3300025929 Bacteria 1550
248 Ga0207664_10522618 3300025929 Unclassified 1064
249 Ga0207664_10656647 3300025929 Unclassified 943
250 Ga0207690_10121198 3300025932 Bacteria 1900
251 Ga0207706_10281281 3300025933 Bacteria 1451
252 Ga0207670_10136990 3300025936 Unclassified 1801
253 Ga0207665_10000184 3300025939 Bacteria 41733
254 Ga0207665_10001512 3300025939 Bacteria 15655
255 Ga0207665_10571912 3300025939 Unclassified 880
256 Ga0207665_10632765 3300025939 Unclassified 837
257 Ga0207711_10037121 3300025941 Bacteria 4137
258 Ga0207711_10050408 3300025941 Bacteria 3564
259 Ga0207711_10887537 3300025941 Unclassified 829
260 Ga0207689_11166559 3300025942 Unclassified 649
261 Ga0207661_10343054 3300025944 Bacteria 1346
262 Ga0207679_10149938 3300025945 Bacteria 1896
263 Ga0207679_10351564 3300025945 Bacteria 1285
264 Ga0207679_10420746 3300025945 Bacteria 1179
265 Ga0207667_10005124 3300025949 Bacteria 16006
266 Ga0207667_10038999 3300025949 Bacteria 5066
267 Ga0207667_10067929 3300025949 Bacteria 3713
268 Ga0207667_10299532 3300025949 Bacteria 1643
269 Ga0207677_10017610 3300026023 Bacteria 4266
270 Ga0207677_10635033 3300026023 Unclassified 941
271 Ga0207677_10642402 3300026023 Unclassified 936
272 Ga0207639_10041379 3300026041 Bacteria 3447
273 Ga0207702_10003591 3300026078 Bacteria 14098
274 Ga0207702_10041657 3300026078 Bacteria 3851
275 Ga0207702_10135617 3300026078 Bacteria 2220
276 Ga0207702_10158632 3300026078 Bacteria 2064
277 Ga0207648_10955597 3300026089 Unclassified 802
278 Ga0207676_10023680 3300026095 Bacteria 4535
279 Ga0207676_10194432 3300026095 Bacteria 1788
280 Ga0207674_10046212 3300026116 Unclassified 4472
281 Ga0207674_10746035 3300026116 Bacteria 945
282 Ga0207698_10004598 3300026142 Bacteria 8426
283 Ga0207698_10186068 3300026142 Unclassified 1845
284 Ga0207698_10687836 3300026142 Unclassified 1017
285 Ga0268266_11766976 3300028379 Unclassified 593
286 Ga0265337_1043260 3300028556 Bacteria 1288
287 Ga0265318_10000020 3300028577 Bacteria 166887
288 Ga0265338_10028857 3300028800 Bacteria 5521
289 Ga0265338_10398778 3300028800 Unclassified 981
290 Ga0265338_10620614 3300028800 Bacteria 752
291 Ga0265760_10000096 3300031090 Bacteria 22944
292 Ga0265330_10000011 3300031235 Bacteria 183176
293 Ga0265332_10000043 3300031238 Bacteria 117186
294 Ga0265332_10172144 3300031238 Unclassified 903
295 Ga0265328_10000855 3300031239 Bacteria 14135
296 Ga0265320_10000092 3300031240 Bacteria 74770
297 Ga0265325_10001493 3300031241 Bacteria 16453
298 Ga0265325_10021228 3300031241 Unclassified 3572
299 Ga0265329_10016726 3300031242 Bacteria 2537
300 Ga0265339_10000275 3300031249 Bacteria 41632
301 Ga0265339_10140264 3300031249 Bacteria 1230
302 Ga0265339_10230701 3300031249 Unclassified 902
303 Ga0265339_10324657 3300031249 Unclassified 729
304 Ga0265331_10000035 3300031250 Bacteria 199191
305 Ga0265331_10229317 3300031250 Unclassified 834
306 Ga0265316_10003787 3300031344 Bacteria 15201
307 Ga0265316_10600138 3300031344 Unclassified 781
308 Ga0265313_10000010 3300031595 Bacteria 166869
309 Ga0265314_10000094 3300031711 Bacteria 134574
310 Ga0265314_10021305 3300031711 Bacteria 4988
311 Ga0265314_10023559 3300031711 Bacteria 4690
312 Ga0265314_10032417 3300031711 Bacteria 3843
313 Ga0265314_10556389 3300031711 Bacteria 596
314 Ga0265342_10090438 3300031712 Bacteria 1755
315 Ga0265342_10103841 3300031712 Bacteria 1616
316 Ga0265342_10254334 3300031712 Bacteria 936
317 Ga0316212_1000988 3300033547 Bacteria 3739
318 Ga0373926_0003092 3300035083 Bacteria 5345
319 Ga0373926_0282899 3300035083 Bacteria 646
320 Ga0373929_0015281 3300035085 Bacteria 1491
321 Ga0373944_0019039 3300035089 Bacteria 1967
322 Ga0373923_0109201 3300035111 Bacteria 1227
323 Ga0373923_0116428 3300035111 Unclassified 1191
324 Ga0373936_0009395 3300035113 Bacteria 3686
325 Ga0373945_0063394 3300035116 Bacteria 1384
326 Ga0373954_0534429 3300035118 Unclassified 581
327 Ga0373960_0097798 3300035121 Bacteria 947
328 Ga0373943_0010631 3300035170 Bacteria 4130
329 Ga0373943_0028972 3300035170 Bacteria 2613
330 Ga0373943_0210757 3300035170 Bacteria 1079
331 Ga0373946_0081812 3300035171 Bacteria 1415
332 Ga0373955_0331661 3300035172 Unclassified 920
333 Ga0373931_0067890 3300035691 Bacteria 1939
334 Ga0373931_0158900 3300035691 Bacteria 1323
335 Ga0373931_0563172 3300035691 Unclassified 741
336 Ga0373935_0003561 3300035692 Bacteria 9072
337 Ga0373935_0004868 3300035692 Bacteria 7890
338 Ga0373935_0044533 3300035692 Bacteria 2797
339 Ga0373927_0012123 3300035695 Bacteria 5736
340 Ga0373927_0075798 3300035695 Bacteria 2178
341 Ga0373927_0775154 3300035695 Unclassified 633
342 Ga0373947_0003319 3300035725 Bacteria 9535
343 Ga0373947_0004853 3300035725 Bacteria 7860
344 Ga0373947_0137236 3300035725 Unclassified 1566
345 Ga0373937_0653181 3300036401 Bacteria 997
346 Ga0373925_0001989 3300037068 Bacteria 16928
347 Ga0373925_0015712 3300037068 Bacteria 5478
348 Ga0373925_0043966 3300037068 Bacteria 3316
349 Ga0373925_0936076 3300037068 Unclassified 714
350 Ga0373925_1394734 3300037068 Unclassified 574
351 Ga0395900_0321094 3300037418 Bacteria 1529
352 Ga0395900_0695515 3300037418 Unclassified 951
353 Ga0395898_1311602 3300037466 Bacteria 653
354 Ga0436364_0965210 3300037853 Bacteria 7757
355 Ga0436364_1172649 3300037853 Unclassified 999
356 Ga0436365_0387974 3300039437 Unclassified 1135
357 Ga0436365_1010748 3300039437 Unclassified 2554
358 Ga0436360_1076585 3300039438 Unclassified 725
359 Ga0436361_0534127 3300039447 Bacteria 894
360 Ga0436363_1095659 3300039450 Bacteria 5028
361 Ga0436362_0447798 3300039453 Unclassified 647
362 Ga0466969_0197040 3300044656 Bacteria 919
363 Ga0466957_0824159 3300044842 Unclassified 660
364 Ga0466959_0013184 3300045049 Bacteria 5988
365 Ga0466958_0606498 3300045836 Unclassified 712
366 Ga0495603_0125801 3300046455 Bacteria 1494
367 Ga0495629_0646838 3300046459 Unclassified 705
368 Ga0495651_0043797 3300046462 Bacteria 3471
369 Ga0495653_0638785 3300046463 Unclassified 651
370 Ga0495580_0001147 3300046472 Bacteria 23331
371 Ga0495580_0020199 3300046472 Unclassified 4934
372 Ga0495580_0042049 3300046472 Bacteria 3257
373 Ga0495580_0047280 3300046472 Bacteria 3050
374 Ga0495582_0001740 3300046473 Bacteria 12286
375 Ga0495582_0005209 3300046473 Bacteria 7276
376 Ga0495639_0032585 3300046475 Bacteria 2325
377 Ga0495608_0104033 3300046511 Bacteria 1829
378 Ga0495630_0048977 3300046517 Bacteria 3163
379 Ga0495666_0102494 3300046526 Bacteria 1348
380 Ga0495666_0506243 3300046526 Unclassified 539
381 Ga0495652_0443312 3300046529 Unclassified 910
382 Ga0495665_0000909 3300046531 Bacteria 15586
383 Ga0495665_0002409 3300046531 Bacteria 10104
384 Ga0495665_0130724 3300046531 Unclassified 1314
385 Ga0495586_0096202 3300046535 Bacteria 1640
386 Ga0495586_0315645 3300046535 Bacteria 896
387 Ga0495587_0053171 3300046536 Bacteria 2388
388 Ga0495645_0146393 3300046543 Unclassified 1645
389 Ga0495622_0238664 3300046557 Bacteria 802
390 Ga0495667_0138523 3300046559 Bacteria 1568
391 Ga0495634_0858571 3300046642 Unclassified 515
392 Ga0495588_0064063 3300046674 Bacteria 1907
393 Ga0495657_0289474 3300046675 Unclassified 979
394 Ga0495599_0225338 3300046678 Bacteria 1146
395 Ga0495599_0678086 3300046678 Bacteria 596
396 Ga0495623_0156772 3300046679 Bacteria 1341
397 Ga0495623_0298049 3300046679 Unclassified 892
398 Ga0495658_0010707 3300046683 Bacteria 4591
399 Ga0495658_0283747 3300046683 Bacteria 1045
400 Ga0495669_0157121 3300046684 Bacteria 1078
401 Ga0495624_0098978 3300046690 Bacteria 1796
402 Ga0495624_0721228 3300046690 Bacteria 591
403 Ga0495581_0207816 3300047315 Bacteria 1145
404 Ga0495581_0483244 3300047315 Unclassified 720
405 Ga0495604_0161373 3300047317 Bacteria 1583
406 Ga0495674_0192388 3300047319 Bacteria 1695
407 Ga0495676_0796324 3300047321 Bacteria 609
408 Ga0495675_0158431 3300047444 Unclassified 1395
409 Ga0495684_0064777 3300047471 Bacteria 2777
410 Ga0495593_0053733 3300047673 Bacteria 2125
411 Ga0495602_0166507 3300048088 Bacteria 1715
412 Ga0495614_0058973 3300048089 Bacteria 1648
413 Ga0496100_0299301 3300048903 Bacteria 1204
414 Ga0496101_0540936 3300048904 Unclassified 921
415 Ga0496104_0154054 3300048907 Bacteria 2206
416 Ga0496104_0326799 3300048907 Bacteria 1447
417 Ga0496104_1284203 3300048907 Bacteria 635
418 Ga0496108_0146556 3300048911 Bacteria 2035
419 Ga0496112_0000754 3300048915 Bacteria 22675
420 Ga0496112_0046137 3300048915 Bacteria 4273
421 Ga0496112_0047133 3300048915 Bacteria 4228
422 Ga0496112_0067397 3300048915 Bacteria 3533
423 Ga0496112_0333887 3300048915 Bacteria 1460
424 Ga0496114_1189795 3300048917 Unclassified 648
425 Ga0496115_0063268 3300048918 Unclassified 2985
426 Ga0496115_0383331 3300048918 Unclassified 1143
427 Ga0501247_001018 3300049677 Unclassified 2554
428 Ga0501249_002667 3300049679 Unclassified 3593
429 Ga0501252_011063 3300049682 Unclassified 1075
430 Ga0501225_0055000 3300049705 Unclassified 1113
431 Ga0501268_030034 3300049765 Unclassified 979
432 Ga0501270_013381 3300049767 Unclassified 1137
433 Ga0501273_003099 3300049770 Bacteria 1740
434 Ga0501226_030763 3300049853 Unclassified 609
435 nmdc:mga09592_618955_c1 3300050508 Unclassified 926
436 nmdc:mga0n895_342844_c1 3300050512 Bacteria 1513
437 nmdc:mga0n895_501064_c1 3300050512 Unclassified 1223
438 nmdc:mga0rr50_4622_c2 3300050513 Bacteria 4648
439 nmdc:mga0rr50_6762_c1 3300050513 Bacteria 7024
440 nmdc:mga0rr50_943496_c1 3300050513 Bacteria 735
441 nmdc:mga08x19_3369_c1 3300050514 Bacteria 9533
442 nmdc:mga08x19_794_c1 3300050514 Bacteria 20154
443 Ga0373936_0298425
444 rootL2_10362052
445 rootH1_10136932
446 rootH1_10177467
447 Ga0070658_11082932
448 Ga0070683_100117965
449 Ga0070690_100262464
450 Ga0070670_100520276
451 Ga0068869_100337729
452 Ga0070680_100052558
453 Ga0070680_101319042
454 Ga0068868_100035526
455 Ga0068868_100568696
456 Ga0068868_101001519
457 Ga0070660_100880944
458 Ga0070689_100177028
459 Ga0070691_10015249
460 Ga0070687_100796624
461 Ga0070661_100281000
462 Ga0070675_100034287
463 Ga0070673_101324325
464 Ga0070659_100212031
465 Ga0070667_100126342
466 Ga0070709_10065325
467 Ga0070709_10172194
468 Ga0070709_10361101
469 Ga0070714_100003635
470 Ga0070714_100041115
471 Ga0070714_100516379
472 Ga0070714_101476163
473 Ga0070713_100000788
474 Ga0070713_100029906
475 Ga0070713_100039396
476 Ga0070713_100162440
477 Ga0070713_100167130
478 Ga0070713_100390339
479 Ga0070710_10051673
480 Ga0070710_10098815
481 Ga0070710_10723538
482 Ga0070711_100045861
483 Ga0070711_100210661
484 Ga0070711_100324162
485 Ga0070662_100475055
486 Ga0070681_10000775
487 Ga0070681_10198698
488 Ga0070681_10232464
489 Ga0068867_100261622
490 Ga0070685_10731089
491 Ga0070706_100378522
492 Ga0070707_101372046
493 Ga0070698_100361296
494 Ga0070679_100081209
495 Ga0070679_100154290
496 Ga0070679_100395231
497 Ga0070679_100597379
498 Ga0070684_100546464
499 Ga0068853_100021793
500 Ga0068853_100075957
501 Ga0068853_100559509
502 Ga0068853_101316916
503 Ga0070686_100000037
504 Ga0070686_100792641
505 Ga0070693_100071219
506 Ga0070693_100101707
507 Ga0070665_102128299
508 Ga0068855_100003383
509 Ga0068855_100030624
510 Ga0068855_100039319
511 Ga0068855_100150357
512 Ga0068855_100528756
513 Ga0070664_100041076
514 Ga0070664_100193924
515 Ga0070664_100220268
516 Ga0070664_100396129
517 Ga0068857_100036835
518 Ga0068857_100280264
519 Ga0068857_100890703
520 Ga0068857_101034586
521 Ga0068854_100127068
522 Ga0068854_100258633
523 Ga0068856_100001663
524 Ga0068856_100002236
525 Ga0068856_100013595
526 Ga0068856_100168044
527 Ga0068856_100244676
528 Ga0068852_100012436
529 Ga0068852_100581248
530 Ga0068852_101238987
531 Ga0068859_100792015
532 Ga0068864_100022318
533 Ga0068864_100303560
534 Ga0068866_10041386
535 Ga0068863_100262567
536 Ga0068858_100155690
537 Ga0081540_1067896
538 Ga0070717_10001879
539 Ga0070717_10002183
540 Ga0070717_10019552
541 Ga0070717_10081776
542 Ga0070717_10292019
543 Ga0070717_10548558
544 Ga0070717_10712746
545 Ga0070717_11091658
546 Ga0070717_11293482
547 Ga0070717_11400140
548 Ga0070715_10170389
549 Ga0070716_100007431
550 Ga0070716_100024960
551 Ga0070716_100376810
552 Ga0070716_100800973
553 Ga0070712_100037469
554 Ga0070712_100059563
555 Ga0070712_100476472
556 Ga0070712_100542554
557 Ga0070712_100906563
558 Ga0097621_100000993
559 Ga0097621_100001095
560 Ga0097621_100172344
561 Ga0097621_100349043
562 Ga0097621_100904119
563 Ga0068871_100001020
564 Ga0068871_100009193
565 Ga0068871_100013745
566 Ga0068871_100196387
567 Ga0068871_100214671
568 Ga0068871_100345079
569 Ga0068871_100784268
570 Ga0068871_101703883
571 Ga0075434_100056499
572 Ga0075434_100285657
573 Ga0075436_100000661
574 Ga0097620_100792076
575 Ga0075435_100025126
576 Ga0075435_100054469
577 Ga0075435_100180387
578 Ga0099794_10016191
579 Ga0105240_10012074
580 Ga0105240_10030544
581 Ga0105240_10083031
582 Ga0105240_10239522
583 Ga0105240_10270039
584 Ga0105240_10469767
585 Ga0105245_10375931
586 Ga0105247_10469914
587 Ga0105241_10011118
588 Ga0105241_10032129
589 Ga0105241_10051487
590 Ga0105241_10234608
591 Ga0105248_10017323
592 Ga0105248_10061991
593 Ga0105237_10006850
594 Ga0105237_10044763
595 Ga0105237_10085947
596 Ga0105237_10453331
597 Ga0105238_10006313
598 Ga0105239_10295214
599 Ga0105239_10481169
600 Ga0105246_10952510
601 Ga0157373_10017435
602 Ga0157371_10031072
603 Ga0157371_10135979
604 Ga0157370_10020283
605 Ga0157370_10521138
606 Ga0157370_10636952
607 Ga0157370_11229823
608 Ga0157369_10000269
609 Ga0157369_10010303
610 Ga0157369_10047206
611 Ga0157369_10147713
612 Ga0157369_10213955
613 Ga0157369_10948572
614 Ga0157369_11596859
615 Ga0157374_10001472
616 Ga0157374_10002373
617 Ga0157374_10057079
618 Ga0157374_11150826
619 Ga0157374_11290855
620 Ga0157378_10001696
621 Ga0157378_10008499
622 Ga0157378_10447377
623 Ga0163162_12419047
624 Ga0157372_10002808
625 Ga0157372_10003752
626 Ga0157372_10033850
627 Ga0157372_10045293
628 Ga0157372_10118259
629 Ga0157372_10235753
630 Ga0157372_10272258
631 Ga0157372_10637751
632 Ga0157375_10185150
633 Ga0157375_10612998
634 Ga0157375_10617641
635 Ga0157375_12842007
636 Ga0163163_10109821
637 Ga0163163_10138701
638 Ga0163163_13107322
639 Ga0157377_10194189
640 Ga0157376_10090468
641 Ga0157376_10153756
642 Ga0157376_10450046
643 Ga0213873_10289485
644 Ga0213874_10101029
645 Ga0213876_10024504
646 Ga0213875_10004751
647 Ga0228598_1016366
648 Ga0207692_10030177
649 Ga0207692_10146916
650 Ga0207692_10565351
651 Ga0207642_10098660
652 Ga0207685_10434190
653 Ga0207699_10147506
654 Ga0207699_10521597
655 Ga0207684_10263694
656 Ga0207654_10078643
657 Ga0207707_10009564
658 Ga0207707_10055518
659 Ga0207707_10245049
660 Ga0207707_10940968
661 Ga0207695_10101879
662 Ga0207695_10124761
663 Ga0207695_11043212
664 Ga0207695_11048442
665 Ga0207671_10063606
666 Ga0207671_10422186
667 Ga0207693_10001883
668 Ga0207693_10052663
669 Ga0207693_10923605
670 Ga0207663_10135228
671 Ga0207663_10202166
672 Ga0207663_10232065
673 Ga0207657_10213948
674 Ga0207649_10281732
675 Ga0207652_10051549
676 Ga0207646_10428170
677 Ga0207694_10000430
678 Ga0207659_10025839
679 Ga0207687_10231915
680 Ga0207700_10072396
681 Ga0207700_10129756
682 Ga0207700_10259624
683 Ga0207700_10291405
684 Ga0207700_10321077
685 Ga0207700_10870157
686 Ga0207664_10007457
687 Ga0207664_10093476
688 Ga0207664_10121274
689 Ga0207664_10248873
690 Ga0207664_10522618
691 Ga0207664_10656647
692 Ga0207690_10121198
693 Ga0207706_10281281
694 Ga0207670_10136990
695 Ga0207665_10000184
696 Ga0207665_10001512
697 Ga0207665_10571912
698 Ga0207665_10632765
699 Ga0207711_10037121
700 Ga0207711_10050408
701 Ga0207711_10887537
702 Ga0207689_11166559
703 Ga0207661_10343054
704 Ga0207679_10149938
705 Ga0207679_10351564
706 Ga0207679_10420746
707 Ga0207667_10005124
708 Ga0207667_10038999
709 Ga0207667_10067929
710 Ga0207667_10299532
711 Ga0207677_10017610
712 Ga0207677_10635033
713 Ga0207677_10642402
714 Ga0207639_10041379
715 Ga0207702_10003591
716 Ga0207702_10041657
717 Ga0207702_10135617
718 Ga0207702_10158632
719 Ga0207648_10955597
720 Ga0207676_10023680
721 Ga0207676_10194432
722 Ga0207674_10046212
723 Ga0207674_10746035
724 Ga0207698_10004598
725 Ga0207698_10186068
726 Ga0207698_10687836
727 Ga0268266_11766976
728 Ga0265337_1043260
729 Ga0265318_10000020
730 Ga0265338_10028857
731 Ga0265338_10398778
732 Ga0265338_10620614
733 Ga0265760_10000096
734 Ga0265330_10000011
735 Ga0265332_10000043
736 Ga0265332_10172144
737 Ga0265328_10000855
738 Ga0265320_10000092
739 Ga0265325_10001493
740 Ga0265325_10021228
741 Ga0265329_10016726
742 Ga0265339_10000275
743 Ga0265339_10140264
744 Ga0265339_10230701
745 Ga0265339_10324657
746 Ga0265331_10000035
747 Ga0265331_10229317
748 Ga0265316_10003787
749 Ga0265316_10600138
750 Ga0265313_10000010
751 Ga0265314_10000094
752 Ga0265314_10021305
753 Ga0265314_10023559
754 Ga0265314_10032417
755 Ga0265314_10556389
756 Ga0265342_10090438
757 Ga0265342_10103841
758 Ga0265342_10254334
759 Ga0316212_1000988
760 Ga0373926_0003092
761 Ga0373926_0282899
762 Ga0373929_0015281
763 Ga0373944_0019039
764 Ga0373923_0109201
765 Ga0373923_0116428
766 Ga0373936_0009395
767 Ga0373945_0063394
768 Ga0373954_0534429
769 Ga0373960_0097798
770 Ga0373943_0010631
771 Ga0373943_0028972
772 Ga0373943_0210757
773 Ga0373946_0081812
774 Ga0373955_0331661
775 Ga0373931_0067890
776 Ga0373931_0158900
777 Ga0373931_0563172
778 Ga0373935_0003561
779 Ga0373935_0004868
780 Ga0373935_0044533
781 Ga0373927_0012123
782 Ga0373927_0075798
783 Ga0373927_0775154
784 Ga0373947_0003319
785 Ga0373947_0004853
786 Ga0373947_0137236
787 Ga0373937_0653181
788 Ga0373925_0001989
789 Ga0373925_0015712
790 Ga0373925_0043966
791 Ga0373925_0936076
792 Ga0373925_1394734
793 Ga0395900_0321094
794 Ga0395900_0695515
795 Ga0395898_1311602
796 Ga0436364_0965210
797 Ga0436364_1172649
798 Ga0436365_0387974
799 Ga0436365_1010748
800 Ga0436360_1076585
801 Ga0436361_0534127
802 Ga0436363_1095659
803 Ga0436362_0447798
804 Ga0466969_0197040
805 Ga0466957_0824159
806 Ga0466959_0013184
807 Ga0466958_0606498
808 Ga0495603_0125801
809 Ga0495629_0646838
810 Ga0495651_0043797
811 Ga0495653_0638785
812 Ga0495580_0001147
813 Ga0495580_0020199
814 Ga0495580_0042049
815 Ga0495580_0047280
816 Ga0495582_0001740
817 Ga0495582_0005209
818 Ga0495639_0032585
819 Ga0495608_0104033
820 Ga0495630_0048977
821 Ga0495666_0102494
822 Ga0495666_0506243
823 Ga0495652_0443312
824 Ga0495665_0000909
825 Ga0495665_0002409
826 Ga0495665_0130724
827 Ga0495586_0096202
828 Ga0495586_0315645
829 Ga0495587_0053171
830 Ga0495645_0146393
831 Ga0495622_0238664
832 Ga0495667_0138523
833 Ga0495634_0858571
834 Ga0495588_0064063
835 Ga0495657_0289474
836 Ga0495599_0225338
837 Ga0495599_0678086
838 Ga0495623_0156772
839 Ga0495623_0298049
840 Ga0495658_0010707
841 Ga0495658_0283747
842 Ga0495669_0157121
843 Ga0495624_0098978
844 Ga0495624_0721228
845 Ga0495581_0207816
846 Ga0495581_0483244
847 Ga0495604_0161373
848 Ga0495674_0192388
849 Ga0495676_0796324
850 Ga0495675_0158431
851 Ga0495684_0064777
852 Ga0495593_0053733
853 Ga0495602_0166507
854 Ga0495614_0058973
855 Ga0496100_0299301
856 Ga0496101_0540936
857 Ga0496104_0154054
858 Ga0496104_0326799
859 Ga0496104_1284203
860 Ga0496108_0146556
861 Ga0496112_0000754
862 Ga0496112_0046137
863 Ga0496112_0047133
864 Ga0496112_0067397
865 Ga0496112_0333887
866 Ga0496114_1189795
867 Ga0496115_0063268
868 Ga0496115_0383331
869 Ga0501247_001018
870 Ga0501249_002667
871 Ga0501252_011063
872 Ga0501225_0055000
873 Ga0501268_030034
874 Ga0501270_013381
875 Ga0501273_003099
876 Ga0501226_030763
877 nmdc:mga09592_618955_c1
878 nmdc:mga0n895_342844_c1
879 nmdc:mga0n895_501064_c1
880 nmdc:mga0rr50_4622_c2
881 nmdc:mga0rr50_6762_c1
882 nmdc:mga0rr50_943496_c1
883 nmdc:mga08x19_3369_c1
884 nmdc:mga08x19_794_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

25

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.914 2 124
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.8975 2 125
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.8952 2 124
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.8945 2 125
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.8933 2 124
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8952 2 124 3.40.50.1010
6nklA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8866 2 125 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.881 2 125 3.40.50.1010
6nklA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8736 2 125 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.868 2 125 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1F9G6G9-F1-model_v4 PIN domain-containing protein 1.002 2 125 GO:0004518
GO:0046872
AF-A0A6A0IMX6-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9981 2 125 GO:0000287
GO:0004540
GO:0090729
AF-A0A1G3R229-F1-model_v4 PIN domain-containing protein 0.996 31 125 GO:0004518
GO:0046872
AF-A0A3N5PN91-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9955 2 125 GO:0004518
GO:0046872
AF-A0A2E3IVY0-F1-model_v4 PIN domain-containing protein 0.9935 2 125 GO:0004518
GO:0046872

Map