F444922

General Info

Members Datasets Scaffolds Average Seq Length
442 251 436 255

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0022609|Ga0466969_0022609_504_1322
Length 272
Sequence MSRGPAILIRQAEAMARFSARRRWLRALVGGAGAMALAGCDRLSQDERVQATLRSAEKLTMGSQRLLLAHQPLAKEYGERDLSPRFRANGSTMPEDPEYRRLLQGRFADYRLRVDGLVRRPLALSLAELKALPARQQITRHDCVEGWSAIGKWQGVPLAQVLDLAGVRPGARYVIFHCADNLAGSADASGLYYESIDLLDAYHPQTILAYGMNGGDLPVPHGAPLRLRVERQLGYKQAKFVMRVEVADGFSRLHGGRGGFWEDRGYEWYAGI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
3 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
4 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
5 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
6 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
7 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
243 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
247 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
248 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.37
Nodule 0
Rhizoplane 6.11
Rhizosphere 75.57
Stem 0
Stem Tuber 0
Unclassified 9.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1374729 2162886007 Bacteria 6133
2 JGI24736J21556_1000471 3300001904 Bacteria 7533
3 JGI24740J21852_10001194 3300001979 Bacteria 11724
4 JGI24739J22299_10014105 3300001989 Bacteria 2910
5 JGI24737J22298_10004375 3300001990 Bacteria 4930
6 JGI24735J21928_10001449 3300002067 Bacteria 8389
7 JGI24738J21930_10002069 3300002075 Bacteria 5380
8 JGI24751J29686_10000273 3300002459 Bacteria 20099
9 JGI25156J39149_1000668 3300002705 Bacteria 18581
10 JGI25157J39369_1000204 3300002741 Bacteria 49470
11 Ga0055539_1000211 3300003752 Bacteria 43149
12 Ga0055539_1001077 3300003752 Bacteria 5779
13 Ga0055533_1000006 3300003756 Bacteria 635559
14 Ga0055525_1000760 3300003759 Bacteria 10704
15 Ga0055535_1000248 3300003761 Bacteria 57085
16 Ga0055529_1000300 3300003763 Bacteria 57085
17 Ga0065704_10072447 3300005289 Bacteria 8513
18 Ga0070658_10020815 3300005327 Bacteria 5256
19 Ga0070658_10064997 3300005327 Bacteria 2976
20 Ga0070658_10091100 3300005327 Bacteria 2513
21 Ga0070658_10233531 3300005327 Bacteria 1558
22 Ga0070683_100671165 3300005329 Bacteria 992
23 Ga0070690_100098782 3300005330 Bacteria 1933
24 Ga0070670_100017748 3300005331 Bacteria 6106
25 Ga0070670_100121139 3300005331 Bacteria 2257
26 Ga0070670_100386834 3300005331 Bacteria 1233
27 Ga0070666_10005583 3300005335 Bacteria 7716
28 Ga0070666_10020283 3300005335 Bacteria 4296
29 Ga0070660_100011131 3300005339 Bacteria 6380
30 Ga0070661_100038900 3300005344 Bacteria 3464
31 Ga0070668_100001975 3300005347 Bacteria 14978
32 Ga0070668_100009650 3300005347 Bacteria 7160
33 Ga0070669_100000223 3300005353 Bacteria 47302
34 Ga0070669_100057315 3300005353 Bacteria 2858
35 Ga0070669_100073292 3300005353 Bacteria 2536
36 Ga0070671_100000039 3300005355 Bacteria 93404
37 Ga0070671_100000646 3300005355 Bacteria 25002
38 Ga0070671_100003296 3300005355 Bacteria 12597
39 Ga0070671_100433121 3300005355 Bacteria 1127
40 Ga0070673_100017339 3300005364 Bacteria 5118
41 Ga0070688_100627512 3300005365 Bacteria 825
42 Ga0070659_100029456 3300005366 Bacteria 4243
43 Ga0070667_100000292 3300005367 Bacteria 56417
44 Ga0070667_100003533 3300005367 Bacteria 13317
45 Ga0070667_100177525 3300005367 Bacteria 1882
46 Ga0070685_10420182 3300005466 Bacteria 930
47 Ga0068853_100080540 3300005539 Bacteria 2849
48 Ga0068853_100253589 3300005539 Bacteria 1615
49 Ga0070686_100158892 3300005544 Bacteria 1590
50 Ga0070686_100217447 3300005544 Bacteria 1379
51 Ga0070665_100049441 3300005548 Bacteria 4218
52 Ga0070665_100076966 3300005548 Bacteria 3342
53 Ga0070665_100085802 3300005548 Bacteria 3154
54 Ga0070665_100150032 3300005548 Bacteria 2334
55 Ga0070704_100252638 3300005549 Bacteria 1449
56 Ga0068855_100003017 3300005563 Bacteria 20595
57 Ga0068855_100003313 3300005563 Bacteria 19716
58 Ga0068855_100173576 3300005563 Bacteria 2440
59 Ga0068855_100359429 3300005563 Bacteria 1602
60 Ga0068855_100397379 3300005563 Bacteria 1511
61 Ga0068857_100000729 3300005577 Bacteria 24503
62 Ga0068857_100102817 3300005577 Bacteria 2565
63 Ga0068857_100462821 3300005577 Bacteria 1187
64 Ga0068854_100019210 3300005578 Bacteria 4601
65 Ga0068854_100316799 3300005578 Bacteria 1266
66 Ga0068856_100027948 3300005614 Bacteria 5504
67 Ga0068856_100036618 3300005614 Bacteria 4811
68 Ga0068852_100267866 3300005616 Bacteria 1643
69 Ga0068859_100000111 3300005617 Bacteria 77474
70 Ga0068859_100001433 3300005617 Bacteria 24186
71 Ga0068859_100022118 3300005617 Bacteria 6375
72 Ga0068859_100158262 3300005617 Bacteria 2343
73 Ga0068859_101005064 3300005617 Bacteria 916
74 Ga0068864_100000522 3300005618 Bacteria 33095
75 Ga0068864_100061474 3300005618 Bacteria 3253
76 Ga0068861_100658158 3300005719 Bacteria 968
77 Ga0068851_10234310 3300005834 Bacteria 1036
78 Ga0068863_100000076 3300005841 Bacteria 109412
79 Ga0068863_100001245 3300005841 Bacteria 25348
80 Ga0068863_100298139 3300005841 Bacteria 1563
81 Ga0068858_100000079 3300005842 Bacteria 100753
82 Ga0068858_100000500 3300005842 Bacteria 41083
83 Ga0068858_100001095 3300005842 Bacteria 28054
84 Ga0068858_100006139 3300005842 Bacteria 11719
85 Ga0068858_100381018 3300005842 Bacteria 1353
86 Ga0068860_100003105 3300005843 Bacteria 17168
87 Ga0068860_100076361 3300005843 Bacteria 3186
88 Ga0068862_100045306 3300005844 Bacteria 3753
89 Ga0068862_100075149 3300005844 Bacteria 2922
90 Ga0068862_100098361 3300005844 Bacteria 2556
91 Ga0075364_10001342 3300006051 Bacteria 13271
92 Ga0075370_10010898 3300006353 Bacteria 4765
93 Ga0075370_10024035 3300006353 Bacteria 3362
94 Ga0075370_10224662 3300006353 Bacteria 1110
95 Ga0097620_100000111 3300006931 Bacteria 77474
96 Ga0097620_100001433 3300006931 Bacteria 24186
97 Ga0097620_100022118 3300006931 Bacteria 6375
98 Ga0097620_100158248 3300006931 Bacteria 2343
99 Ga0097620_101004900 3300006931 Bacteria 916
100 Ga0105251_10016937 3300009011 Bacteria 3919
101 Ga0105251_10228547 3300009011 Bacteria 838
102 Ga0105250_10003149 3300009092 Bacteria 7916
103 Ga0105250_10004734 3300009092 Bacteria 6211
104 Ga0105240_10000049 3300009093 Bacteria 236718
105 Ga0105240_10053653 3300009093 Bacteria 5059
106 Ga0105247_10000179 3300009101 Bacteria 61933
107 Ga0105241_10009670 3300009174 Bacteria 7086
108 Ga0105248_10001802 3300009177 Bacteria 23825
109 Ga0105248_10016652 3300009177 Bacteria 8092
110 Ga0105248_10051555 3300009177 Bacteria 4617
111 Ga0105248_10115019 3300009177 Bacteria 3034
112 Ga0105248_10216380 3300009177 Bacteria 2158
113 Ga0105248_10451829 3300009177 Bacteria 1448
114 Ga0105237_10069899 3300009545 Bacteria 3506
115 Ga0105237_10127862 3300009545 Bacteria 2535
116 Ga0105237_10205517 3300009545 Bacteria 1970
117 Ga0105238_10004144 3300009551 Bacteria 14383
118 Ga0105238_10221223 3300009551 Bacteria 1869
119 Ga0105238_10253732 3300009551 Bacteria 1738
120 Ga0105249_10000296 3300009553 Bacteria 51256
121 Ga0105249_10059011 3300009553 Bacteria 3518
122 Ga0105249_10740019 3300009553 Bacteria 1045
123 Ga0105148_100001 3300009978 Bacteria 58900
124 Ga0105239_10000070 3300010375 Bacteria 144044
125 Ga0105239_10008314 3300010375 Bacteria 11827
126 Ga0105239_10134586 3300010375 Bacteria 2751
127 Ga0105239_10136274 3300010375 Bacteria 2733
128 Ga0157373_10018656 3300013100 Bacteria 5049
129 Ga0157373_10364682 3300013100 Bacteria 1032
130 Ga0157370_10010836 3300013104 Bacteria 9576
131 Ga0157369_10042945 3300013105 Bacteria 4930
132 Ga0157378_10411317 3300013297 Bacteria 1335
133 Ga0163162_10063061 3300013306 Bacteria 3748
134 Ga0163162_10154764 3300013306 Bacteria 2412
135 Ga0163162_10315114 3300013306 Bacteria 1697
136 Ga0163162_10396673 3300013306 Bacteria 1512
137 Ga0163162_10726289 3300013306 Bacteria 1114
138 Ga0157372_10218900 3300013307 Bacteria 2207
139 Ga0157372_10384236 3300013307 Bacteria 1636
140 Ga0163163_10009991 3300014325 Bacteria 8510
141 Ga0163163_10199946 3300014325 Bacteria 2047
142 Ga0182008_10027630 3300014497 Bacteria 2872
143 Ga0157379_10000416 3300014968 Bacteria 34546
144 Ga0157379_10011790 3300014968 Bacteria 7634
145 Ga0157379_10019100 3300014968 Bacteria 6052
146 Ga0182006_1000627 3300015261 Bacteria 25230
147 Ga0182007_10001500 3300015262 Bacteria 12478
148 Ga0163161_10009072 3300017792 Bacteria 6879
149 Ga0163161_10122455 3300017792 Bacteria 1956
150 Ga0163161_10339725 3300017792 Bacteria 1191
151 Ga0209674_100003 3300025226 Bacteria 2196646
152 Ga0209563_100010 3300025230 Bacteria 1337457
153 Ga0207427_102518 3300025231 Bacteria 4842
154 Ga0209258_100380 3300025242 Bacteria 57138
155 Ga0209258_100605 3300025242 Bacteria 29085
156 Ga0209646_1000150 3300025246 Bacteria 99112
157 Ga0209026_1000026 3300025250 Bacteria 352109
158 Ga0209677_100026 3300025253 Bacteria 382520
159 Ga0209677_100060 3300025253 Bacteria 155728
160 Ga0209677_100783 3300025253 Bacteria 15993
161 Ga0209759_1000270 3300025256 Bacteria 73626
162 Ga0209759_1000871 3300025256 Bacteria 23164
163 Ga0209759_1001827 3300025256 Bacteria 10686
164 Ga0209759_1011470 3300025256 Bacteria 2516
165 Ga0209759_1023000 3300025256 Bacteria 1383
166 Ga0209455_1000273 3300025272 Bacteria 57138
167 Ga0209051_1012590 3300025303 Bacteria 4084
168 Ga0207697_10065617 3300025315 Bacteria 1515
169 Ga0207697_10083800 3300025315 Bacteria 1345
170 Ga0207656_10003658 3300025321 Bacteria 5314
171 Ga0207710_10000331 3300025900 Bacteria 35720
172 Ga0207680_10014397 3300025903 Bacteria 4092
173 Ga0207680_10026359 3300025903 Bacteria 3221
174 Ga0207680_10348170 3300025903 Bacteria 1040
175 Ga0207647_10001478 3300025904 Bacteria 18054
176 Ga0207705_10044249 3300025909 Bacteria 3199
177 Ga0207654_10008215 3300025911 Bacteria 5267
178 Ga0207695_10070951 3300025913 Bacteria 3559
179 Ga0207671_10073608 3300025914 Bacteria 2552
180 Ga0207657_10105676 3300025919 Bacteria 2330
181 Ga0207681_10000160 3300025923 Bacteria 55315
182 Ga0207681_10031848 3300025923 Bacteria 3447
183 Ga0207681_10129426 3300025923 Bacteria 1864
184 Ga0207681_10594221 3300025923 Bacteria 914
185 Ga0207694_10031066 3300025924 Bacteria 4078
186 Ga0207694_10175689 3300025924 Bacteria 1735
187 Ga0207650_10037100 3300025925 Bacteria 3550
188 Ga0207650_10097171 3300025925 Bacteria 2261
189 Ga0207687_10229620 3300025927 Bacteria 1465
190 Ga0207644_10000022 3300025931 Bacteria 160689
191 Ga0207644_10000999 3300025931 Bacteria 18072
192 Ga0207644_10146993 3300025931 Bacteria 1820
193 Ga0207644_10309739 3300025931 Bacteria 1274
194 Ga0207690_10502613 3300025932 Bacteria 981
195 Ga0207706_10045644 3300025933 Bacteria 3881
196 Ga0207670_10083981 3300025936 Bacteria 2235
197 Ga0207711_10000979 3300025941 Bacteria 27387
198 Ga0207711_10036816 3300025941 Bacteria 4153
199 Ga0207711_10070373 3300025941 Bacteria 3034
200 Ga0207711_10147471 3300025941 Bacteria 2121
201 Ga0207711_10624671 3300025941 Bacteria 1005
202 Ga0207689_10056416 3300025942 Bacteria 3233
203 Ga0207667_10000355 3300025949 Bacteria 62384
204 Ga0207667_10009368 3300025949 Bacteria 11544
205 Ga0207667_10013742 3300025949 Bacteria 9253
206 Ga0207667_10153815 3300025949 Bacteria 2367
207 Ga0207651_10003840 3300025960 Bacteria 7451
208 Ga0207712_10000472 3300025961 Bacteria 33923
209 Ga0207712_10034171 3300025961 Bacteria 3443
210 Ga0207668_10001435 3300025972 Bacteria 14042
211 Ga0207668_10260523 3300025972 Bacteria 1413
212 Ga0207640_10041109 3300025981 Bacteria 2938
213 Ga0207658_10000084 3300025986 Bacteria 104409
214 Ga0207658_10020640 3300025986 Bacteria 4562
215 Ga0207658_10023810 3300025986 Bacteria 4278
216 Ga0207703_10000051 3300026035 Bacteria 145390
217 Ga0207703_10004406 3300026035 Bacteria 11582
218 Ga0207703_10077642 3300026035 Bacteria 2757
219 Ga0207703_10096174 3300026035 Bacteria 2500
220 Ga0207639_10001279 3300026041 Bacteria 16988
221 Ga0207639_10023474 3300026041 Bacteria 4454
222 Ga0207639_10264517 3300026041 Bacteria 1506
223 Ga0207678_10000402 3300026067 Bacteria 39370
224 Ga0207702_10000760 3300026078 Bacteria 34286
225 Ga0207702_10004355 3300026078 Bacteria 12623
226 Ga0207641_10000003 3300026088 Bacteria 496984
227 Ga0207641_10007881 3300026088 Bacteria 8833
228 Ga0207641_10143832 3300026088 Bacteria 2154
229 Ga0207676_10000223 3300026095 Bacteria 48952
230 Ga0207676_10030384 3300026095 Bacteria 4056
231 Ga0207674_10002576 3300026116 Bacteria 22832
232 Ga0207674_10010437 3300026116 Bacteria 10520
233 Ga0207674_10011852 3300026116 Bacteria 9774
234 Ga0207674_10203060 3300026116 Bacteria 1931
235 Ga0207674_10384205 3300026116 Bacteria 1357
236 Ga0207674_10692949 3300026116 Bacteria 984
237 Ga0207674_10770337 3300026116 Bacteria 929
238 Ga0207675_100043343 3300026118 Bacteria 4202
239 Ga0207698_10203936 3300026142 Bacteria 1773
240 Ga0207698_10376479 3300026142 Bacteria 1349
241 Ga0207698_10376490 3300026142 Bacteria 1349
242 Ga0207698_10559365 3300026142 Bacteria 1122
243 Ga0268266_10074311 3300028379 Bacteria 2951
244 Ga0268266_10093138 3300028379 Bacteria 2644
245 Ga0268266_10157405 3300028379 Bacteria 2053
246 Ga0268265_10014055 3300028380 Bacteria 5454
247 Ga0268265_10182051 3300028380 Bacteria 1806
248 Ga0268264_10001582 3300028381 Bacteria 21076
249 Ga0268264_10035051 3300028381 Bacteria 4131
250 Ga0268264_10110569 3300028381 Bacteria 2406
251 Ga0265326_10016264 3300028558 Bacteria 2151
252 Ga0265334_10017372 3300028573 Bacteria 2973
253 Ga0265336_10000016 3300028666 Bacteria 238832
254 Ga0307517_10048134 3300028786 Bacteria 4398
255 Ga0265338_10006244 3300028800 Bacteria 15253
256 Ga0265338_10029177 3300028800 Bacteria 5477
257 Ga0265338_10048553 3300028800 Bacteria 3860
258 Ga0265338_10059075 3300028800 Bacteria 3380
259 Ga0265338_10173733 3300028800 Bacteria 1649
260 Ga0265324_10000419 3300029957 Bacteria 30459
261 Ga0307511_10000015 3300030521 Bacteria 126567
262 Ga0265330_10058209 3300031235 Bacteria 1685
263 Ga0265332_10099932 3300031238 Bacteria 1224
264 Ga0265325_10000285 3300031241 Bacteria 35898
265 Ga0265340_10016743 3300031247 Bacteria 3793
266 Ga0265340_10051441 3300031247 Bacteria 1995
267 Ga0265340_10067490 3300031247 Bacteria 1700
268 Ga0265339_10004004 3300031249 Bacteria 10185
269 Ga0265327_10035389 3300031251 Bacteria 2761
270 Ga0265316_10067948 3300031344 Bacteria 2755
271 Ga0265314_10003659 3300031711 Bacteria 14747
272 Ga0265314_10051891 3300031711 Bacteria 2854
273 Ga0265342_10104909 3300031712 Bacteria 1606
274 Ga0307516_10012354 3300031730 Bacteria 9210
275 Ga0307405_10005099 3300031731 Bacteria 6289
276 Ga0307406_10057527 3300031901 Bacteria 2494
277 Ga0307412_10038992 3300031911 Bacteria 3063
278 Ga0307412_10113252 3300031911 Bacteria 1940
279 Ga0307412_10300441 3300031911 Bacteria 1268
280 Ga0307416_100892674 3300032002 Bacteria 988
281 Ga0307414_10419371 3300032004 Bacteria 1167
282 Ga0307411_10017495 3300032005 Bacteria 4086
283 Ga0307507_10203882 3300033179 Bacteria 1363
284 Ga0373959_0017562 3300034820 Bacteria 1337
285 Ga0373931_0187952 3300035691 Bacteria 1227
286 Ga0395899_0021761 3300037312 Bacteria 4864
287 Ga0395900_0014590 3300037418 Bacteria 8016
288 Ga0395900_0040528 3300037418 Bacteria 4800
289 Ga0395898_0034491 3300037466 Bacteria 5043
290 Ga0395898_0681173 3300037466 Bacteria 970
291 Ga0395905_0000769 3300037471 Bacteria 42306
292 Ga0436364_0532456 3300037853 Bacteria 1476
293 Ga0395901_0001021 3300038443 Bacteria 30275
294 Ga0395901_0003843 3300038443 Bacteria 15134
295 Ga0395901_1175046 3300038443 Bacteria 734
296 Ga0436363_0609559 3300039450 Bacteria 1273
297 Ga0450888_010037 3300042126 Bacteria 1091
298 Ga0466969_0022609 3300044656 Bacteria 3245
299 Ga0466965_0004465 3300044683 Bacteria 6223
300 Ga0466966_0003637 3300044684 Bacteria 10176
301 Ga0466961_0089514 3300044693 Bacteria 1943
302 Ga0466963_0028975 3300044694 Bacteria 3560
303 Ga0466964_0015842 3300044706 Bacteria 2870
304 Ga0466968_0011867 3300044735 Bacteria 3400
305 Ga0466970_0053977 3300044765 Bacteria 2146
306 Ga0466957_0007432 3300044842 Bacteria 6189
307 Ga0466959_0013595 3300045049 Bacteria 5902
308 Ga0466958_0014268 3300045836 Bacteria 4536
309 Ga0466967_0025880 3300045976 Bacteria 4847
310 Ga0466967_0407018 3300045976 Bacteria 1324
311 Ga0495617_011202 3300046452 Bacteria 3063
312 Ga0495627_000112 3300046453 Bacteria 101337
313 Ga0495627_000206 3300046453 Bacteria 63802
314 Ga0495651_0091660 3300046462 Bacteria 2278
315 Ga0495585_0035288 3300046492 Bacteria 2827
316 Ga0495585_0072769 3300046492 Bacteria 1872
317 Ga0495583_0000166 3300046506 Bacteria 111939
318 Ga0495606_0001259 3300046507 Bacteria 35323
319 Ga0495610_0000085 3300046512 Bacteria 112390
320 Ga0495610_0034163 3300046512 Bacteria 2622
321 Ga0495616_0000698 3300046513 Bacteria 24874
322 Ga0495632_0000095 3300046519 Bacteria 89499
323 Ga0495637_0001011 3300046520 Bacteria 17698
324 Ga0495637_0010056 3300046520 Bacteria 4593
325 Ga0495643_0000038 3300046522 Bacteria 236010
326 Ga0495648_0010720 3300046524 Bacteria 6959
327 Ga0495648_0042995 3300046524 Bacteria 2837
328 Ga0495663_0000028 3300046525 Bacteria 89526
329 Ga0495633_0000136 3300046558 Bacteria 97314
330 Ga0495633_0001114 3300046558 Bacteria 21590
331 Ga0495633_0036358 3300046558 Bacteria 2360
332 Ga0495668_0032137 3300046616 Bacteria 2955
333 Ga0495668_0055819 3300046616 Bacteria 2181
334 Ga0495668_0224176 3300046616 Bacteria 1029
335 Ga0495625_0018196 3300046660 Bacteria 5491
336 Ga0495661_0205325 3300046665 Bacteria 1029
337 Ga0495671_0000027 3300046692 Bacteria 236011
338 Ga0495649_0000998 3300046694 Bacteria 22261
339 Ga0495600_0234200 3300046809 Bacteria 1171
340 Ga0495636_0093175 3300047318 Bacteria 1310
341 Ga0495672_0087667 3300047320 Bacteria 1718
342 Ga0495683_0021444 3300047323 Bacteria 3330
343 Ga0495687_118765 3300047443 Bacteria 958
344 Ga0495673_0130615 3300047469 Bacteria 987
345 Ga0495681_0000013 3300047470 Bacteria 189155
346 Ga0495681_0001132 3300047470 Bacteria 20269
347 Ga0495686_0005745 3300047472 Bacteria 9697
348 Ga0495686_0019617 3300047472 Bacteria 4517
349 Ga0496100_0019488 3300048903 Bacteria 4049
350 Ga0496101_0074532 3300048904 Bacteria 2496
351 Ga0496102_0044175 3300048905 Bacteria 4043
352 Ga0496102_0047216 3300048905 Bacteria 3912
353 Ga0496102_0278634 3300048905 Bacteria 1576
354 Ga0496103_0277468 3300048906 Bacteria 1078
355 Ga0496105_0000326 3300048908 Bacteria 31216
356 Ga0496105_0065316 3300048908 Bacteria 3003
357 Ga0496106_0000127 3300048909 Bacteria 58281
358 Ga0496106_0026392 3300048909 Bacteria 4326
359 Ga0496107_0010952 3300048910 Bacteria 6309
360 Ga0496108_0028638 3300048911 Bacteria 4609
361 Ga0496108_0075723 3300048911 Bacteria 2844
362 Ga0496108_0312440 3300048911 Bacteria 1369
363 Ga0496108_0413944 3300048911 Bacteria 1177
364 Ga0496109_0191973 3300048912 Bacteria 1919
365 Ga0496110_0055094 3300048913 Bacteria 3499
366 Ga0496110_0061792 3300048913 Bacteria 3307
367 Ga0496110_0517919 3300048913 Bacteria 1085
368 Ga0496111_0048240 3300048914 Bacteria 3068
369 Ga0496111_0170901 3300048914 Bacteria 1615
370 Ga0496111_0224299 3300048914 Bacteria 1396
371 Ga0496111_0487867 3300048914 Bacteria 907
372 Ga0496112_0063069 3300048915 Bacteria 3656
373 Ga0496113_0000269 3300048916 Bacteria 24502
374 Ga0496113_0687217 3300048916 Bacteria 817
375 Ga0496114_0021988 3300048917 Bacteria 5193
376 Ga0496117_0005392 3300048920 Bacteria 13465
377 Ga0496117_0006324 3300048920 Bacteria 12051
378 Ga0496118_0000978 3300048921 Bacteria 44553
379 Ga0496118_0010751 3300048921 Bacteria 9023
380 Ga0496118_0126840 3300048921 Bacteria 1648
381 Ga0496119_0000048 3300048922 Bacteria 185846
382 Ga0496119_0010638 3300048922 Bacteria 7712
383 Ga0496120_0000519 3300048923 Bacteria 59691
384 Ga0496121_0000874 3300048924 Bacteria 54498
385 Ga0496121_0001426 3300048924 Bacteria 40386
386 Ga0496121_0003062 3300048924 Bacteria 24239
387 Ga0496121_0111566 3300048924 Bacteria 2085
388 Ga0496122_0011807 3300048925 Bacteria 8785
389 Ga0496122_0317083 3300048925 Bacteria 831
390 Ga0496123_0025859 3300048926 Bacteria 4412
391 Ga0496123_0115091 3300048926 Bacteria 1527
392 Ga0496123_0185371 3300048926 Bacteria 1082
393 Ga0496124_0019516 3300048927 Bacteria 6306
394 Ga0496124_0115324 3300048927 Bacteria 2156
395 Ga0496124_0152623 3300048927 Bacteria 1810
396 Ga0496124_0256439 3300048927 Bacteria 1290
397 Ga0496125_0000425 3300048928 Bacteria 78294
398 Ga0496125_0055919 3300048928 Bacteria 3210
399 Ga0496125_0106570 3300048928 Bacteria 2045
400 Ga0496125_0110502 3300048928 Bacteria 1993
401 Ga0496126_0002609 3300048929 Bacteria 24014
402 Ga0496126_0010007 3300048929 Bacteria 10006
403 Ga0496126_0025020 3300048929 Bacteria 5754
404 Ga0495678_033410 3300049459 Bacteria 2124
405 Ga0501034_0004634 3300049571 Bacteria 15229
406 Ga0501037_0044340 3300049573 Bacteria 3266
407 Ga0501038_0065710 3300049574 Bacteria 3090
408 Ga0501047_0011529 3300049581 Bacteria 8367
409 Ga0501223_000080 3300049663 Bacteria 28958
410 Ga0501235_000785 3300049669 Bacteria 6473
411 Ga0501256_005711 3300049685 Bacteria 1103
412 Ga0501225_0000092 3300049705 Bacteria 28671
413 Ga0501225_0004314 3300049705 Bacteria 4251
414 Ga0501225_0006131 3300049705 Bacteria 3512
415 Ga0501245_000399 3300049708 Bacteria 5242
416 Ga0501044_0002965 3300049823 Bacteria 19286
417 Ga0501044_0169315 3300049823 Bacteria 2157
418 nmdc:mga00v17_1499_c1 3300050491 Bacteria 12193
419 nmdc:mga07m45_11219_c1 3300050496 Bacteria 4703
420 nmdc:mga07m45_155284_c1 3300050496 Bacteria 1328
421 nmdc:mga07m45_217459_c1 3300050496 Bacteria 1111
422 nmdc:mga05p37_1557232_c1 3300050507 Bacteria 654
423 Ga0500635_0000182 3300053080 Bacteria 32307
424 Ga0500635_0007993 3300053080 Bacteria 2885
425 Ga0500643_000856 3300053087 Bacteria 19429
426 Ga0500643_023200 3300053087 Bacteria 1985
427 Ga0500647_0183056 3300053091 Bacteria 960
428 Ga0500641_0003118 3300053096 Bacteria 5873
429 Ga0500562_008184 3300053108 Bacteria 2639
430 Ga0500559_0042136 3300053136 Bacteria 1991
431 Ga0500604_0001490 3300053151 Bacteria 6553
432 Ga0500624_000028 3300053157 Bacteria 106675
433 Ga0500627_0000779 3300053158 Bacteria 8488
434 Ga0500636_0003658 3300053177 Bacteria 8673
435 Ga0500637_0316696 3300053178 Bacteria 844
436 Ga0466962_0008587 3300061719 Bacteria 4895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_0687217 Ga0496113_0687217_14_622 202
2 3300049459 Ga0495678_033410 Ga0495678_033410_1496_2104 202
3 3300050507 nmdc:mga05p37_1557232_c1 nmdc:mga05p37_1557232_c1_10_618 202
4 3300044765 Ga0466970_0053977 Ga0466970_0053977_1248_1952 211
5 3300046809 Ga0495600_0234200 Ga0495600_0234200_77_733 214
6 3300005834 Ga0068851_10234310 Ga0068851_102343102 215
7 3300038443 Ga0395901_1175046 Ga0395901_1175046_20_685 217
8 3300053178 Ga0500637_0316696 Ga0500637_0316696_40_699 217
9 3300009093 Ga0105240_10000049 Ga0105240_1000004910 220
10 3300010375 Ga0105239_10000070 Ga0105239_1000007080 220
11 3300048908 Ga0496105_0000326 Ga0496105_0000326_14002_14676 220
12 3300048920 Ga0496117_0005392 Ga0496117_0005392_8631_9305 220
13 3300048921 Ga0496118_0000978 Ga0496118_0000978_7873_8547 220
14 3300048922 Ga0496119_0000048 Ga0496119_0000048_53267_53941 220
15 3300048923 Ga0496120_0000519 Ga0496120_0000519_53210_53884 220
16 3300028573 Ga0265334_10017372 Ga0265334_100173722 223
17 3300028800 Ga0265338_10059075 Ga0265338_100590752 223
18 3300031251 Ga0265327_10035389 Ga0265327_100353892 223
19 3300031711 Ga0265314_10051891 Ga0265314_100518914 223
20 3300005549 Ga0070704_100252638 Ga0070704_1002526381 231
21 3300028800 Ga0265338_10029177 Ga0265338_100291777 232
22 3300025900 Ga0207710_10000331 Ga0207710_1000033121 233
23 3300005563 Ga0068855_100003313 Ga0068855_10000331316 236
24 3300005614 Ga0068856_100036618 Ga0068856_1000366183 236
25 3300025949 Ga0207667_10000355 Ga0207667_1000035512 236
26 3300028800 Ga0265338_10048553 Ga0265338_100485533 236
27 3300037312 Ga0395899_0021761 Ga0395899_0021761_2977_3732 236
28 3300037418 Ga0395900_0040528 Ga0395900_0040528_2392_3147 236
29 3300037471 Ga0395905_0000769 Ga0395905_0000769_2187_2942 236
30 3300038443 Ga0395901_0003843 Ga0395901_0003843_3969_4724 236
31 3300009545 Ga0105237_10205517 Ga0105237_102055171 237
32 3300026116 Ga0207674_10692949 Ga0207674_106929491 237
33 3300047443 Ga0495687_118765 Ga0495687_118765_96_836 239
34 3300009092 Ga0105250_10004734 Ga0105250_100047343 240
35 3300048905 Ga0496102_0278634 Ga0496102_0278634_547_1290 240
36 3300048906 Ga0496103_0277468 Ga0496103_0277468_264_1007 240
37 3300048909 Ga0496106_0026392 Ga0496106_0026392_2607_3350 240
38 3300048915 Ga0496112_0063069 Ga0496112_0063069_2106_2849 240
39 3300048924 Ga0496121_0003062 Ga0496121_0003062_6853_7596 240
40 3300001904 JGI24736J21556_1000471 JGI24736J21556_10004716 244
41 3300001979 JGI24740J21852_10001194 JGI24740J21852_100011944 244
42 3300002067 JGI24735J21928_10001449 JGI24735J21928_100014494 244
43 3300002075 JGI24738J21930_10002069 JGI24738J21930_100020691 244
44 3300005327 Ga0070658_10020815 Ga0070658_100208154 244
45 3300005339 Ga0070660_100011131 Ga0070660_1000111316 244
46 3300005344 Ga0070661_100038900 Ga0070661_1000389004 244
47 3300005539 Ga0068853_100253589 Ga0068853_1002535892 244
48 3300005577 Ga0068857_100102817 Ga0068857_1001028173 244
49 3300005578 Ga0068854_100316799 Ga0068854_1003167991 244
50 3300005614 Ga0068856_100027948 Ga0068856_1000279482 244
51 3300005719 Ga0068861_100658158 Ga0068861_1006581582 244
52 3300009174 Ga0105241_10009670 Ga0105241_100096705 244
53 3300009545 Ga0105237_10069899 Ga0105237_100698994 244
54 3300009551 Ga0105238_10221223 Ga0105238_102212231 244
55 3300010375 Ga0105239_10134586 Ga0105239_101345863 244
56 3300013100 Ga0157373_10018656 Ga0157373_100186562 244
57 3300013104 Ga0157370_10010836 Ga0157370_100108365 244
58 3300013307 Ga0157372_10384236 Ga0157372_103842362 244
59 3300025321 Ga0207656_10003658 Ga0207656_100036582 244
60 3300025904 Ga0207647_10001478 Ga0207647_100014782 244
61 3300025911 Ga0207654_10008215 Ga0207654_100082156 244
62 3300025919 Ga0207657_10105676 Ga0207657_101056762 244
63 3300026041 Ga0207639_10001279 Ga0207639_100012794 244
64 3300026067 Ga0207678_10000402 Ga0207678_1000040225 244
65 3300026078 Ga0207702_10004355 Ga0207702_1000435511 244
66 3300026116 Ga0207674_10010437 Ga0207674_100104379 244
67 3300026142 Ga0207698_10376479 Ga0207698_103764791 244
68 3300031901 Ga0307406_10057527 Ga0307406_100575272 244
69 3300031911 Ga0307412_10113252 Ga0307412_101132522 244
70 iso_pu_bacteria 2808606401 2809063428 244
71 iso_pu_bacteria 2808606404 2809079136 244
72 iso_pu_bacteria 2808606405 2809083490 244
73 iso_pu_bacteria 2880518877 2880520698 244
74 iso_pu_bacteria 2919709256 2919712436 244
75 3300035691 Ga0373931_0187952 Ga0373931_0187952_432_1208 246
76 3300045976 Ga0466967_0025880 Ga0466967_0025880_259_1035 246
77 iso_pu_bacteria 2775507255 2778123295 246
78 3300005335 Ga0070666_10005583 Ga0070666_100055836 247
79 3300005367 Ga0070667_100000292 Ga0070667_10000029252 247
80 3300005618 Ga0068864_100000522 Ga0068864_10000052218 247
81 3300005841 Ga0068863_100000076 Ga0068863_10000007696 247
82 3300005842 Ga0068858_100000079 Ga0068858_10000007918 247
83 3300009011 Ga0105251_10228547 Ga0105251_102285471 247
84 3300009092 Ga0105250_10003149 Ga0105250_100031496 247
85 3300009177 Ga0105248_10115019 Ga0105248_101150194 247
86 3300009177 Ga0105248_10216380 Ga0105248_102163802 247
87 3300009553 Ga0105249_10000296 Ga0105249_100002966 247
88 3300013306 Ga0163162_10315114 Ga0163162_103151142 247
89 3300014325 Ga0163163_10199946 Ga0163163_101999463 247
90 3300014968 Ga0157379_10011790 Ga0157379_100117906 247
91 3300025903 Ga0207680_10014397 Ga0207680_100143976 247
92 3300025925 Ga0207650_10097171 Ga0207650_100971712 247
93 3300025941 Ga0207711_10070373 Ga0207711_100703732 247
94 3300025941 Ga0207711_10147471 Ga0207711_101474712 247
95 3300025961 Ga0207712_10000472 Ga0207712_1000047232 247
96 3300025986 Ga0207658_10000084 Ga0207658_1000008432 247
97 3300026035 Ga0207703_10000051 Ga0207703_1000005197 247
98 3300026088 Ga0207641_10000003 Ga0207641_10000003106 247
99 3300026095 Ga0207676_10000223 Ga0207676_1000022335 247
100 3300028380 Ga0268265_10014055 Ga0268265_100140553 247
101 3300028381 Ga0268264_10001582 Ga0268264_1000158215 247
102 3300028800 Ga0265338_10006244 Ga0265338_100062446 247
103 3300031235 Ga0265330_10058209 Ga0265330_100582092 247
104 3300031238 Ga0265332_10099932 Ga0265332_100999321 247
105 3300031241 Ga0265325_10000285 Ga0265325_1000028516 247
106 3300031247 Ga0265340_10051441 Ga0265340_100514412 247
107 3300031247 Ga0265340_10067490 Ga0265340_100674903 247
108 3300031249 Ga0265339_10004004 Ga0265339_100040048 247
109 3300031344 Ga0265316_10067948 Ga0265316_100679481 247
110 3300031711 Ga0265314_10003659 Ga0265314_100036593 247
111 3300048905 Ga0496102_0044175 Ga0496102_0044175_856_1626 247
112 3300049571 Ga0501034_0004634 Ga0501034_0004634_2497_3261 247
113 3300049573 Ga0501037_0044340 Ga0501037_0044340_1492_2256 247
114 3300049574 Ga0501038_0065710 Ga0501038_0065710_2236_3000 247
115 3300049823 Ga0501044_0002965 Ga0501044_0002965_18419_19183 247
116 3300005329 Ga0070683_100671165 Ga0070683_1006711651 248
117 3300005331 Ga0070670_100017748 Ga0070670_1000177487 248
118 3300005347 Ga0070668_100001975 Ga0070668_10000197512 248
119 3300005353 Ga0070669_100073292 Ga0070669_1000732922 248
120 3300005355 Ga0070671_100000646 Ga0070671_1000006466 248
121 3300005367 Ga0070667_100003533 Ga0070667_10000353312 248
122 3300005548 Ga0070665_100150032 Ga0070665_1001500321 248
123 3300005577 Ga0068857_100462821 Ga0068857_1004628212 248
124 3300005617 Ga0068859_100000111 Ga0068859_1000001117 248
125 3300005841 Ga0068863_100001245 Ga0068863_10000124531 248
126 3300005842 Ga0068858_100000500 Ga0068858_1000005009 248
127 3300005842 Ga0068858_100006139 Ga0068858_10000613911 248
128 3300005844 Ga0068862_100045306 Ga0068862_1000453061 248
129 3300006051 Ga0075364_10001342 Ga0075364_1000134210 248
130 3300006353 Ga0075370_10010898 Ga0075370_100108985 248
131 3300006353 Ga0075370_10224662 Ga0075370_102246622 248
132 3300006931 Ga0097620_100000111 Ga0097620_1000001117 248
133 3300009177 Ga0105248_10001802 Ga0105248_1000180211 248
134 3300010375 Ga0105239_10136274 Ga0105239_101362743 248
135 3300013100 Ga0157373_10364682 Ga0157373_103646822 248
136 3300013306 Ga0163162_10063061 Ga0163162_100630614 248
137 3300014497 Ga0182008_10027630 Ga0182008_100276304 248
138 3300014968 Ga0157379_10000416 Ga0157379_1000041634 248
139 3300015261 Ga0182006_1000627 Ga0182006_10006277 248
140 3300015262 Ga0182007_10001500 Ga0182007_100015005 248
141 3300017792 Ga0163161_10122455 Ga0163161_101224553 248
142 3300025315 Ga0207697_10065617 Ga0207697_100656172 248
143 3300025903 Ga0207680_10348170 Ga0207680_103481701 248
144 3300025925 Ga0207650_10037100 Ga0207650_100371002 248
145 3300025931 Ga0207644_10000999 Ga0207644_1000099921 248
146 3300025941 Ga0207711_10000979 Ga0207711_1000097923 248
147 3300025941 Ga0207711_10036816 Ga0207711_100368161 248
148 3300025972 Ga0207668_10001435 Ga0207668_1000143511 248
149 3300025986 Ga0207658_10023810 Ga0207658_100238102 248
150 3300026035 Ga0207703_10004406 Ga0207703_100044066 248
151 3300026035 Ga0207703_10096174 Ga0207703_100961743 248
152 3300026088 Ga0207641_10007881 Ga0207641_100078811 248
153 3300026116 Ga0207674_10384205 Ga0207674_103842052 248
154 3300028379 Ga0268266_10157405 Ga0268266_101574052 248
155 3300028381 Ga0268264_10035051 Ga0268264_100350512 248
156 3300028786 Ga0307517_10048134 Ga0307517_100481342 248
157 3300031712 Ga0265342_10104909 Ga0265342_101049092 248
158 3300037418 Ga0395900_0014590 Ga0395900_0014590_6259_7062 248
159 3300037466 Ga0395898_0681173 Ga0395898_0681173_136_939 248
160 3300037853 Ga0436364_0532456 Ga0436364_0532456_439_1209 248
161 3300039450 Ga0436363_0609559 Ga0436363_0609559_250_1053 248
162 3300042126 Ga0450888_010037 Ga0450888_010037_55_828 248
163 3300046452 Ga0495617_011202 Ga0495617_011202_1580_2326 248
164 3300046453 Ga0495627_000112 Ga0495627_000112_19607_20353 248
165 3300046453 Ga0495627_000206 Ga0495627_000206_28752_29498 248
166 3300046492 Ga0495585_0072769 Ga0495585_0072769_980_1756 248
167 3300046512 Ga0495610_0000085 Ga0495610_0000085_87942_88688 248
168 3300046512 Ga0495610_0034163 Ga0495610_0034163_1325_2071 248
169 3300046513 Ga0495616_0000698 Ga0495616_0000698_12517_13263 248
170 3300046519 Ga0495632_0000095 Ga0495632_0000095_77926_78672 248
171 3300046520 Ga0495637_0001011 Ga0495637_0001011_6200_6946 248
172 3300046520 Ga0495637_0010056 Ga0495637_0010056_1931_2677 248
173 3300046522 Ga0495643_0000038 Ga0495643_0000038_224405_225151 248
174 3300046524 Ga0495648_0010720 Ga0495648_0010720_1253_1999 248
175 3300046524 Ga0495648_0042995 Ga0495648_0042995_1638_2384 248
176 3300046525 Ga0495663_0000028 Ga0495663_0000028_77926_78672 248
177 3300046558 Ga0495633_0000136 Ga0495633_0000136_33916_34662 248
178 3300046558 Ga0495633_0001114 Ga0495633_0001114_10855_11601 248
179 3300046558 Ga0495633_0036358 Ga0495633_0036358_50_796 248
180 3300046616 Ga0495668_0032137 Ga0495668_0032137_1415_2161 248
181 3300046665 Ga0495661_0205325 Ga0495661_0205325_46_792 248
182 3300046692 Ga0495671_0000027 Ga0495671_0000027_10861_11607 248
183 3300047320 Ga0495672_0087667 Ga0495672_0087667_514_1287 248
184 3300047469 Ga0495673_0130615 Ga0495673_0130615_158_904 248
185 3300047470 Ga0495681_0000013 Ga0495681_0000013_91006_91752 248
186 3300047470 Ga0495681_0001132 Ga0495681_0001132_8887_9633 248
187 3300047472 Ga0495686_0005745 Ga0495686_0005745_7500_8246 248
188 3300048920 Ga0496117_0006324 Ga0496117_0006324_9758_10534 248
189 3300048921 Ga0496118_0010751 Ga0496118_0010751_6572_7348 248
190 3300048922 Ga0496119_0010638 Ga0496119_0010638_298_1074 248
191 3300048924 Ga0496121_0000874 Ga0496121_0000874_33595_34371 248
192 3300048926 Ga0496123_0185371 Ga0496123_0185371_307_1053 248
193 3300048927 Ga0496124_0115324 Ga0496124_0115324_40_786 248
194 3300050491 nmdc:mga00v17_1499_c1 nmdc:mga00v17_1499_c1_10408_11184 248
195 3300050496 nmdc:mga07m45_155284_c1 nmdc:mga07m45_155284_c1_15_791 248
196 3300050496 nmdc:mga07m45_217459_c1 nmdc:mga07m45_217459_c1_139_885 248
197 3300053087 Ga0500643_023200 Ga0500643_023200_536_1297 248
198 3300053096 Ga0500641_0003118 Ga0500641_0003118_4555_5319 248
199 3300053151 Ga0500604_0001490 Ga0500604_0001490_3408_4154 248
200 3300053158 Ga0500627_0000779 Ga0500627_0000779_3239_3985 248
201 3300002459 JGI24751J29686_10000273 JGI24751J29686_1000027317 249
202 3300002705 JGI25156J39149_1000668 JGI25156J39149_100066811 249
203 3300002741 JGI25157J39369_1000204 JGI25157J39369_100020449 249
204 3300003752 Ga0055539_1000211 Ga0055539_100021114 249
205 3300003752 Ga0055539_1001077 Ga0055539_10010773 249
206 3300003756 Ga0055533_1000006 Ga0055533_1000006357 249
207 3300003759 Ga0055525_1000760 Ga0055525_10007607 249
208 3300003761 Ga0055535_1000248 Ga0055535_100024811 249
209 3300003763 Ga0055529_1000300 Ga0055529_100030011 249
210 3300005327 Ga0070658_10064997 Ga0070658_100649973 249
211 3300005327 Ga0070658_10091100 Ga0070658_100911002 249
212 3300005327 Ga0070658_10233531 Ga0070658_102335312 249
213 3300005330 Ga0070690_100098782 Ga0070690_1000987823 249
214 3300005331 Ga0070670_100386834 Ga0070670_1003868342 249
215 3300005335 Ga0070666_10020283 Ga0070666_100202834 249
216 3300005353 Ga0070669_100000223 Ga0070669_1000002234 249
217 3300005355 Ga0070671_100000039 Ga0070671_10000003964 249
218 3300005355 Ga0070671_100003296 Ga0070671_1000032966 249
219 3300005355 Ga0070671_100433121 Ga0070671_1004331211 249
220 3300005364 Ga0070673_100017339 Ga0070673_1000173395 249
221 3300005367 Ga0070667_100177525 Ga0070667_1001775253 249
222 3300005466 Ga0070685_10420182 Ga0070685_104201821 249
223 3300005544 Ga0070686_100158892 Ga0070686_1001588921 249
224 3300005544 Ga0070686_100217447 Ga0070686_1002174471 249
225 3300005548 Ga0070665_100076966 Ga0070665_1000769663 249
226 3300005548 Ga0070665_100085802 Ga0070665_1000858023 249
227 3300005563 Ga0068855_100003017 Ga0068855_10000301719 249
228 3300005563 Ga0068855_100173576 Ga0068855_1001735762 249
229 3300005563 Ga0068855_100359429 Ga0068855_1003594291 249
230 3300005577 Ga0068857_100000729 Ga0068857_10000072913 249
231 3300005578 Ga0068854_100019210 Ga0068854_1000192104 249
232 3300005617 Ga0068859_100001433 Ga0068859_10000143315 249
233 3300005617 Ga0068859_100022118 Ga0068859_1000221189 249
234 3300005617 Ga0068859_100158262 Ga0068859_1001582622 249
235 3300005617 Ga0068859_101005064 Ga0068859_1010050641 249
236 3300005841 Ga0068863_100298139 Ga0068863_1002981391 249
237 3300005842 Ga0068858_100001095 Ga0068858_1000010952 249
238 3300005842 Ga0068858_100381018 Ga0068858_1003810182 249
239 3300005843 Ga0068860_100003105 Ga0068860_1000031053 249
240 3300005843 Ga0068860_100076361 Ga0068860_1000763613 249
241 3300005844 Ga0068862_100075149 Ga0068862_1000751492 249
242 3300005844 Ga0068862_100098361 Ga0068862_1000983612 249
243 3300006353 Ga0075370_10024035 Ga0075370_100240353 249
244 3300006931 Ga0097620_100001433 Ga0097620_10000143315 249
245 3300006931 Ga0097620_100022118 Ga0097620_1000221189 249
246 3300006931 Ga0097620_100158248 Ga0097620_1001582482 249
247 3300006931 Ga0097620_101004900 Ga0097620_1010049001 249
248 3300009093 Ga0105240_10053653 Ga0105240_100536534 249
249 3300009101 Ga0105247_10000179 Ga0105247_1000017925 249
250 3300009177 Ga0105248_10016652 Ga0105248_100166525 249
251 3300009177 Ga0105248_10051555 Ga0105248_100515553 249
252 3300009177 Ga0105248_10451829 Ga0105248_104518292 249
253 3300009545 Ga0105237_10127862 Ga0105237_101278624 249
254 3300009551 Ga0105238_10004144 Ga0105238_1000414412 249
255 3300009553 Ga0105249_10740019 Ga0105249_107400192 249
256 3300010375 Ga0105239_10008314 Ga0105239_100083143 249
257 3300013105 Ga0157369_10042945 Ga0157369_100429453 249
258 3300013297 Ga0157378_10411317 Ga0157378_104113172 249
259 3300013306 Ga0163162_10154764 Ga0163162_101547642 249
260 3300013306 Ga0163162_10396673 Ga0163162_103966732 249
261 3300013306 Ga0163162_10726289 Ga0163162_107262892 249
262 3300013307 Ga0157372_10218900 Ga0157372_102189001 249
263 3300014325 Ga0163163_10009991 Ga0163163_100099916 249
264 3300014968 Ga0157379_10019100 Ga0157379_100191005 249
265 3300017792 Ga0163161_10339725 Ga0163161_103397252 249
266 3300025226 Ga0209674_100003 Ga0209674_100003977 249
267 3300025230 Ga0209563_100010 Ga0209563_100010706 249
268 3300025231 Ga0207427_102518 Ga0207427_1025183 249
269 3300025242 Ga0209258_100380 Ga0209258_10038042 249
270 3300025242 Ga0209258_100605 Ga0209258_1006053 249
271 3300025246 Ga0209646_1000150 Ga0209646_100015046 249
272 3300025250 Ga0209026_1000026 Ga0209026_1000026259 249
273 3300025253 Ga0209677_100026 Ga0209677_100026229 249
274 3300025253 Ga0209677_100060 Ga0209677_10006014 249
275 3300025253 Ga0209677_100783 Ga0209677_1007836 249
276 3300025256 Ga0209759_1000270 Ga0209759_100027050 249
277 3300025256 Ga0209759_1000871 Ga0209759_100087111 249
278 3300025256 Ga0209759_1001827 Ga0209759_10018276 249
279 3300025256 Ga0209759_1011470 Ga0209759_10114703 249
280 3300025256 Ga0209759_1023000 Ga0209759_10230002 249
281 3300025272 Ga0209455_1000273 Ga0209455_100027342 249
282 3300025303 Ga0209051_1012590 Ga0209051_10125902 249
283 3300025315 Ga0207697_10083800 Ga0207697_100838002 249
284 3300025903 Ga0207680_10026359 Ga0207680_100263593 249
285 3300025909 Ga0207705_10044249 Ga0207705_100442492 249
286 3300025913 Ga0207695_10070951 Ga0207695_100709513 249
287 3300025914 Ga0207671_10073608 Ga0207671_100736082 249
288 3300025923 Ga0207681_10000160 Ga0207681_1000016012 249
289 3300025924 Ga0207694_10175689 Ga0207694_101756892 249
290 3300025927 Ga0207687_10229620 Ga0207687_102296201 249
291 3300025931 Ga0207644_10000022 Ga0207644_1000002262 249
292 3300025931 Ga0207644_10146993 Ga0207644_101469932 249
293 3300025931 Ga0207644_10309739 Ga0207644_103097392 249
294 3300025932 Ga0207690_10502613 Ga0207690_105026131 249
295 3300025936 Ga0207670_10083981 Ga0207670_100839812 249
296 3300025941 Ga0207711_10624671 Ga0207711_106246712 249
297 3300025942 Ga0207689_10056416 Ga0207689_100564164 249
298 3300025949 Ga0207667_10009368 Ga0207667_100093682 249
299 3300025949 Ga0207667_10013742 Ga0207667_100137422 249
300 3300025960 Ga0207651_10003840 Ga0207651_100038408 249
301 3300025972 Ga0207668_10260523 Ga0207668_102605232 249
302 3300025981 Ga0207640_10041109 Ga0207640_100411094 249
303 3300025986 Ga0207658_10020640 Ga0207658_100206401 249
304 3300026035 Ga0207703_10077642 Ga0207703_100776423 249
305 3300026041 Ga0207639_10264517 Ga0207639_102645172 249
306 3300026078 Ga0207702_10000760 Ga0207702_100007602 249
307 3300026088 Ga0207641_10143832 Ga0207641_101438321 249
308 3300026116 Ga0207674_10002576 Ga0207674_1000257624 249
309 3300026116 Ga0207674_10203060 Ga0207674_102030602 249
310 3300026116 Ga0207674_10770337 Ga0207674_107703371 249
311 3300026118 Ga0207675_100043343 Ga0207675_1000433433 249
312 3300026142 Ga0207698_10559365 Ga0207698_105593651 249
313 3300028379 Ga0268266_10074311 Ga0268266_100743112 249
314 3300028379 Ga0268266_10093138 Ga0268266_100931382 249
315 3300028380 Ga0268265_10182051 Ga0268265_101820512 249
316 3300028381 Ga0268264_10110569 Ga0268264_101105692 249
317 3300028558 Ga0265326_10016264 Ga0265326_100162642 249
318 3300028666 Ga0265336_10000016 Ga0265336_1000001662 249
319 3300028800 Ga0265338_10173733 Ga0265338_101737332 249
320 3300029957 Ga0265324_10000419 Ga0265324_1000041916 249
321 3300030521 Ga0307511_10000015 Ga0307511_1000001551 249
322 3300031247 Ga0265340_10016743 Ga0265340_100167433 249
323 3300031730 Ga0307516_10012354 Ga0307516_100123545 249
324 3300033179 Ga0307507_10203882 Ga0307507_102038822 249
325 3300034820 Ga0373959_0017562 Ga0373959_0017562_145_954 249
326 3300037466 Ga0395898_0034491 Ga0395898_0034491_185_994 249
327 3300038443 Ga0395901_0001021 Ga0395901_0001021_23758_24567 249
328 3300044656 Ga0466969_0022609 Ga0466969_0022609_504_1322 249
329 3300044683 Ga0466965_0004465 Ga0466965_0004465_4550_5368 249
330 3300044684 Ga0466966_0003637 Ga0466966_0003637_5200_6018 249
331 3300044693 Ga0466961_0089514 Ga0466961_0089514_375_1193 249
332 3300044694 Ga0466963_0028975 Ga0466963_0028975_1868_2686 249
333 3300044706 Ga0466964_0015842 Ga0466964_0015842_1943_2761 249
334 3300044735 Ga0466968_0011867 Ga0466968_0011867_1759_2577 249
335 3300044842 Ga0466957_0007432 Ga0466957_0007432_4171_4989 249
336 3300045049 Ga0466959_0013595 Ga0466959_0013595_5072_5890 249
337 3300045836 Ga0466958_0014268 Ga0466958_0014268_1922_2740 249
338 3300045976 Ga0466967_0407018 Ga0466967_0407018_392_1210 249
339 3300046462 Ga0495651_0091660 Ga0495651_0091660_749_1558 249
340 3300046492 Ga0495585_0035288 Ga0495585_0035288_1045_1824 249
341 3300046506 Ga0495583_0000166 Ga0495583_0000166_95762_96571 249
342 3300046507 Ga0495606_0001259 Ga0495606_0001259_16114_16923 249
343 3300046616 Ga0495668_0055819 Ga0495668_0055819_200_1009 249
344 3300046616 Ga0495668_0224176 Ga0495668_0224176_200_976 249
345 3300046660 Ga0495625_0018196 Ga0495625_0018196_3328_4137 249
346 3300046694 Ga0495649_0000998 Ga0495649_0000998_7122_7931 249
347 3300047318 Ga0495636_0093175 Ga0495636_0093175_418_1197 249
348 3300047323 Ga0495683_0021444 Ga0495683_0021444_993_1802 249
349 3300047472 Ga0495686_0019617 Ga0495686_0019617_1217_2026 249
350 3300048903 Ga0496100_0019488 Ga0496100_0019488_2909_3691 249
351 3300048904 Ga0496101_0074532 Ga0496101_0074532_1604_2371 249
352 3300048905 Ga0496102_0047216 Ga0496102_0047216_2464_3231 249
353 3300048908 Ga0496105_0065316 Ga0496105_0065316_1464_2246 249
354 3300048909 Ga0496106_0000127 Ga0496106_0000127_42901_43683 249
355 3300048910 Ga0496107_0010952 Ga0496107_0010952_3258_4040 249
356 3300048911 Ga0496108_0075723 Ga0496108_0075723_600_1382 249
357 3300048911 Ga0496108_0413944 Ga0496108_0413944_16_792 249
358 3300048913 Ga0496110_0517919 Ga0496110_0517919_308_1075 249
359 3300048914 Ga0496111_0048240 Ga0496111_0048240_76_843 249
360 3300048916 Ga0496113_0000269 Ga0496113_0000269_13840_14622 249
361 3300048917 Ga0496114_0021988 Ga0496114_0021988_2805_3572 249
362 3300048927 Ga0496124_0256439 Ga0496124_0256439_18_785 249
363 3300048928 Ga0496125_0055919 Ga0496125_0055919_2370_3125 249
364 3300048928 Ga0496125_0110502 Ga0496125_0110502_915_1682 249
365 3300048929 Ga0496126_0002609 Ga0496126_0002609_8452_9219 249
366 3300049581 Ga0501047_0011529 Ga0501047_0011529_6517_7287 249
367 3300049823 Ga0501044_0169315 Ga0501044_0169315_1052_1822 249
368 3300050496 nmdc:mga07m45_11219_c1 nmdc:mga07m45_11219_c1_3441_4250 249
369 3300053080 Ga0500635_0000182 Ga0500635_0000182_22886_23695 249
370 3300053080 Ga0500635_0007993 Ga0500635_0007993_1958_2767 249
371 3300053087 Ga0500643_000856 Ga0500643_000856_11274_12035 249
372 3300053136 Ga0500559_0042136 Ga0500559_0042136_898_1707 249
373 3300053177 Ga0500636_0003658 Ga0500636_0003658_4684_5493 249
374 3300061719 Ga0466962_0008587 Ga0466962_0008587_2527_3345 249
375 2162886007 SwRhRL2b_contig_1374729 SwRhRL2b_0675.00001350 250
376 3300001989 JGI24739J22299_10014105 JGI24739J22299_100141054 250
377 3300001990 JGI24737J22298_10004375 JGI24737J22298_100043754 250
378 3300005289 Ga0065704_10072447 Ga0065704_100724477 250
379 3300005331 Ga0070670_100121139 Ga0070670_1001211392 250
380 3300005347 Ga0070668_100009650 Ga0070668_1000096506 250
381 3300005353 Ga0070669_100057315 Ga0070669_1000573152 250
382 3300005365 Ga0070688_100627512 Ga0070688_1006275121 250
383 3300005366 Ga0070659_100029456 Ga0070659_1000294562 250
384 3300005539 Ga0068853_100080540 Ga0068853_1000805402 250
385 3300005548 Ga0070665_100049441 Ga0070665_1000494412 250
386 3300005563 Ga0068855_100397379 Ga0068855_1003973792 250
387 3300005616 Ga0068852_100267866 Ga0068852_1002678662 250
388 3300005618 Ga0068864_100061474 Ga0068864_1000614742 250
389 3300009011 Ga0105251_10016937 Ga0105251_100169372 250
390 3300009551 Ga0105238_10253732 Ga0105238_102537322 250
391 3300009553 Ga0105249_10059011 Ga0105249_100590114 250
392 3300009978 Ga0105148_100001 Ga0105148_10000146 250
393 3300017792 Ga0163161_10009072 Ga0163161_100090724 250
394 3300025923 Ga0207681_10031848 Ga0207681_100318482 250
395 3300025923 Ga0207681_10129426 Ga0207681_101294261 250
396 3300025923 Ga0207681_10594221 Ga0207681_105942211 250
397 3300025924 Ga0207694_10031066 Ga0207694_100310665 250
398 3300025933 Ga0207706_10045644 Ga0207706_100456443 250
399 3300025949 Ga0207667_10153815 Ga0207667_101538152 250
400 3300025961 Ga0207712_10034171 Ga0207712_100341712 250
401 3300026041 Ga0207639_10023474 Ga0207639_100234743 250
402 3300026095 Ga0207676_10030384 Ga0207676_100303842 250
403 3300026116 Ga0207674_10011852 Ga0207674_100118523 250
404 3300026142 Ga0207698_10203936 Ga0207698_102039361 250
405 3300026142 Ga0207698_10376490 Ga0207698_103764901 250
406 3300031731 Ga0307405_10005099 Ga0307405_100050997 250
407 3300031911 Ga0307412_10038992 Ga0307412_100389923 250
408 3300031911 Ga0307412_10300441 Ga0307412_103004412 250
409 3300032002 Ga0307416_100892674 Ga0307416_1008926742 250
410 3300032004 Ga0307414_10419371 Ga0307414_104193712 250
411 3300032005 Ga0307411_10017495 Ga0307411_100174952 250
412 3300048911 Ga0496108_0028638 Ga0496108_0028638_2590_3342 250
413 3300048911 Ga0496108_0312440 Ga0496108_0312440_121_873 250
414 3300048912 Ga0496109_0191973 Ga0496109_0191973_825_1577 250
415 3300048913 Ga0496110_0055094 Ga0496110_0055094_1651_2403 250
416 3300048913 Ga0496110_0061792 Ga0496110_0061792_2534_3286 250
417 3300048914 Ga0496111_0170901 Ga0496111_0170901_483_1235 250
418 3300048914 Ga0496111_0224299 Ga0496111_0224299_558_1310 250
419 3300048914 Ga0496111_0487867 Ga0496111_0487867_102_854 250
420 3300048921 Ga0496118_0126840 Ga0496118_0126840_771_1523 250
421 3300048924 Ga0496121_0001426 Ga0496121_0001426_14847_15599 250
422 3300048924 Ga0496121_0111566 Ga0496121_0111566_1064_1816 250
423 3300048925 Ga0496122_0011807 Ga0496122_0011807_5376_6128 250
424 3300048925 Ga0496122_0317083 Ga0496122_0317083_54_806 250
425 3300048926 Ga0496123_0025859 Ga0496123_0025859_1002_1754 250
426 3300048926 Ga0496123_0115091 Ga0496123_0115091_216_968 250
427 3300048927 Ga0496124_0019516 Ga0496124_0019516_2870_3622 250
428 3300048927 Ga0496124_0152623 Ga0496124_0152623_232_984 250
429 3300048928 Ga0496125_0000425 Ga0496125_0000425_74790_75542 250
430 3300048928 Ga0496125_0106570 Ga0496125_0106570_717_1469 250
431 3300048929 Ga0496126_0010007 Ga0496126_0010007_5277_6029 250
432 3300048929 Ga0496126_0025020 Ga0496126_0025020_4373_5125 250
433 3300049663 Ga0501223_000080 Ga0501223_000080_19039_19791 250
434 3300049669 Ga0501235_000785 Ga0501235_000785_3504_4256 250
435 3300049685 Ga0501256_005711 Ga0501256_005711_269_1021 250
436 3300049705 Ga0501225_0000092 Ga0501225_0000092_9052_9804 250
437 3300049705 Ga0501225_0004314 Ga0501225_0004314_2252_3004 250
438 3300049705 Ga0501225_0006131 Ga0501225_0006131_2497_3249 250
439 3300049708 Ga0501245_000399 Ga0501245_000399_1566_2318 250
440 3300053091 Ga0500647_0183056 Ga0500647_0183056_14_766 250
441 3300053108 Ga0500562_008184 Ga0500562_008184_140_892 250
442 3300053157 Ga0500624_000028 Ga0500624_000028_44886_45638 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

101

253

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.8979 85 225
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.897 91 226
1sox-assembly1.cif.gz_B sulfite oxidase from chicken liver 0.8966 89 226
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.8924 91 226
1ogp-assembly3.cif.gz_E the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals 0.8863 89 226
ID Description Score Start End Superfamily
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9154 89 226 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9138 89 226 3.90.420.10
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9008 91 226 3.90.420.10
af_A0A0R4IKF7_192_441_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8969 89 226 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8523 67 223 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A2P5MJH8-F1-model_v4 Molybdopterin-binding protein 0.9602 54 250
AF-A0A3D0WIJ7-F1-model_v4 deleted 0.9523 80 250
AF-A0A2P5MJH8-F1-model_v4 Molybdopterin-binding protein 0.9507 54 250
AF-A0A2V8MQD5-F1-model_v4 Molybdopterin-binding protein 0.9479 50 250
AF-A0A3S1HJU4-F1-model_v4 Molybdopterin oxidoreductase 0.9477 67 250

Feature Viewer

pLDDT pTM Quality
82.95 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map