F444918

General Info

Members Datasets Scaffolds Average Seq Length
442 283 432 75

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0151660|Ga0436360_0151660_1514_1777
Length 87
Sequence LPDPRPFETHAMKPDVHPSYHPIKVVMTDGTEYMTRSTYGKPGDTLHLDIDPKTHPAWTGGSQQLVDRGGRLSRFNSRFGNLSFGKK

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
3 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
4 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
5 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
6 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
7 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
8 2909042592 Labrys sp. LIt4 Isolate Nodule
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
167 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
168 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
169 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
274 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
278 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
283 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0.23
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 0.45
Rhizoplane 2.71
Rhizosphere 79.86
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1020821 3300003578 Bacteria 610
2 Ga0065707_10981197 3300005295 Bacteria 544
3 Ga0070676_10325144 3300005328 Bacteria 1050
4 Ga0070683_100094865 3300005329 Bacteria 2804
5 Ga0068869_101226667 3300005334 Bacteria 660
6 Ga0070661_100419355 3300005344 Bacteria 1061
7 Ga0070668_100177491 3300005347 Bacteria 1738
8 Ga0070669_100293534 3300005353 Bacteria 1306
9 Ga0070675_100645788 3300005354 Bacteria 961
10 Ga0070674_100601432 3300005356 Bacteria 929
11 Ga0070674_101547831 3300005356 Bacteria 597
12 Ga0070674_102171782 3300005356 Bacteria 507
13 Ga0070673_100179007 3300005364 Bacteria 1814
14 Ga0070688_100860061 3300005365 Bacteria 713
15 Ga0070659_101157825 3300005366 Bacteria 683
16 Ga0070709_11787606 3300005434 Bacteria 503
17 Ga0070714_101431747 3300005435 Bacteria 675
18 Ga0070714_102397243 3300005435 Bacteria 513
19 Ga0070713_100291403 3300005436 Bacteria 1500
20 Ga0070713_100357820 3300005436 Bacteria 1356
21 Ga0070713_100483057 3300005436 Bacteria 1167
22 Ga0070713_100868103 3300005436 Bacteria 867
23 Ga0070700_101312299 3300005441 Bacteria 608
24 Ga0070663_100768233 3300005455 Bacteria 824
25 Ga0070663_100942413 3300005455 Bacteria 748
26 Ga0068867_100195101 3300005459 Bacteria 1618
27 Ga0070665_101317518 3300005548 Bacteria 732
28 Ga0068855_100036376 3300005563 Bacteria 5860
29 Ga0070664_101434138 3300005564 Bacteria 653
30 Ga0081455_10021063 3300005937 Bacteria 6122
31 Ga0081540_1181393 3300005983 Bacteria 787
32 Ga0081539_10004224 3300005985 Bacteria 16174
33 Ga0070717_10329482 3300006028 Bacteria 1362
34 Ga0070717_11053816 3300006028 Bacteria 741
35 Ga0070717_11346145 3300006028 Bacteria 649
36 Ga0070717_11761153 3300006028 Bacteria 560
37 Ga0075365_10093852 3300006038 Bacteria 2047
38 Ga0075368_10021510 3300006042 Bacteria 2451
39 Ga0075363_100001280 3300006048 Bacteria 9353
40 Ga0075363_100012816 3300006048 Bacteria 4048
41 Ga0075364_10026098 3300006051 Bacteria 3724
42 Ga0075364_10047200 3300006051 Bacteria 2805
43 Ga0075364_10490397 3300006051 Bacteria 840
44 Ga0075364_10773259 3300006051 Bacteria 655
45 Ga0075364_11008844 3300006051 Bacteria 566
46 Ga0070715_10486043 3300006163 Bacteria 704
47 Ga0070716_100651346 3300006173 Bacteria 799
48 Ga0070712_100698054 3300006175 Bacteria 865
49 Ga0075362_10027127 3300006177 Bacteria 2450
50 Ga0075367_10059715 3300006178 Bacteria 2271
51 Ga0075367_10194006 3300006178 Bacteria 1268
52 Ga0075367_10604619 3300006178 Bacteria 697
53 Ga0075367_10646134 3300006178 Bacteria 673
54 Ga0075367_10655372 3300006178 Bacteria 667
55 Ga0075369_10008685 3300006186 Bacteria 3920
56 Ga0075369_10189454 3300006186 Bacteria 948
57 Ga0075369_10538704 3300006186 Bacteria 556
58 Ga0075366_10000720 3300006195 Bacteria 15704
59 Ga0075366_10030503 3300006195 Bacteria 3169
60 Ga0075366_10162392 3300006195 Bacteria 1354
61 Ga0075366_10267912 3300006195 Bacteria 1043
62 Ga0075370_10030097 3300006353 Bacteria 3027
63 Ga0075370_11030268 3300006353 Bacteria 505
64 Ga0075428_100079977 3300006844 Bacteria 3567
65 Ga0075428_102291121 3300006844 Bacteria 556
66 Ga0075430_100479711 3300006846 Bacteria 1026
67 Ga0075431_100632301 3300006847 Bacteria 1052
68 Ga0075431_101504948 3300006847 Bacteria 631
69 Ga0075434_100026307 3300006871 Bacteria 5699
70 Ga0075434_100090272 3300006871 Bacteria 3065
71 Ga0075429_101746949 3300006880 Bacteria 540
72 Ga0075436_100119606 3300006914 Bacteria 1842
73 Ga0075435_100685754 3300007076 Bacteria 890
74 Ga0105240_10124692 3300009093 Bacteria 3097
75 Ga0105240_10347259 3300009093 Bacteria 1684
76 Ga0111539_10345345 3300009094 Bacteria 1732
77 Ga0111539_10934981 3300009094 Bacteria 1008
78 Ga0111539_11244298 3300009094 Bacteria 864
79 Ga0105245_10476254 3300009098 Bacteria 1261
80 Ga0114129_11760018 3300009147 Bacteria 755
81 Ga0114129_12014667 3300009147 Bacteria 698
82 Ga0114129_12398129 3300009147 Bacteria 632
83 Ga0114129_12689640 3300009147 Bacteria 593
84 Ga0114129_12718478 3300009147 Bacteria 589
85 Ga0105243_12748593 3300009148 Bacteria 533
86 Ga0105242_13111617 3300009176 Bacteria 514
87 Ga0105237_10133071 3300009545 Bacteria 2481
88 Ga0105237_10260172 3300009545 Bacteria 1738
89 Ga0105238_10753547 3300009551 Bacteria 988
90 Ga0105249_10151762 3300009553 Bacteria 2231
91 Ga0105249_10368271 3300009553 Bacteria 1460
92 Ga0105249_13360486 3300009553 Bacteria 515
93 Ga0099796_10027854 3300010159 Bacteria 1809
94 Ga0105239_12993807 3300010375 Bacteria 551
95 Ga0105246_10440956 3300011119 Bacteria 1092
96 Ga0157370_10499979 3300013104 Bacteria 1116
97 Ga0157370_11072718 3300013104 Bacteria 728
98 Ga0157374_12230399 3300013296 Bacteria 575
99 Ga0157378_12956277 3300013297 Bacteria 527
100 Ga0163162_11891810 3300013306 Bacteria 683
101 Ga0157372_11266819 3300013307 Bacteria 851
102 Ga0157372_12070223 3300013307 Bacteria 654
103 Ga0157375_11527563 3300013308 Bacteria 788
104 Ga0163163_10003165 3300014325 Bacteria 13940
105 Ga0163163_12495913 3300014325 Bacteria 575
106 Ga0157380_10310878 3300014326 Bacteria 1456
107 Ga0157380_10982616 3300014326 Bacteria 876
108 Ga0157380_11301549 3300014326 Bacteria 774
109 Ga0157380_12071127 3300014326 Bacteria 632
110 Ga0157380_12266060 3300014326 Bacteria 607
111 Ga0157377_11167621 3300014745 Bacteria 594
112 Ga0157379_12399673 3300014968 Bacteria 526
113 Ga0213872_10055505 3300021361 Bacteria 1796
114 Ga0213872_10064604 3300021361 Bacteria 1653
115 Ga0213871_10104167 3300021441 Bacteria 833
116 Ga0207685_10597516 3300025905 Bacteria 592
117 Ga0207699_10216035 3300025906 Bacteria 1306
118 Ga0207699_10566434 3300025906 Bacteria 825
119 Ga0207695_10381412 3300025913 Bacteria 1295
120 Ga0207671_10325256 3300025914 Bacteria 1217
121 Ga0207671_10778866 3300025914 Bacteria 759
122 Ga0207693_10391791 3300025915 Bacteria 1086
123 Ga0207681_10430982 3300025923 Bacteria 1070
124 Ga0207681_10490671 3300025923 Bacteria 1004
125 Ga0207681_11556045 3300025923 Bacteria 554
126 Ga0207694_10140931 3300025924 Bacteria 1939
127 Ga0207694_10479392 3300025924 Bacteria 1040
128 Ga0207659_11401508 3300025926 Bacteria 599
129 Ga0207700_10440874 3300025928 Bacteria 1146
130 Ga0207700_11853409 3300025928 Bacteria 529
131 Ga0207664_10395910 3300025929 Bacteria 1228
132 Ga0207664_11599173 3300025929 Bacteria 574
133 Ga0207690_11613359 3300025932 Bacteria 542
134 Ga0207706_11344072 3300025933 Bacteria 589
135 Ga0207670_11478477 3300025936 Bacteria 577
136 Ga0207669_11004697 3300025937 Bacteria 701
137 Ga0207665_10117110 3300025939 Bacteria 1878
138 Ga0207711_10827891 3300025941 Bacteria 862
139 Ga0207689_10174995 3300025942 Bacteria 1770
140 Ga0207689_10991040 3300025942 Bacteria 709
141 Ga0207679_12191708 3300025945 Bacteria 501
142 Ga0207667_10030723 3300025949 Bacteria 5806
143 Ga0207712_10149716 3300025961 Bacteria 1801
144 Ga0207712_11056651 3300025961 Bacteria 722
145 Ga0207668_10016231 3300025972 Bacteria 4644
146 Ga0207668_10855880 3300025972 Bacteria 807
147 Ga0207639_12232549 3300026041 Bacteria 509
148 Ga0207678_11473408 3300026067 Bacteria 601
149 Ga0207708_10357922 3300026075 Bacteria 1199
150 Ga0207702_10938854 3300026078 Bacteria 858
151 Ga0207641_11678355 3300026088 Bacteria 637
152 Ga0207683_10678190 3300026121 Bacteria 955
153 Ga0207683_11572262 3300026121 Bacteria 607
154 Ga0207683_11668307 3300026121 Bacteria 587
155 Ga0209179_1056531 3300027512 Bacteria 848
156 Ga0209999_1113631 3300027543 Bacteria 530
157 Ga0209970_1112559 3300027614 Bacteria 524
158 Ga0209998_10101971 3300027717 Bacteria 711
159 Ga0207428_10403211 3300027907 Bacteria 1001
160 Ga0268266_10501028 3300028379 Bacteria 1159
161 Ga0268266_10618595 3300028379 Bacteria 1041
162 Ga0268266_10631983 3300028379 Bacteria 1030
163 Ga0268266_12255247 3300028379 Bacteria 516
164 Ga0268264_10828255 3300028381 Bacteria 926
165 Ga0265330_10432158 3300031235 Bacteria 558
166 Ga0265328_10000011 3300031239 Bacteria 161717
167 Ga0265328_10000166 3300031239 Bacteria 30372
168 Ga0265328_10001180 3300031239 Bacteria 12085
169 Ga0265328_10014742 3300031239 Bacteria 3072
170 Ga0265328_10022938 3300031239 Bacteria 2369
171 Ga0265328_10148447 3300031239 Bacteria 881
172 Ga0265328_10166134 3300031239 Bacteria 833
173 Ga0265329_10073862 3300031242 Bacteria 1079
174 Ga0265340_10323262 3300031247 Bacteria 683
175 Ga0265331_10000005 3300031250 Bacteria 465192
176 Ga0265331_10002904 3300031250 Bacteria 11326
177 Ga0265331_10003511 3300031250 Bacteria 10091
178 Ga0265331_10592224 3300031250 Bacteria 501
179 Ga0265327_10013348 3300031251 Bacteria 5461
180 Ga0265327_10074553 3300031251 Bacteria 1690
181 Ga0265316_10002500 3300031344 Bacteria 19043
182 Ga0265316_10023877 3300031344 Bacteria 5134
183 Ga0265316_10558455 3300031344 Bacteria 814
184 Ga0307408_101894124 3300031548 Bacteria 572
185 Ga0307405_10065028 3300031731 Bacteria 2320
186 Ga0307405_10816077 3300031731 Bacteria 783
187 Ga0307413_10544227 3300031824 Bacteria 940
188 Ga0307413_11063270 3300031824 Bacteria 697
189 Ga0307410_10099610 3300031852 Bacteria 2081
190 Ga0307410_10982197 3300031852 Bacteria 727
191 Ga0307406_10121555 3300031901 Bacteria 1817
192 Ga0307406_10200053 3300031901 Bacteria 1470
193 Ga0307407_10106947 3300031903 Bacteria 1749
194 Ga0307407_11542533 3300031903 Bacteria 526
195 Ga0307412_10132568 3300031911 Bacteria 1812
196 Ga0307412_11177189 3300031911 Bacteria 685
197 Ga0307409_100192035 3300031995 Bacteria 1819
198 Ga0307409_100299000 3300031995 Bacteria 1496
199 Ga0307414_10053293 3300032004 Bacteria 2820
200 Ga0307414_10064110 3300032004 Bacteria 2614
201 Ga0307414_10080182 3300032004 Bacteria 2386
202 Ga0307414_10234058 3300032004 Bacteria 1516
203 Ga0307414_10286456 3300032004 Bacteria 1387
204 Ga0307414_11006032 3300032004 Bacteria 767
205 Ga0307415_100411299 3300032126 Bacteria 1158
206 Ga0307415_100669509 3300032126 Bacteria 933
207 Ga0307510_10154198 3300033180 Bacteria 1908
208 Ga0307510_10589341 3300033180 Bacteria 562
209 Ga0373926_0443535 3300035083 Bacteria 515
210 Ga0373934_0099840 3300035086 Bacteria 1174
211 Ga0373923_0001014 3300035111 Bacteria 7618
212 Ga0373936_0007038 3300035113 Bacteria 4232
213 Ga0373941_0345797 3300035115 Bacteria 604
214 Ga0373945_0001691 3300035116 Bacteria 6794
215 Ga0373953_0211986 3300035117 Bacteria 838
216 Ga0373956_0133044 3300035119 Bacteria 1165
217 Ga0373957_0015098 3300035120 Bacteria 2652
218 Ga0373943_0005855 3300035170 Bacteria 5521
219 Ga0373946_0007871 3300035171 Bacteria 3912
220 Ga0373955_0001221 3300035172 Bacteria 10920
221 Ga0373924_0000296 3300035410 Bacteria 15383
222 Ga0373931_1067315 3300035691 Bacteria 549
223 Ga0373935_0003708 3300035692 Bacteria 8915
224 Ga0373927_0006337 3300035695 Bacteria 8062
225 Ga0373927_0063289 3300035695 Bacteria 2393
226 Ga0373933_0036258 3300035724 Bacteria 2885
227 Ga0373933_0184590 3300035724 Bacteria 1331
228 Ga0373947_0028036 3300035725 Bacteria 3298
229 Ga0373947_0193800 3300035725 Bacteria 1327
230 Ga0373947_0930011 3300035725 Bacteria 593
231 Ga0373937_0000058 3300036401 Bacteria 99025
232 Ga0373937_0486704 3300036401 Bacteria 1172
233 Ga0373925_0000036 3300037068 Bacteria 143388
234 Ga0373925_0295421 3300037068 Bacteria 1307
235 Ga0373925_0417266 3300037068 Bacteria 1096
236 Ga0395899_0000124 3300037312 Bacteria 122011
237 Ga0395900_0000086 3300037418 Bacteria 171749
238 Ga0395898_0000285 3300037466 Bacteria 122279
239 Ga0395905_0000133 3300037471 Bacteria 123500
240 Ga0436364_0802173 3300037853 Bacteria 2093
241 Ga0436364_0821832 3300037853 Bacteria 1103
242 Ga0436364_1440221 3300037853 Bacteria 1878
243 Ga0395901_0000092 3300038443 Bacteria 121976
244 Ga0436360_0151660 3300039438 Bacteria 2891
245 Ga0436360_0214789 3300039438 Bacteria 10979
246 Ga0436360_0383424 3300039438 Bacteria 558
247 Ga0436361_0030309 3300039447 Bacteria 1019
248 Ga0436361_0091108 3300039447 Bacteria 9141
249 Ga0436361_0249653 3300039447 Bacteria 584
250 Ga0436361_0395817 3300039447 Bacteria 828
251 Ga0436361_0940185 3300039447 Bacteria 2110
252 Ga0436363_0258137 3300039450 Bacteria 5367
253 Ga0436363_1410280 3300039450 Bacteria 536
254 Ga0436363_1540361 3300039450 Bacteria 1105
255 Ga0436362_0831602 3300039453 Bacteria 2467
256 Ga0439465_0080440 3300041413 Bacteria 1104
257 Ga0439465_0131130 3300041413 Bacteria 885
258 Ga0451791_1389321 3300041451 Bacteria 731
259 Ga0451797_0134859 3300041453 Bacteria 864
260 Ga0451807_1126454 3300041486 Bacteria 669
261 Ga0451835_0105891 3300041492 Bacteria 811
262 Ga0451837_0632021 3300041494 Bacteria 515
263 Ga0451841_0848273 3300041498 Bacteria 503
264 Ga0451851_1035382 3300041507 Bacteria 534
265 Ga0439451_134127 3300042009 Bacteria 506
266 Ga0450896_071996 3300042133 Bacteria 574
267 Ga0439435_0027232 3300042436 Bacteria 1528
268 Ga0439459_0150750 3300042438 Bacteria 608
269 Ga0466963_0217147 3300044694 Bacteria 1339
270 Ga0466970_0329766 3300044765 Bacteria 864
271 Ga0466960_0492852 3300044901 Bacteria 717
272 Ga0466960_0938890 3300044901 Bacteria 529
273 Ga0466967_0055010 3300045976 Bacteria 3505
274 Ga0495592_0000232 3300046454 Bacteria 48214
275 Ga0495629_0015449 3300046459 Bacteria 5482
276 Ga0495651_0001333 3300046462 Bacteria 19125
277 Ga0495653_0000069 3300046463 Bacteria 89715
278 Ga0495653_0724221 3300046463 Bacteria 603
279 Ga0495662_0000613 3300046476 Bacteria 16534
280 Ga0495664_0000010 3300046477 Bacteria 268381
281 Ga0495608_0000008 3300046511 Bacteria 268629
282 Ga0495618_0000002 3300046514 Bacteria 271353
283 Ga0495618_0931264 3300046514 Bacteria 500
284 Ga0495628_0000009 3300046516 Bacteria 237611
285 Ga0495630_0001382 3300046517 Bacteria 16742
286 Ga0495652_0000011 3300046529 Bacteria 255329
287 Ga0495665_0433079 3300046531 Bacteria 665
288 Ga0495640_0000009 3300046533 Bacteria 217086
289 Ga0495586_0070794 3300046535 Bacteria 1905
290 Ga0495587_0000006 3300046536 Bacteria 310070
291 Ga0495597_0173004 3300046542 Bacteria 876
292 Ga0495645_0000010 3300046543 Bacteria 238337
293 Ga0495667_0000005 3300046559 Bacteria 268252
294 Ga0495634_0000055 3300046642 Bacteria 89761
295 Ga0495634_0784656 3300046642 Bacteria 544
296 Ga0495635_0000008 3300046663 Bacteria 268349
297 Ga0495657_0000470 3300046675 Bacteria 37809
298 Ga0495599_0000250 3300046678 Bacteria 34000
299 Ga0495623_0000004 3300046679 Bacteria 142249
300 Ga0495646_0000040 3300046680 Bacteria 71368
301 Ga0495658_0129564 3300046683 Bacteria 1534
302 Ga0495613_0015318 3300046689 Bacteria 5699
303 Ga0495613_1112353 3300046689 Bacteria 504
304 Ga0495624_0323144 3300046690 Bacteria 929
305 Ga0495600_0000080 3300046809 Bacteria 53421
306 Ga0495581_0004214 3300047315 Bacteria 8287
307 Ga0495604_0000012 3300047317 Bacteria 268341
308 Ga0495674_0000011 3300047319 Bacteria 270911
309 Ga0495680_0001797 3300047322 Bacteria 22695
310 Ga0495675_0000468 3300047444 Bacteria 26603
311 Ga0495684_0000014 3300047471 Bacteria 172111
312 Ga0495686_0119132 3300047472 Bacteria 1575
313 Ga0495686_0199323 3300047472 Bacteria 1150
314 Ga0495602_0000019 3300048088 Bacteria 170922
315 Ga0496102_0694252 3300048905 Bacteria 941
316 Ga0496104_0568607 3300048907 Bacteria 1044
317 Ga0496104_0953271 3300048907 Bacteria 762
318 Ga0496106_0606778 3300048909 Bacteria 876
319 Ga0496107_0196996 3300048910 Bacteria 1497
320 Ga0496110_0479201 3300048913 Bacteria 1133
321 Ga0496111_0039076 3300048914 Bacteria 3401
322 Ga0496112_0720732 3300048915 Bacteria 925
323 Ga0496115_0032671 3300048918 Bacteria 4106
324 Ga0496117_0369575 3300048920 Bacteria 734
325 Ga0496121_0195175 3300048924 Bacteria 1448
326 Ga0496124_0065640 3300048927 Bacteria 3025
327 Ga0496124_0132225 3300048927 Bacteria 1981
328 Ga0496124_0141398 3300048927 Bacteria 1899
329 Ga0496125_0000585 3300048928 Bacteria 62191
330 Ga0496125_0182391 3300048928 Bacteria 1397
331 Ga0496125_0763379 3300048928 Bacteria 505
332 Ga0496126_0125563 3300048929 Bacteria 2221
333 Ga0496126_0360563 3300048929 Bacteria 1187
334 Ga0496126_0373953 3300048929 Bacteria 1161
335 Ga0496126_0409581 3300048929 Bacteria 1098
336 Ga0501031_0023934 3300049568 Bacteria 3982
337 Ga0501031_0175296 3300049568 Bacteria 1401
338 Ga0501031_0210555 3300049568 Bacteria 1267
339 Ga0501032_0452937 3300049569 Bacteria 822
340 Ga0501032_0768316 3300049569 Bacteria 609
341 Ga0501033_0909637 3300049570 Bacteria 591
342 Ga0501034_0021888 3300049571 Bacteria 6514
343 Ga0501034_0026667 3300049571 Bacteria 5880
344 Ga0501034_0040959 3300049571 Bacteria 4687
345 Ga0501034_0045765 3300049571 Bacteria 4420
346 Ga0501034_0076667 3300049571 Bacteria 3349
347 Ga0501034_0103478 3300049571 Bacteria 2841
348 Ga0501034_0478636 3300049571 Bacteria 1160
349 Ga0501034_0955348 3300049571 Bacteria 743
350 Ga0501036_0055438 3300049572 Bacteria 3358
351 Ga0501036_0240626 3300049572 Bacteria 1518
352 Ga0501037_0017162 3300049573 Bacteria 5328
353 Ga0501038_0584888 3300049574 Bacteria 846
354 Ga0501038_1037051 3300049574 Bacteria 601
355 Ga0501038_1150317 3300049574 Bacteria 565
356 Ga0501039_0012570 3300049575 Bacteria 6468
357 Ga0501039_0389727 3300049575 Bacteria 1094
358 Ga0501040_0131506 3300049576 Bacteria 1760
359 Ga0501040_0379576 3300049576 Bacteria 1014
360 Ga0501041_0049444 3300049577 Bacteria 2561
361 Ga0501042_0118234 3300049578 Bacteria 1908
362 Ga0501046_0077349 3300049580 Bacteria 2576
363 Ga0501046_1161550 3300049580 Bacteria 532
364 Ga0501047_1009876 3300049581 Bacteria 645
365 Ga0501047_1012271 3300049581 Bacteria 644
366 Ga0501048_1068638 3300049582 Bacteria 581
367 Ga0501070_0632125 3300049586 Bacteria 851
368 Ga0501071_0079673 3300049587 Bacteria 2395
369 Ga0501072_0045738 3300049588 Bacteria 3443
370 Ga0501073_0134193 3300049589 Bacteria 1716
371 Ga0501073_0648692 3300049589 Bacteria 729
372 Ga0501074_0167264 3300049590 Bacteria 1570
373 Ga0501074_0457150 3300049590 Bacteria 905
374 Ga0501074_1049820 3300049590 Bacteria 573
375 Ga0501075_1050926 3300049591 Bacteria 619
376 Ga0501076_0886665 3300049592 Bacteria 736
377 Ga0501076_0962583 3300049592 Bacteria 703
378 Ga0501077_0029581 3300049593 Bacteria 3483
379 Ga0501077_0487364 3300049593 Bacteria 790
380 Ga0501077_0954839 3300049593 Bacteria 552
381 Ga0501079_0044702 3300049741 Bacteria 3418
382 Ga0501080_0002834 3300049742 Bacteria 15237
383 Ga0501080_0596037 3300049742 Bacteria 981
384 Ga0501081_0207875 3300049743 Bacteria 1421
385 Ga0501083_0205315 3300049744 Bacteria 1285
386 Ga0501035_0183987 3300049822 Bacteria 1799
387 Ga0501044_0081280 3300049823 Bacteria 3281
388 Ga0501044_0152542 3300049823 Bacteria 2292
389 Ga0501044_0578456 3300049823 Bacteria 1018
390 Ga0501044_0927579 3300049823 Bacteria 745
391 Ga0501045_0158791 3300049824 Bacteria 1683
392 nmdc:mga03683_26432_c1 3300050489 Bacteria 2290
393 nmdc:mga03n38_316828_c1 3300050490 Bacteria 841
394 nmdc:mga03n38_319963_c1 3300050490 Bacteria 837
395 nmdc:mga00v17_684282_c1 3300050491 Bacteria 658
396 nmdc:mga00v17_688726_c1 3300050491 Bacteria 656
397 nmdc:mga0k408_131477_c1 3300050493 Bacteria 1486
398 nmdc:mga0k408_717491_c1 3300050493 Bacteria 585
399 nmdc:mga06z11_134833_c1 3300050494 Bacteria 1390
400 nmdc:mga06z11_71097_c1 3300050494 Bacteria 1841
401 nmdc:mga06z11_826957_c1 3300050494 Bacteria 564
402 nmdc:mga05p37_1271650_c1 3300050507 Bacteria 753
403 nmdc:mga05p37_499019_c1 3300050507 Bacteria 1397
404 nmdc:mga0qj67_793704_c1 3300050509 Bacteria 750
405 nmdc:mga06r32_207578_c1 3300050510 Bacteria 1947
406 nmdc:mga08y16_1616987_c1 3300050511 Bacteria 605
407 nmdc:mga08y16_653060_c1 3300050511 Bacteria 1056
408 nmdc:mga08y16_696148_c1 3300050511 Bacteria 1016
409 nmdc:mga0n895_151036_c1 3300050512 Bacteria 2353
410 nmdc:mga0n895_19362_c1 3300050512 Bacteria 6325
411 nmdc:mga0n895_255878_c1 3300050512 Bacteria 1777
412 nmdc:mga0rr50_38938_c1 3300050513 Bacteria 3445
413 nmdc:mga0rr50_420048_c1 3300050513 Bacteria 1131
414 nmdc:mga08x19_2300_c1 3300050514 Bacteria 11611
415 nmdc:mga0sz30_356712_c1 3300050516 Bacteria 654
416 Ga0495601_0000009 3300053077 Bacteria 270622
417 Ga0495601_0967940 3300053077 Bacteria 536
418 Ga0495612_0000021 3300053078 Bacteria 130528
419 Ga0495595_0000067 3300053084 Bacteria 51316
420 Ga0495619_0000012 3300053085 Bacteria 268349
421 Ga0500650_0041275 3300053098 Bacteria 2130
422 Ga0500555_004824 3300053103 Bacteria 3828
423 Ga0500593_278252 3300053117 Bacteria 549
424 Ga0500588_0000448 3300053146 Bacteria 6500
425 Ga0500604_0001259 3300053151 Bacteria 7076
426 Ga0500616_0009459 3300053153 Bacteria 5928
427 Ga0500616_0151512 3300053153 Bacteria 1073
428 Ga0500634_0000005 3300053161 Bacteria 184092
429 Ga0500609_010992 3300053731 Bacteria 1223
430 Ga0501084_0460550 3300054114 Bacteria 1075
431 Ga0501082_0441920 3300060353 Bacteria 1136
432 Ga0530510_0269799 3300061734 Bacteria 1270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513237087 2513591413 69
2 iso_pu_bacteria 2523231067 2523470055 69
3 iso_pu_bacteria 2671180139 2671691846 69
4 iso_pu_bacteria 2828305725 2828308020 69
5 iso_pu_bacteria 2891088606 2891091674 69
6 iso_pu_bacteria 2909042592 2909046550 69
7 iso_pu_bacteria 8002060224 8002061669 69
8 iso_pu_bacteria 8054563764 8054564762 69
9 3300042438 Ga0439459_0150750 Ga0439459_0150750_179_403 71
10 3300053153 Ga0500616_0009459 Ga0500616_0009459_3492_3716 71
11 iso_pu_bacteria 2775506901 2776262268 71
12 iso_pu_bacteria 2884298095 2884298915 71
13 3300014326 Ga0157380_11301549 Ga0157380_113015492 72
14 3300025923 Ga0207681_10430982 Ga0207681_104309823 72
15 3300025942 Ga0207689_10991040 Ga0207689_109910402 72
16 3300026075 Ga0207708_10357922 Ga0207708_103579222 72
17 3300027614 Ga0209970_1112559 Ga0209970_11125591 72
18 3300027717 Ga0209998_10101971 Ga0209998_101019712 72
19 3300031852 Ga0307410_10982197 Ga0307410_109821972 72
20 3300032126 Ga0307415_100669509 Ga0307415_1006695092 72
21 3300049571 Ga0501034_0103478 Ga0501034_0103478_2153_2374 72
22 3300049593 Ga0501077_0029581 Ga0501077_0029581_2752_2973 72
23 3300049742 Ga0501080_0002834 Ga0501080_0002834_12776_12997 72
24 3300049744 Ga0501083_0205315 Ga0501083_0205315_668_889 72
25 3300054114 Ga0501084_0460550 Ga0501084_0460550_88_309 72
26 3300003578 Ga0006562J51391_1020821 Ga0006562J51391_10208211 73
27 3300005295 Ga0065707_10981197 Ga0065707_109811971 73
28 3300005328 Ga0070676_10325144 Ga0070676_103251442 73
29 3300005329 Ga0070683_100094865 Ga0070683_1000948652 73
30 3300005334 Ga0068869_101226667 Ga0068869_1012266671 73
31 3300005344 Ga0070661_100419355 Ga0070661_1004193552 73
32 3300005347 Ga0070668_100177491 Ga0070668_1001774912 73
33 3300005353 Ga0070669_100293534 Ga0070669_1002935342 73
34 3300005354 Ga0070675_100645788 Ga0070675_1006457881 73
35 3300005356 Ga0070674_100601432 Ga0070674_1006014322 73
36 3300005356 Ga0070674_101547831 Ga0070674_1015478312 73
37 3300005356 Ga0070674_102171782 Ga0070674_1021717822 73
38 3300005364 Ga0070673_100179007 Ga0070673_1001790072 73
39 3300005365 Ga0070688_100860061 Ga0070688_1008600612 73
40 3300005366 Ga0070659_101157825 Ga0070659_1011578251 73
41 3300005434 Ga0070709_11787606 Ga0070709_117876061 73
42 3300005435 Ga0070714_101431747 Ga0070714_1014317471 73
43 3300005435 Ga0070714_102397243 Ga0070714_1023972431 73
44 3300005436 Ga0070713_100291403 Ga0070713_1002914033 73
45 3300005436 Ga0070713_100357820 Ga0070713_1003578202 73
46 3300005436 Ga0070713_100483057 Ga0070713_1004830572 73
47 3300005436 Ga0070713_100868103 Ga0070713_1008681031 73
48 3300005441 Ga0070700_101312299 Ga0070700_1013122992 73
49 3300005455 Ga0070663_100768233 Ga0070663_1007682332 73
50 3300005455 Ga0070663_100942413 Ga0070663_1009424131 73
51 3300005459 Ga0068867_100195101 Ga0068867_1001951013 73
52 3300005548 Ga0070665_101317518 Ga0070665_1013175181 73
53 3300005563 Ga0068855_100036376 Ga0068855_1000363766 73
54 3300005564 Ga0070664_101434138 Ga0070664_1014341382 73
55 3300005937 Ga0081455_10021063 Ga0081455_100210636 73
56 3300005983 Ga0081540_1181393 Ga0081540_11813931 73
57 3300005985 Ga0081539_10004224 Ga0081539_100042245 73
58 3300006028 Ga0070717_10329482 Ga0070717_103294822 73
59 3300006028 Ga0070717_11053816 Ga0070717_110538162 73
60 3300006028 Ga0070717_11346145 Ga0070717_113461451 73
61 3300006028 Ga0070717_11761153 Ga0070717_117611532 73
62 3300006038 Ga0075365_10093852 Ga0075365_100938524 73
63 3300006042 Ga0075368_10021510 Ga0075368_100215102 73
64 3300006048 Ga0075363_100001280 Ga0075363_1000012809 73
65 3300006048 Ga0075363_100012816 Ga0075363_1000128162 73
66 3300006051 Ga0075364_10026098 Ga0075364_100260982 73
67 3300006051 Ga0075364_10047200 Ga0075364_100472002 73
68 3300006051 Ga0075364_10490397 Ga0075364_104903972 73
69 3300006051 Ga0075364_10773259 Ga0075364_107732592 73
70 3300006051 Ga0075364_11008844 Ga0075364_110088441 73
71 3300006163 Ga0070715_10486043 Ga0070715_104860432 73
72 3300006173 Ga0070716_100651346 Ga0070716_1006513461 73
73 3300006175 Ga0070712_100698054 Ga0070712_1006980542 73
74 3300006177 Ga0075362_10027127 Ga0075362_100271272 73
75 3300006178 Ga0075367_10059715 Ga0075367_100597152 73
76 3300006178 Ga0075367_10194006 Ga0075367_101940062 73
77 3300006178 Ga0075367_10604619 Ga0075367_106046191 73
78 3300006178 Ga0075367_10646134 Ga0075367_106461342 73
79 3300006178 Ga0075367_10655372 Ga0075367_106553721 73
80 3300006186 Ga0075369_10008685 Ga0075369_100086853 73
81 3300006186 Ga0075369_10189454 Ga0075369_101894541 73
82 3300006186 Ga0075369_10538704 Ga0075369_105387042 73
83 3300006195 Ga0075366_10000720 Ga0075366_100007208 73
84 3300006195 Ga0075366_10030503 Ga0075366_100305034 73
85 3300006195 Ga0075366_10162392 Ga0075366_101623922 73
86 3300006195 Ga0075366_10267912 Ga0075366_102679122 73
87 3300006353 Ga0075370_10030097 Ga0075370_100300974 73
88 3300006353 Ga0075370_11030268 Ga0075370_110302682 73
89 3300006844 Ga0075428_100079977 Ga0075428_1000799773 73
90 3300006844 Ga0075428_102291121 Ga0075428_1022911212 73
91 3300006846 Ga0075430_100479711 Ga0075430_1004797111 73
92 3300006847 Ga0075431_100632301 Ga0075431_1006323012 73
93 3300006847 Ga0075431_101504948 Ga0075431_1015049481 73
94 3300006871 Ga0075434_100026307 Ga0075434_1000263074 73
95 3300006871 Ga0075434_100090272 Ga0075434_1000902722 73
96 3300006880 Ga0075429_101746949 Ga0075429_1017469491 73
97 3300006914 Ga0075436_100119606 Ga0075436_1001196062 73
98 3300007076 Ga0075435_100685754 Ga0075435_1006857542 73
99 3300009093 Ga0105240_10124692 Ga0105240_101246923 73
100 3300009093 Ga0105240_10347259 Ga0105240_103472592 73
101 3300009094 Ga0111539_10345345 Ga0111539_103453452 73
102 3300009094 Ga0111539_10934981 Ga0111539_109349812 73
103 3300009094 Ga0111539_11244298 Ga0111539_112442982 73
104 3300009098 Ga0105245_10476254 Ga0105245_104762542 73
105 3300009147 Ga0114129_11760018 Ga0114129_117600182 73
106 3300009147 Ga0114129_12014667 Ga0114129_120146671 73
107 3300009147 Ga0114129_12398129 Ga0114129_123981292 73
108 3300009147 Ga0114129_12689640 Ga0114129_126896402 73
109 3300009147 Ga0114129_12718478 Ga0114129_127184781 73
110 3300009148 Ga0105243_12748593 Ga0105243_127485932 73
111 3300009176 Ga0105242_13111617 Ga0105242_131116171 73
112 3300009545 Ga0105237_10133071 Ga0105237_101330713 73
113 3300009545 Ga0105237_10260172 Ga0105237_102601722 73
114 3300009551 Ga0105238_10753547 Ga0105238_107535471 73
115 3300009553 Ga0105249_10151762 Ga0105249_101517622 73
116 3300009553 Ga0105249_10368271 Ga0105249_103682712 73
117 3300009553 Ga0105249_13360486 Ga0105249_133604862 73
118 3300010159 Ga0099796_10027854 Ga0099796_100278541 73
119 3300010375 Ga0105239_12993807 Ga0105239_129938071 73
120 3300011119 Ga0105246_10440956 Ga0105246_104409562 73
121 3300013104 Ga0157370_10499979 Ga0157370_104999791 73
122 3300013104 Ga0157370_11072718 Ga0157370_110727182 73
123 3300013296 Ga0157374_12230399 Ga0157374_122303991 73
124 3300013297 Ga0157378_12956277 Ga0157378_129562771 73
125 3300013306 Ga0163162_11891810 Ga0163162_118918102 73
126 3300013307 Ga0157372_11266819 Ga0157372_112668192 73
127 3300013307 Ga0157372_12070223 Ga0157372_120702232 73
128 3300013308 Ga0157375_11527563 Ga0157375_115275632 73
129 3300014325 Ga0163163_10003165 Ga0163163_100031656 73
130 3300014325 Ga0163163_12495913 Ga0163163_124959132 73
131 3300014326 Ga0157380_10310878 Ga0157380_103108782 73
132 3300014326 Ga0157380_10982616 Ga0157380_109826161 73
133 3300014326 Ga0157380_12071127 Ga0157380_120711272 73
134 3300014326 Ga0157380_12266060 Ga0157380_122660602 73
135 3300014745 Ga0157377_11167621 Ga0157377_111676212 73
136 3300014968 Ga0157379_12399673 Ga0157379_123996731 73
137 3300021361 Ga0213872_10055505 Ga0213872_100555052 73
138 3300021361 Ga0213872_10064604 Ga0213872_100646043 73
139 3300021441 Ga0213871_10104167 Ga0213871_101041671 73
140 3300025905 Ga0207685_10597516 Ga0207685_105975161 73
141 3300025906 Ga0207699_10216035 Ga0207699_102160352 73
142 3300025906 Ga0207699_10566434 Ga0207699_105664341 73
143 3300025913 Ga0207695_10381412 Ga0207695_103814122 73
144 3300025914 Ga0207671_10325256 Ga0207671_103252562 73
145 3300025914 Ga0207671_10778866 Ga0207671_107788661 73
146 3300025915 Ga0207693_10391791 Ga0207693_103917912 73
147 3300025923 Ga0207681_10490671 Ga0207681_104906712 73
148 3300025923 Ga0207681_11556045 Ga0207681_115560451 73
149 3300025924 Ga0207694_10140931 Ga0207694_101409311 73
150 3300025924 Ga0207694_10479392 Ga0207694_104793922 73
151 3300025926 Ga0207659_11401508 Ga0207659_114015082 73
152 3300025928 Ga0207700_10440874 Ga0207700_104408742 73
153 3300025928 Ga0207700_11853409 Ga0207700_118534092 73
154 3300025929 Ga0207664_10395910 Ga0207664_103959101 73
155 3300025929 Ga0207664_11599173 Ga0207664_115991731 73
156 3300025932 Ga0207690_11613359 Ga0207690_116133591 73
157 3300025933 Ga0207706_11344072 Ga0207706_113440721 73
158 3300025936 Ga0207670_11478477 Ga0207670_114784772 73
159 3300025937 Ga0207669_11004697 Ga0207669_110046972 73
160 3300025939 Ga0207665_10117110 Ga0207665_101171102 73
161 3300025941 Ga0207711_10827891 Ga0207711_108278912 73
162 3300025942 Ga0207689_10174995 Ga0207689_101749952 73
163 3300025945 Ga0207679_12191708 Ga0207679_121917082 73
164 3300025949 Ga0207667_10030723 Ga0207667_100307232 73
165 3300025961 Ga0207712_10149716 Ga0207712_101497162 73
166 3300025961 Ga0207712_11056651 Ga0207712_110566512 73
167 3300025972 Ga0207668_10016231 Ga0207668_100162317 73
168 3300025972 Ga0207668_10855880 Ga0207668_108558802 73
169 3300026041 Ga0207639_12232549 Ga0207639_122325491 73
170 3300026067 Ga0207678_11473408 Ga0207678_114734082 73
171 3300026078 Ga0207702_10938854 Ga0207702_109388541 73
172 3300026088 Ga0207641_11678355 Ga0207641_116783552 73
173 3300026121 Ga0207683_10678190 Ga0207683_106781902 73
174 3300026121 Ga0207683_11572262 Ga0207683_115722621 73
175 3300026121 Ga0207683_11668307 Ga0207683_116683071 73
176 3300027512 Ga0209179_1056531 Ga0209179_10565312 73
177 3300027543 Ga0209999_1113631 Ga0209999_11136311 73
178 3300027907 Ga0207428_10403211 Ga0207428_104032112 73
179 3300028379 Ga0268266_10501028 Ga0268266_105010282 73
180 3300028379 Ga0268266_10618595 Ga0268266_106185952 73
181 3300028379 Ga0268266_10631983 Ga0268266_106319832 73
182 3300028379 Ga0268266_12255247 Ga0268266_122552471 73
183 3300028381 Ga0268264_10828255 Ga0268264_108282552 73
184 3300031235 Ga0265330_10432158 Ga0265330_104321581 73
185 3300031239 Ga0265328_10000011 Ga0265328_10000011120 73
186 3300031239 Ga0265328_10000166 Ga0265328_1000016629 73
187 3300031239 Ga0265328_10001180 Ga0265328_100011808 73
188 3300031239 Ga0265328_10014742 Ga0265328_100147424 73
189 3300031239 Ga0265328_10022938 Ga0265328_100229384 73
190 3300031239 Ga0265328_10148447 Ga0265328_101484472 73
191 3300031239 Ga0265328_10166134 Ga0265328_101661342 73
192 3300031242 Ga0265329_10073862 Ga0265329_100738622 73
193 3300031247 Ga0265340_10323262 Ga0265340_103232622 73
194 3300031250 Ga0265331_10000005 Ga0265331_10000005448 73
195 3300031250 Ga0265331_10002904 Ga0265331_1000290415 73
196 3300031250 Ga0265331_10003511 Ga0265331_100035115 73
197 3300031250 Ga0265331_10592224 Ga0265331_105922241 73
198 3300031251 Ga0265327_10013348 Ga0265327_100133488 73
199 3300031251 Ga0265327_10074553 Ga0265327_100745532 73
200 3300031344 Ga0265316_10002500 Ga0265316_1000250019 73
201 3300031344 Ga0265316_10023877 Ga0265316_100238773 73
202 3300031344 Ga0265316_10558455 Ga0265316_105584551 73
203 3300031548 Ga0307408_101894124 Ga0307408_1018941241 73
204 3300031731 Ga0307405_10065028 Ga0307405_100650282 73
205 3300031731 Ga0307405_10816077 Ga0307405_108160772 73
206 3300031824 Ga0307413_10544227 Ga0307413_105442272 73
207 3300031824 Ga0307413_11063270 Ga0307413_110632702 73
208 3300031852 Ga0307410_10099610 Ga0307410_100996102 73
209 3300031901 Ga0307406_10121555 Ga0307406_101215553 73
210 3300031901 Ga0307406_10200053 Ga0307406_102000532 73
211 3300031903 Ga0307407_10106947 Ga0307407_101069471 73
212 3300031903 Ga0307407_11542533 Ga0307407_115425331 73
213 3300031911 Ga0307412_10132568 Ga0307412_101325682 73
214 3300031911 Ga0307412_11177189 Ga0307412_111771892 73
215 3300031995 Ga0307409_100192035 Ga0307409_1001920352 73
216 3300031995 Ga0307409_100299000 Ga0307409_1002990001 73
217 3300032004 Ga0307414_10053293 Ga0307414_100532936 73
218 3300032004 Ga0307414_10064110 Ga0307414_100641101 73
219 3300032004 Ga0307414_10080182 Ga0307414_100801822 73
220 3300032004 Ga0307414_10234058 Ga0307414_102340582 73
221 3300032004 Ga0307414_10286456 Ga0307414_102864561 73
222 3300032004 Ga0307414_11006032 Ga0307414_110060322 73
223 3300032126 Ga0307415_100411299 Ga0307415_1004112991 73
224 3300033180 Ga0307510_10154198 Ga0307510_101541982 73
225 3300033180 Ga0307510_10589341 Ga0307510_105893411 73
226 3300035083 Ga0373926_0443535 Ga0373926_0443535_149_376 73
227 3300035086 Ga0373934_0099840 Ga0373934_0099840_70_300 73
228 3300035111 Ga0373923_0001014 Ga0373923_0001014_308_538 73
229 3300035113 Ga0373936_0007038 Ga0373936_0007038_3118_3348 73
230 3300035115 Ga0373941_0345797 Ga0373941_0345797_81_308 73
231 3300035116 Ga0373945_0001691 Ga0373945_0001691_5173_5403 73
232 3300035117 Ga0373953_0211986 Ga0373953_0211986_33_263 73
233 3300035119 Ga0373956_0133044 Ga0373956_0133044_561_791 73
234 3300035120 Ga0373957_0015098 Ga0373957_0015098_260_490 73
235 3300035170 Ga0373943_0005855 Ga0373943_0005855_5048_5278 73
236 3300035171 Ga0373946_0007871 Ga0373946_0007871_1732_1962 73
237 3300035172 Ga0373955_0001221 Ga0373955_0001221_2899_3129 73
238 3300035410 Ga0373924_0000296 Ga0373924_0000296_13695_13925 73
239 3300035691 Ga0373931_1067315 Ga0373931_1067315_53_283 73
240 3300035692 Ga0373935_0003708 Ga0373935_0003708_709_939 73
241 3300035695 Ga0373927_0006337 Ga0373927_0006337_5658_5888 73
242 3300035695 Ga0373927_0063289 Ga0373927_0063289_81_311 73
243 3300035724 Ga0373933_0036258 Ga0373933_0036258_1194_1424 73
244 3300035724 Ga0373933_0184590 Ga0373933_0184590_109_336 73
245 3300035725 Ga0373947_0028036 Ga0373947_0028036_1140_1370 73
246 3300035725 Ga0373947_0193800 Ga0373947_0193800_237_464 73
247 3300035725 Ga0373947_0930011 Ga0373947_0930011_338_568 73
248 3300036401 Ga0373937_0000058 Ga0373937_0000058_76390_76620 73
249 3300036401 Ga0373937_0486704 Ga0373937_0486704_621_848 73
250 3300037068 Ga0373925_0000036 Ga0373925_0000036_9444_9674 73
251 3300037068 Ga0373925_0295421 Ga0373925_0295421_1063_1290 73
252 3300037068 Ga0373925_0417266 Ga0373925_0417266_463_690 73
253 3300037312 Ga0395899_0000124 Ga0395899_0000124_7086_7307 73
254 3300037418 Ga0395900_0000086 Ga0395900_0000086_164443_164664 73
255 3300037466 Ga0395898_0000285 Ga0395898_0000285_7086_7307 73
256 3300037471 Ga0395905_0000133 Ga0395905_0000133_116194_116415 73
257 3300037853 Ga0436364_0802173 Ga0436364_0802173_1282_1512 73
258 3300037853 Ga0436364_0821832 Ga0436364_0821832_72_299 73
259 3300037853 Ga0436364_1440221 Ga0436364_1440221_372_602 73
260 3300038443 Ga0395901_0000092 Ga0395901_0000092_114670_114891 73
261 3300039438 Ga0436360_0151660 Ga0436360_0151660_1514_1777 73
262 3300039438 Ga0436360_0214789 Ga0436360_0214789_2987_3223 73
263 3300039438 Ga0436360_0383424 Ga0436360_0383424_118_351 73
264 3300039447 Ga0436361_0030309 Ga0436361_0030309_549_785 73
265 3300039447 Ga0436361_0091108 Ga0436361_0091108_1034_1267 73
266 3300039447 Ga0436361_0249653 Ga0436361_0249653_201_437 73
267 3300039447 Ga0436361_0395817 Ga0436361_0395817_367_594 73
268 3300039447 Ga0436361_0940185 Ga0436361_0940185_996_1226 73
269 3300039450 Ga0436363_0258137 Ga0436363_0258137_3584_3814 73
270 3300039450 Ga0436363_1410280 Ga0436363_1410280_64_297 73
271 3300039450 Ga0436363_1540361 Ga0436363_1540361_854_1084 73
272 3300039453 Ga0436362_0831602 Ga0436362_0831602_1947_2183 73
273 3300041413 Ga0439465_0080440 Ga0439465_0080440_11_232 73
274 3300041413 Ga0439465_0131130 Ga0439465_0131130_611_841 73
275 3300041451 Ga0451791_1389321 Ga0451791_1389321_321_542 73
276 3300041453 Ga0451797_0134859 Ga0451797_0134859_131_352 73
277 3300041486 Ga0451807_1126454 Ga0451807_1126454_67_288 73
278 3300041492 Ga0451835_0105891 Ga0451835_0105891_457_684 73
279 3300041494 Ga0451837_0632021 Ga0451837_0632021_269_490 73
280 3300041498 Ga0451841_0848273 Ga0451841_0848273_103_330 73
281 3300041507 Ga0451851_1035382 Ga0451851_1035382_90_311 73
282 3300042009 Ga0439451_134127 Ga0439451_134127_246_476 73
283 3300042133 Ga0450896_071996 Ga0450896_071996_302_553 73
284 3300042436 Ga0439435_0027232 Ga0439435_0027232_959_1207 73
285 3300044694 Ga0466963_0217147 Ga0466963_0217147_811_1038 73
286 3300044765 Ga0466970_0329766 Ga0466970_0329766_231_461 73
287 3300044901 Ga0466960_0492852 Ga0466960_0492852_143_385 73
288 3300044901 Ga0466960_0938890 Ga0466960_0938890_276_497 73
289 3300045976 Ga0466967_0055010 Ga0466967_0055010_1645_1872 73
290 3300046454 Ga0495592_0000232 Ga0495592_0000232_41971_42201 73
291 3300046459 Ga0495629_0015449 Ga0495629_0015449_4762_4992 73
292 3300046462 Ga0495651_0001333 Ga0495651_0001333_10000_10230 73
293 3300046463 Ga0495653_0000069 Ga0495653_0000069_7103_7333 73
294 3300046463 Ga0495653_0724221 Ga0495653_0724221_199_432 73
295 3300046476 Ga0495662_0000613 Ga0495662_0000613_12655_12885 73
296 3300046477 Ga0495664_0000010 Ga0495664_0000010_22395_22625 73
297 3300046511 Ga0495608_0000008 Ga0495608_0000008_246024_246254 73
298 3300046514 Ga0495618_0000002 Ga0495618_0000002_24668_24898 73
299 3300046514 Ga0495618_0931264 Ga0495618_0931264_162_392 73
300 3300046516 Ga0495628_0000009 Ga0495628_0000009_22423_22653 73
301 3300046517 Ga0495630_0001382 Ga0495630_0001382_8173_8403 73
302 3300046529 Ga0495652_0000011 Ga0495652_0000011_245714_245944 73
303 3300046531 Ga0495665_0433079 Ga0495665_0433079_44_274 73
304 3300046533 Ga0495640_0000009 Ga0495640_0000009_194466_194696 73
305 3300046535 Ga0495586_0070794 Ga0495586_0070794_452_682 73
306 3300046536 Ga0495587_0000006 Ga0495587_0000006_136141_136371 73
307 3300046542 Ga0495597_0173004 Ga0495597_0173004_145_366 73
308 3300046543 Ga0495645_0000010 Ga0495645_0000010_215087_215317 73
309 3300046559 Ga0495667_0000005 Ga0495667_0000005_22423_22653 73
310 3300046642 Ga0495634_0000055 Ga0495634_0000055_22411_22641 73
311 3300046642 Ga0495634_0784656 Ga0495634_0784656_47_274 73
312 3300046663 Ga0495635_0000008 Ga0495635_0000008_245697_245927 73
313 3300046675 Ga0495657_0000470 Ga0495657_0000470_24696_24926 73
314 3300046678 Ga0495599_0000250 Ga0495599_0000250_9075_9305 73
315 3300046679 Ga0495623_0000004 Ga0495623_0000004_58088_58318 73
316 3300046680 Ga0495646_0000040 Ga0495646_0000040_48716_48946 73
317 3300046683 Ga0495658_0129564 Ga0495658_0129564_1152_1382 73
318 3300046689 Ga0495613_0015318 Ga0495613_0015318_4386_4616 73
319 3300046689 Ga0495613_1112353 Ga0495613_1112353_133_360 73
320 3300046690 Ga0495624_0323144 Ga0495624_0323144_156_386 73
321 3300046809 Ga0495600_0000080 Ga0495600_0000080_22412_22642 73
322 3300047315 Ga0495581_0004214 Ga0495581_0004214_2688_2918 73
323 3300047317 Ga0495604_0000012 Ga0495604_0000012_22410_22640 73
324 3300047319 Ga0495674_0000011 Ga0495674_0000011_24696_24926 73
325 3300047322 Ga0495680_0001797 Ga0495680_0001797_15305_15535 73
326 3300047444 Ga0495675_0000468 Ga0495675_0000468_22404_22634 73
327 3300047471 Ga0495684_0000014 Ga0495684_0000014_22412_22642 73
328 3300047472 Ga0495686_0119132 Ga0495686_0119132_240_461 73
329 3300047472 Ga0495686_0199323 Ga0495686_0199323_287_514 73
330 3300048088 Ga0495602_0000019 Ga0495602_0000019_22388_22618 73
331 3300048905 Ga0496102_0694252 Ga0496102_0694252_58_285 73
332 3300048907 Ga0496104_0568607 Ga0496104_0568607_103_336 73
333 3300048907 Ga0496104_0953271 Ga0496104_0953271_520_750 73
334 3300048909 Ga0496106_0606778 Ga0496106_0606778_19_246 73
335 3300048910 Ga0496107_0196996 Ga0496107_0196996_748_981 73
336 3300048913 Ga0496110_0479201 Ga0496110_0479201_226_447 73
337 3300048914 Ga0496111_0039076 Ga0496111_0039076_2071_2292 73
338 3300048915 Ga0496112_0720732 Ga0496112_0720732_609_842 73
339 3300048918 Ga0496115_0032671 Ga0496115_0032671_3806_4039 73
340 3300048920 Ga0496117_0369575 Ga0496117_0369575_228_455 73
341 3300048924 Ga0496121_0195175 Ga0496121_0195175_1132_1359 73
342 3300048927 Ga0496124_0065640 Ga0496124_0065640_1306_1527 73
343 3300048927 Ga0496124_0132225 Ga0496124_0132225_1311_1532 73
344 3300048927 Ga0496124_0141398 Ga0496124_0141398_607_828 73
345 3300048928 Ga0496125_0000585 Ga0496125_0000585_36495_36716 73
346 3300048928 Ga0496125_0182391 Ga0496125_0182391_688_909 73
347 3300048928 Ga0496125_0763379 Ga0496125_0763379_115_336 73
348 3300048929 Ga0496126_0125563 Ga0496126_0125563_1535_1786 73
349 3300048929 Ga0496126_0360563 Ga0496126_0360563_12_233 73
350 3300048929 Ga0496126_0373953 Ga0496126_0373953_166_393 73
351 3300048929 Ga0496126_0409581 Ga0496126_0409581_442_663 73
352 3300049568 Ga0501031_0023934 Ga0501031_0023934_739_960 73
353 3300049568 Ga0501031_0175296 Ga0501031_0175296_1062_1298 73
354 3300049568 Ga0501031_0210555 Ga0501031_0210555_683_904 73
355 3300049569 Ga0501032_0452937 Ga0501032_0452937_415_636 73
356 3300049569 Ga0501032_0768316 Ga0501032_0768316_325_546 73
357 3300049570 Ga0501033_0909637 Ga0501033_0909637_32_253 73
358 3300049571 Ga0501034_0021888 Ga0501034_0021888_3153_3374 73
359 3300049571 Ga0501034_0026667 Ga0501034_0026667_3525_3746 73
360 3300049571 Ga0501034_0040959 Ga0501034_0040959_3491_3712 73
361 3300049571 Ga0501034_0045765 Ga0501034_0045765_30_251 73
362 3300049571 Ga0501034_0076667 Ga0501034_0076667_260_484 73
363 3300049571 Ga0501034_0478636 Ga0501034_0478636_779_1000 73
364 3300049571 Ga0501034_0955348 Ga0501034_0955348_476_697 73
365 3300049572 Ga0501036_0055438 Ga0501036_0055438_2199_2435 73
366 3300049572 Ga0501036_0240626 Ga0501036_0240626_1124_1345 73
367 3300049573 Ga0501037_0017162 Ga0501037_0017162_3402_3623 73
368 3300049574 Ga0501038_0584888 Ga0501038_0584888_432_668 73
369 3300049574 Ga0501038_1037051 Ga0501038_1037051_77_307 73
370 3300049574 Ga0501038_1150317 Ga0501038_1150317_302_523 73
371 3300049575 Ga0501039_0012570 Ga0501039_0012570_1154_1390 73
372 3300049575 Ga0501039_0389727 Ga0501039_0389727_730_951 73
373 3300049576 Ga0501040_0131506 Ga0501040_0131506_418_654 73
374 3300049576 Ga0501040_0379576 Ga0501040_0379576_402_623 73
375 3300049577 Ga0501041_0049444 Ga0501041_0049444_303_539 73
376 3300049578 Ga0501042_0118234 Ga0501042_0118234_779_1015 73
377 3300049580 Ga0501046_0077349 Ga0501046_0077349_1332_1568 73
378 3300049580 Ga0501046_1161550 Ga0501046_1161550_22_243 73
379 3300049581 Ga0501047_1009876 Ga0501047_1009876_321_542 73
380 3300049581 Ga0501047_1012271 Ga0501047_1012271_351_572 73
381 3300049582 Ga0501048_1068638 Ga0501048_1068638_78_302 73
382 3300049586 Ga0501070_0632125 Ga0501070_0632125_153_389 73
383 3300049587 Ga0501071_0079673 Ga0501071_0079673_1940_2176 73
384 3300049588 Ga0501072_0045738 Ga0501072_0045738_3204_3428 73
385 3300049589 Ga0501073_0134193 Ga0501073_0134193_1059_1292 73
386 3300049589 Ga0501073_0648692 Ga0501073_0648692_404_637 73
387 3300049590 Ga0501074_0167264 Ga0501074_0167264_1192_1428 73
388 3300049590 Ga0501074_0457150 Ga0501074_0457150_222_443 73
389 3300049590 Ga0501074_1049820 Ga0501074_1049820_35_259 73
390 3300049591 Ga0501075_1050926 Ga0501075_1050926_204_434 73
391 3300049592 Ga0501076_0886665 Ga0501076_0886665_415_651 73
392 3300049592 Ga0501076_0962583 Ga0501076_0962583_348_575 73
393 3300049593 Ga0501077_0487364 Ga0501077_0487364_129_365 73
394 3300049593 Ga0501077_0954839 Ga0501077_0954839_283_513 73
395 3300049741 Ga0501079_0044702 Ga0501079_0044702_533_769 73
396 3300049742 Ga0501080_0596037 Ga0501080_0596037_113_334 73
397 3300049743 Ga0501081_0207875 Ga0501081_0207875_178_414 73
398 3300049822 Ga0501035_0183987 Ga0501035_0183987_1176_1412 73
399 3300049823 Ga0501044_0081280 Ga0501044_0081280_639_860 73
400 3300049823 Ga0501044_0152542 Ga0501044_0152542_1217_1438 73
401 3300049823 Ga0501044_0578456 Ga0501044_0578456_383_604 73
402 3300049823 Ga0501044_0927579 Ga0501044_0927579_95_316 73
403 3300049824 Ga0501045_0158791 Ga0501045_0158791_846_1082 73
404 3300050489 nmdc:mga03683_26432_c1 nmdc:mga03683_26432_c1_2007_2231 73
405 3300050490 nmdc:mga03n38_316828_c1 nmdc:mga03n38_316828_c1_439_669 73
406 3300050490 nmdc:mga03n38_319963_c1 nmdc:mga03n38_319963_c1_545_766 73
407 3300050491 nmdc:mga00v17_684282_c1 nmdc:mga00v17_684282_c1_394_615 73
408 3300050491 nmdc:mga00v17_688726_c1 nmdc:mga00v17_688726_c1_142_363 73
409 3300050493 nmdc:mga0k408_131477_c1 nmdc:mga0k408_131477_c1_907_1137 73
410 3300050493 nmdc:mga0k408_717491_c1 nmdc:mga0k408_717491_c1_131_352 73
411 3300050494 nmdc:mga06z11_134833_c1 nmdc:mga06z11_134833_c1_1079_1303 73
412 3300050494 nmdc:mga06z11_71097_c1 nmdc:mga06z11_71097_c1_852_1082 73
413 3300050494 nmdc:mga06z11_826957_c1 nmdc:mga06z11_826957_c1_209_430 73
414 3300050507 nmdc:mga05p37_1271650_c1 nmdc:mga05p37_1271650_c1_224_445 73
415 3300050507 nmdc:mga05p37_499019_c1 nmdc:mga05p37_499019_c1_62_289 73
416 3300050509 nmdc:mga0qj67_793704_c1 nmdc:mga0qj67_793704_c1_119_346 73
417 3300050510 nmdc:mga06r32_207578_c1 nmdc:mga06r32_207578_c1_143_370 73
418 3300050511 nmdc:mga08y16_1616987_c1 nmdc:mga08y16_1616987_c1_100_330 73
419 3300050511 nmdc:mga08y16_653060_c1 nmdc:mga08y16_653060_c1_32_259 73
420 3300050511 nmdc:mga08y16_696148_c1 nmdc:mga08y16_696148_c1_197_433 73
421 3300050512 nmdc:mga0n895_151036_c1 nmdc:mga0n895_151036_c1_669_896 73
422 3300050512 nmdc:mga0n895_19362_c1 nmdc:mga0n895_19362_c1_3365_3592 73
423 3300050512 nmdc:mga0n895_255878_c1 nmdc:mga0n895_255878_c1_678_905 73
424 3300050513 nmdc:mga0rr50_38938_c1 nmdc:mga0rr50_38938_c1_2653_2880 73
425 3300050513 nmdc:mga0rr50_420048_c1 nmdc:mga0rr50_420048_c1_761_988 73
426 3300050514 nmdc:mga08x19_2300_c1 nmdc:mga08x19_2300_c1_10939_11166 73
427 3300050516 nmdc:mga0sz30_356712_c1 nmdc:mga0sz30_356712_c1_175_402 73
428 3300053077 Ga0495601_0000009 Ga0495601_0000009_245697_245927 73
429 3300053077 Ga0495601_0967940 Ga0495601_0967940_283_513 73
430 3300053078 Ga0495612_0000021 Ga0495612_0000021_22302_22532 73
431 3300053084 Ga0495595_0000067 Ga0495595_0000067_25382_25612 73
432 3300053085 Ga0495619_0000012 Ga0495619_0000012_245697_245927 73
433 3300053098 Ga0500650_0041275 Ga0500650_0041275_1573_1809 73
434 3300053103 Ga0500555_004824 Ga0500555_004824_3358_3579 73
435 3300053117 Ga0500593_278252 Ga0500593_278252_298_534 73
436 3300053146 Ga0500588_0000448 Ga0500588_0000448_5330_5566 73
437 3300053151 Ga0500604_0001259 Ga0500604_0001259_146_367 73
438 3300053153 Ga0500616_0151512 Ga0500616_0151512_707_928 73
439 3300053161 Ga0500634_0000005 Ga0500634_0000005_182985_183206 73
440 3300053731 Ga0500609_010992 Ga0500609_010992_882_1118 73
441 3300060353 Ga0501082_0441920 Ga0501082_0441920_366_602 73
442 3300061734 Ga0530510_0269799 Ga0530510_0269799_16_246 73

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01197

Ribosomal_L31

Ribosomal protein L31

12

80

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hk0-assembly1.cif.gz_B crystal structure of the ra and ph domains of grb10 0.9277 10 24
3hk0-assembly1.cif.gz_A crystal structure of the ra and ph domains of grb10 0.8765 10 24
6f07-assembly1.cif.gz_D cbf3 core complex 0.8539 11 24
6j62-assembly1.cif.gz_A crystal structure of misg15/ns1b complex 0.8253 10 23
6vjv-assembly2.cif.gz_B crystal structure of the prochlorococcus phage (myovirus p-ssm2) ferredoxin at 1.6 angstroms 0.8156 10 23
ID Description Score Start End Superfamily
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9761 11 23 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9711 11 23 3.10.20.30
af_Q9M0X0_1_69_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9686 11 24 3.10.20.90
af_K7V3Y6_198_315_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.9555 11 23 2.40.330.10
af_Q9FY81_1_79_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9496 11 24 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A4Q2XTS0-F1-model_v4 deleted 0.8555 1 38
AF-A0A4Q2YWP4-F1-model_v4 50S ribosomal protein L31 0.8378 1 42 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A4Q2XTS0-F1-model_v4 deleted 0.8359 1 38
AF-A0A376FEF3-F1-model_v4 50S ribosomal protein L31 0.8117 1 40 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A4Q2YWP4-F1-model_v4 50S ribosomal protein L31 0.8033 1 42 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
78.61 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map