F444926
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 442 | 279 | 423 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300044735|Ga0466968_0029256|Ga0466968_0029256_896_2062 |
| Length | 388 |
| Sequence | MAKKNLQRCFVRVKPKIIRIQQPCLNAGNYFCRVIDEPSQTKYMEYTTLGNTGLIVSKLAFGAMTFGNDASIKSVYKVDQQLAQEMINRSLEAGINFFDTADGYSNGQSETMLGKLLAPHRHEVIISTKVGFRTGQPVTQAGLSKKHILFSCEQSLKRLNTDYIDLYILHKEDPFTPLEETLAALNSLVEAGKVRYVGYSNWSAWKSALAYQLQKDNGWATFCNGQMNYSLVGRDVEYDVIPFMQHAGIGMTVWSPLASGFLSGKYTRENLKDPNNRLSGFDLLPFDKEQGFKVVDVLKEIASQQQASVAQTALAWLLAKPVVSSVIVGASKMHQLEDNLKAINVKLNPAQIQQLDAITKPGILYPHWFNQQLIDQKHKEIFSSTTQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 2 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 3 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 4 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 5 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 6 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 7 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 8 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 9 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 10 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 11 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 12 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 13 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 14 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 15 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 161 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 181 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 182 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 183 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 184 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 185 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 186 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 187 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 193 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 194 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 197 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 198 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 269 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 270 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 271 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 272 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 273 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 274 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 275 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 276 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 277 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 278 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 279 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.7 |
| Metatranscriptomes | 0 |
| Isolates | 4.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.88 |
| Nodule | 1.58 |
| Rhizoplane | 1.58 |
| Rhizosphere | 81.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10004604 | 3300001989 | Bacteria | 5274 |
| 2 | JGI25162J39368_1000223 | 3300002737 | Bacteria | 58437 |
| 3 | JGI25162J39368_1000305 | 3300002737 | Bacteria | 45039 |
| 4 | JGI25153J46596_10033647 | 3300003215 | Bacteria | 1689 |
| 5 | rootH1_10057445 | 3300003316 | Bacteria | 15175 |
| 6 | rootH2_10062707 | 3300003320 | Bacteria | 26576 |
| 7 | rootH2_10127796 | 3300003320 | Bacteria | 3621 |
| 8 | rootH2_10149170 | 3300003320 | Unclassified | 3344 |
| 9 | rootH2_10235252 | 3300003320 | Bacteria | 1475 |
| 10 | rootH2_10246733 | 3300003320 | Bacteria | 1474 |
| 11 | rootH2_10295873 | 3300003320 | Unclassified | 2596 |
| 12 | rootL2_10037395 | 3300003322 | Bacteria | 9152 |
| 13 | rootL2_10175820 | 3300003322 | Bacteria | 2101 |
| 14 | rootH1_10016736 | 3300003323 | Bacteria | 27879 |
| 15 | rootH1_10158222 | 3300003323 | Bacteria | 3085 |
| 16 | rootH1_10345561 | 3300003323 | Unclassified | 1611 |
| 17 | Ga0055526_1004431 | 3300003771 | Bacteria | 8439 |
| 18 | Ga0055526_1018038 | 3300003771 | Bacteria | 2657 |
| 19 | Ga0055528_1000180 | 3300003790 | Bacteria | 53597 |
| 20 | Ga0065165_1000019 | 3300005262 | Bacteria | 271815 |
| 21 | Ga0065712_10019742 | 3300005290 | Bacteria | 2246 |
| 22 | Ga0065712_10119487 | 3300005290 | Bacteria | 1683 |
| 23 | Ga0065715_10131967 | 3300005293 | Bacteria | 1977 |
| 24 | Ga0070658_10216718 | 3300005327 | Bacteria | 1618 |
| 25 | Ga0070683_100001153 | 3300005329 | Bacteria | 20002 |
| 26 | Ga0070683_100003365 | 3300005329 | Bacteria | 12956 |
| 27 | Ga0070683_100005006 | 3300005329 | Bacteria | 10998 |
| 28 | Ga0070683_100009403 | 3300005329 | Bacteria | 8359 |
| 29 | Ga0070683_100185353 | 3300005329 | Bacteria | 1975 |
| 30 | Ga0070670_100104883 | 3300005331 | Unclassified | 2435 |
| 31 | Ga0070666_10000307 | 3300005335 | Bacteria | 31713 |
| 32 | Ga0070680_100003763 | 3300005336 | Bacteria | 11338 |
| 33 | Ga0070680_100056279 | 3300005336 | Unclassified | 3215 |
| 34 | Ga0068868_100193085 | 3300005338 | Bacteria | 1694 |
| 35 | Ga0070660_100021530 | 3300005339 | Bacteria | 4756 |
| 36 | Ga0070689_100214582 | 3300005340 | Unclassified | 1576 |
| 37 | Ga0070691_10005990 | 3300005341 | Bacteria | 5548 |
| 38 | Ga0070687_100092305 | 3300005343 | Unclassified | 1677 |
| 39 | Ga0070661_100060265 | 3300005344 | Unclassified | 2785 |
| 40 | Ga0070675_100023295 | 3300005354 | Unclassified | 4950 |
| 41 | Ga0070671_100175894 | 3300005355 | Bacteria | 1811 |
| 42 | Ga0070673_100008398 | 3300005364 | Bacteria | 6864 |
| 43 | Ga0070714_100001231 | 3300005435 | Bacteria | 18476 |
| 44 | Ga0070714_100121064 | 3300005435 | Bacteria | 2328 |
| 45 | Ga0070714_100277763 | 3300005435 | Bacteria | 1555 |
| 46 | Ga0070713_100014373 | 3300005436 | Bacteria | 5877 |
| 47 | Ga0070713_100083140 | 3300005436 | Bacteria | 2736 |
| 48 | Ga0070663_100001290 | 3300005455 | Bacteria | 13731 |
| 49 | Ga0070678_100261273 | 3300005456 | Bacteria | 1456 |
| 50 | Ga0070662_100099275 | 3300005457 | Bacteria | 2200 |
| 51 | Ga0070681_10008049 | 3300005458 | Bacteria | 10318 |
| 52 | Ga0070681_10025709 | 3300005458 | Bacteria | 5921 |
| 53 | Ga0070681_10104144 | 3300005458 | Bacteria | 2780 |
| 54 | Ga0068867_100050482 | 3300005459 | Bacteria | 3066 |
| 55 | Ga0070679_100017740 | 3300005530 | Bacteria | 6890 |
| 56 | Ga0070679_100068366 | 3300005530 | Bacteria | 3544 |
| 57 | Ga0070684_100002184 | 3300005535 | Bacteria | 14445 |
| 58 | Ga0070684_100021376 | 3300005535 | Bacteria | 5383 |
| 59 | Ga0070684_100094752 | 3300005535 | Bacteria | 2659 |
| 60 | Ga0070684_100191414 | 3300005535 | Bacteria | 1861 |
| 61 | Ga0068853_100004903 | 3300005539 | Bacteria | 10413 |
| 62 | Ga0068853_100041970 | 3300005539 | Bacteria | 3909 |
| 63 | Ga0068853_100184922 | 3300005539 | Unclassified | 1891 |
| 64 | Ga0068853_100239339 | 3300005539 | Bacteria | 1663 |
| 65 | Ga0070686_100079291 | 3300005544 | Unclassified | 2170 |
| 66 | Ga0070693_100141658 | 3300005547 | Bacteria | 1514 |
| 67 | Ga0070665_100017981 | 3300005548 | Bacteria | 7097 |
| 68 | Ga0070665_100024306 | 3300005548 | Bacteria | 6100 |
| 69 | Ga0070704_100357178 | 3300005549 | Bacteria | 1235 |
| 70 | Ga0068855_100004019 | 3300005563 | Bacteria | 17967 |
| 71 | Ga0068855_100014907 | 3300005563 | Bacteria | 9364 |
| 72 | Ga0068855_100287874 | 3300005563 | Bacteria | 1822 |
| 73 | Ga0068855_100334767 | 3300005563 | Bacteria | 1670 |
| 74 | Ga0070664_100000069 | 3300005564 | Bacteria | 63932 |
| 75 | Ga0070664_100064316 | 3300005564 | Bacteria | 3129 |
| 76 | Ga0068857_100004743 | 3300005577 | Bacteria | 11517 |
| 77 | Ga0068857_100044099 | 3300005577 | Unclassified | 3955 |
| 78 | Ga0068857_100053344 | 3300005577 | Unclassified | 3587 |
| 79 | Ga0068854_100030046 | 3300005578 | Bacteria | 3766 |
| 80 | Ga0068856_100004931 | 3300005614 | Bacteria | 13214 |
| 81 | Ga0068856_100015863 | 3300005614 | Bacteria | 7285 |
| 82 | Ga0068856_100071334 | 3300005614 | Unclassified | 3439 |
| 83 | Ga0068852_100028722 | 3300005616 | Bacteria | 4558 |
| 84 | Ga0068852_100077300 | 3300005616 | Bacteria | 2942 |
| 85 | Ga0068864_100017568 | 3300005618 | Bacteria | 5963 |
| 86 | Ga0068851_10032028 | 3300005834 | Bacteria | 2614 |
| 87 | Ga0068863_100080055 | 3300005841 | Bacteria | 3094 |
| 88 | Ga0068858_100024022 | 3300005842 | Bacteria | 5680 |
| 89 | Ga0068858_100387966 | 3300005842 | Bacteria | 1341 |
| 90 | Ga0081455_10000011 | 3300005937 | Bacteria | 203132 |
| 91 | Ga0070717_10096082 | 3300006028 | Bacteria | 2509 |
| 92 | Ga0070717_10154700 | 3300006028 | Bacteria | 1986 |
| 93 | Ga0070717_10485719 | 3300006028 | Bacteria | 1115 |
| 94 | Ga0097621_100009107 | 3300006237 | Bacteria | 7195 |
| 95 | Ga0097621_100026778 | 3300006237 | Bacteria | 4527 |
| 96 | Ga0068871_100047211 | 3300006358 | Bacteria | 3472 |
| 97 | Ga0068871_100057255 | 3300006358 | Bacteria | 3171 |
| 98 | Ga0075428_100003973 | 3300006844 | Bacteria | 16228 |
| 99 | Ga0075428_100116247 | 3300006844 | Bacteria | 2913 |
| 100 | Ga0075428_100262158 | 3300006844 | Bacteria | 1861 |
| 101 | Ga0075430_100120712 | 3300006846 | Bacteria | 2185 |
| 102 | Ga0075430_100167527 | 3300006846 | Bacteria | 1828 |
| 103 | Ga0075431_100033221 | 3300006847 | Bacteria | 5317 |
| 104 | Ga0075431_100062562 | 3300006847 | Bacteria | 3840 |
| 105 | Ga0075431_100347645 | 3300006847 | Bacteria | 1491 |
| 106 | Ga0075434_100222702 | 3300006871 | Bacteria | 1906 |
| 107 | Ga0075429_100060518 | 3300006880 | Bacteria | 3298 |
| 108 | Ga0075429_100065557 | 3300006880 | Bacteria | 3162 |
| 109 | Ga0068865_100020749 | 3300006881 | Bacteria | 4264 |
| 110 | Ga0075436_100049111 | 3300006914 | Bacteria | 2911 |
| 111 | Ga0105240_10000457 | 3300009093 | Bacteria | 75275 |
| 112 | Ga0105240_10069090 | 3300009093 | Unclassified | 4373 |
| 113 | Ga0105240_10142486 | 3300009093 | Bacteria | 2864 |
| 114 | Ga0105240_10171793 | 3300009093 | Bacteria | 2566 |
| 115 | Ga0111539_10149909 | 3300009094 | Bacteria | 2730 |
| 116 | Ga0111539_10227120 | 3300009094 | Bacteria | 2174 |
| 117 | Ga0105245_10000995 | 3300009098 | Bacteria | 25730 |
| 118 | Ga0114129_10116601 | 3300009147 | Bacteria | 3680 |
| 119 | Ga0114129_10327559 | 3300009147 | Bacteria | 2035 |
| 120 | Ga0114129_10350344 | 3300009147 | Bacteria | 1956 |
| 121 | Ga0105241_10000714 | 3300009174 | Bacteria | 25119 |
| 122 | Ga0105241_10003993 | 3300009174 | Bacteria | 10905 |
| 123 | Ga0105241_10057595 | 3300009174 | Bacteria | 2982 |
| 124 | Ga0105241_10059953 | 3300009174 | Bacteria | 2927 |
| 125 | Ga0105242_10064141 | 3300009176 | Bacteria | 3027 |
| 126 | Ga0105242_10166588 | 3300009176 | Bacteria | 1933 |
| 127 | Ga0105248_10010010 | 3300009177 | Bacteria | 10438 |
| 128 | Ga0105248_10017519 | 3300009177 | Bacteria | 7899 |
| 129 | Ga0105237_10004841 | 3300009545 | Bacteria | 15465 |
| 130 | Ga0105237_10011895 | 3300009545 | Bacteria | 9203 |
| 131 | Ga0105237_10014459 | 3300009545 | Bacteria | 8251 |
| 132 | Ga0105237_10213109 | 3300009545 | Bacteria | 1931 |
| 133 | Ga0105237_10337965 | 3300009545 | Bacteria | 1510 |
| 134 | Ga0105238_10003582 | 3300009551 | Bacteria | 15484 |
| 135 | Ga0105238_10008740 | 3300009551 | Bacteria | 10133 |
| 136 | Ga0105238_10011865 | 3300009551 | Bacteria | 8776 |
| 137 | Ga0105239_10000604 | 3300010375 | Bacteria | 51154 |
| 138 | Ga0105239_10001438 | 3300010375 | Bacteria | 31747 |
| 139 | Ga0105239_10001560 | 3300010375 | Bacteria | 30320 |
| 140 | Ga0105239_10004033 | 3300010375 | Bacteria | 17765 |
| 141 | Ga0105239_10035014 | 3300010375 | Bacteria | 5514 |
| 142 | Ga0105239_10325381 | 3300010375 | Bacteria | 1734 |
| 143 | Ga0105239_10393955 | 3300010375 | Bacteria | 1567 |
| 144 | Ga0105239_10442003 | 3300010375 | Bacteria | 1475 |
| 145 | Ga0157371_10188123 | 3300013102 | Bacteria | 1478 |
| 146 | Ga0157370_10012271 | 3300013104 | Bacteria | 8894 |
| 147 | Ga0157369_10003094 | 3300013105 | Bacteria | 19881 |
| 148 | Ga0157369_10060843 | 3300013105 | Bacteria | 4072 |
| 149 | Ga0157369_10159337 | 3300013105 | Bacteria | 2383 |
| 150 | Ga0157369_10634603 | 3300013105 | Bacteria | 1102 |
| 151 | Ga0157374_10000015 | 3300013296 | Bacteria | 296773 |
| 152 | Ga0157374_10105479 | 3300013296 | Bacteria | 2707 |
| 153 | Ga0157374_10106294 | 3300013296 | Bacteria | 2696 |
| 154 | Ga0157378_10003102 | 3300013297 | Bacteria | 14775 |
| 155 | Ga0163162_10001514 | 3300013306 | Bacteria | 21645 |
| 156 | Ga0163162_10312512 | 3300013306 | Bacteria | 1704 |
| 157 | Ga0157372_10010127 | 3300013307 | Bacteria | 10015 |
| 158 | Ga0157372_10010551 | 3300013307 | Bacteria | 9825 |
| 159 | Ga0157372_10190592 | 3300013307 | Bacteria | 2375 |
| 160 | Ga0163163_10246815 | 3300014325 | Unclassified | 1835 |
| 161 | Ga0157380_10005132 | 3300014326 | Bacteria | 9151 |
| 162 | Ga0182008_10079634 | 3300014497 | Bacteria | 1612 |
| 163 | Ga0157379_10348245 | 3300014968 | Unclassified | 1356 |
| 164 | Ga0157376_10012172 | 3300014969 | Bacteria | 6375 |
| 165 | Ga0182006_1017861 | 3300015261 | Bacteria | 3006 |
| 166 | Ga0182007_10009845 | 3300015262 | Bacteria | 3815 |
| 167 | Ga0163161_10060951 | 3300017792 | Bacteria | 2747 |
| 168 | Ga0213875_10105022 | 3300021388 | Bacteria | 1319 |
| 169 | Ga0209437_100070 | 3300025233 | Bacteria | 306718 |
| 170 | Ga0209673_1000042 | 3300025273 | Bacteria | 300704 |
| 171 | Ga0209564_1000840 | 3300025295 | Bacteria | 41373 |
| 172 | Ga0209564_1004230 | 3300025295 | Bacteria | 8928 |
| 173 | Ga0209564_1029372 | 3300025295 | Bacteria | 1732 |
| 174 | Ga0209758_1001003 | 3300025297 | Bacteria | 37543 |
| 175 | Ga0209758_1003437 | 3300025297 | Bacteria | 14408 |
| 176 | Ga0209050_1000308 | 3300025298 | Bacteria | 99516 |
| 177 | Ga0207426_1000934 | 3300025302 | Bacteria | 29145 |
| 178 | Ga0209051_1039253 | 3300025303 | Bacteria | 1713 |
| 179 | Ga0209257_1001059 | 3300025304 | Bacteria | 36382 |
| 180 | Ga0207656_10049059 | 3300025321 | Bacteria | 1819 |
| 181 | Ga0207647_10005843 | 3300025904 | Bacteria | 8973 |
| 182 | Ga0207705_10291331 | 3300025909 | Bacteria | 1251 |
| 183 | Ga0207654_10027991 | 3300025911 | Bacteria | 3069 |
| 184 | Ga0207707_10001082 | 3300025912 | Bacteria | 26051 |
| 185 | Ga0207707_10018467 | 3300025912 | Bacteria | 6080 |
| 186 | Ga0207707_10073135 | 3300025912 | Bacteria | 2989 |
| 187 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 188 | Ga0207695_10000156 | 3300025913 | Bacteria | 204576 |
| 189 | Ga0207695_10000778 | 3300025913 | Bacteria | 60342 |
| 190 | Ga0207695_10001264 | 3300025913 | Bacteria | 43057 |
| 191 | Ga0207695_10003542 | 3300025913 | Bacteria | 21871 |
| 192 | Ga0207695_10054011 | 3300025913 | Bacteria | 4199 |
| 193 | Ga0207695_10125850 | 3300025913 | Bacteria | 2525 |
| 194 | Ga0207695_10139691 | 3300025913 | Bacteria | 2372 |
| 195 | Ga0207671_10000594 | 3300025914 | Bacteria | 48267 |
| 196 | Ga0207671_10000750 | 3300025914 | Bacteria | 41189 |
| 197 | Ga0207671_10003366 | 3300025914 | Bacteria | 16036 |
| 198 | Ga0207671_10008731 | 3300025914 | Bacteria | 8540 |
| 199 | Ga0207693_10220941 | 3300025915 | Bacteria | 1488 |
| 200 | Ga0207662_10130155 | 3300025918 | Unclassified | 1586 |
| 201 | Ga0207657_10018771 | 3300025919 | Bacteria | 6588 |
| 202 | Ga0207657_10086454 | 3300025919 | Bacteria | 2624 |
| 203 | Ga0207649_10033256 | 3300025920 | Bacteria | 3079 |
| 204 | Ga0207652_10006515 | 3300025921 | Bacteria | 9413 |
| 205 | Ga0207694_10000985 | 3300025924 | Bacteria | 24968 |
| 206 | Ga0207694_10004729 | 3300025924 | Bacteria | 10594 |
| 207 | Ga0207694_10013630 | 3300025924 | Bacteria | 6129 |
| 208 | Ga0207694_10027019 | 3300025924 | Bacteria | 4369 |
| 209 | Ga0207694_10057807 | 3300025924 | Bacteria | 3016 |
| 210 | Ga0207650_10021072 | 3300025925 | Bacteria | 4605 |
| 211 | Ga0207687_10001118 | 3300025927 | Bacteria | 18248 |
| 212 | Ga0207687_10001962 | 3300025927 | Bacteria | 14159 |
| 213 | Ga0207700_10150511 | 3300025928 | Bacteria | 1922 |
| 214 | Ga0207664_10004048 | 3300025929 | Bacteria | 9877 |
| 215 | Ga0207664_10086034 | 3300025929 | Bacteria | 2567 |
| 216 | Ga0207664_10148382 | 3300025929 | Bacteria | 1990 |
| 217 | Ga0207644_10145902 | 3300025931 | Bacteria | 1827 |
| 218 | Ga0207706_10184679 | 3300025933 | Bacteria | 1831 |
| 219 | Ga0207686_10029808 | 3300025934 | Bacteria | 3223 |
| 220 | Ga0207686_10054779 | 3300025934 | Bacteria | 2500 |
| 221 | Ga0207670_10242642 | 3300025936 | Unclassified | 1389 |
| 222 | Ga0207665_10166935 | 3300025939 | Bacteria | 1587 |
| 223 | Ga0207691_10034449 | 3300025940 | Bacteria | 4708 |
| 224 | Ga0207711_10009271 | 3300025941 | Bacteria | 8217 |
| 225 | Ga0207711_10031419 | 3300025941 | Bacteria | 4482 |
| 226 | Ga0207661_10000365 | 3300025944 | Bacteria | 29025 |
| 227 | Ga0207661_10069133 | 3300025944 | Bacteria | 2878 |
| 228 | Ga0207679_10133661 | 3300025945 | Unclassified | 1994 |
| 229 | Ga0207667_10002201 | 3300025949 | Bacteria | 24454 |
| 230 | Ga0207667_10006940 | 3300025949 | Bacteria | 13685 |
| 231 | Ga0207667_10008600 | 3300025949 | Bacteria | 12112 |
| 232 | Ga0207667_10278127 | 3300025949 | Bacteria | 1711 |
| 233 | Ga0207658_10051933 | 3300025986 | Unclassified | 3023 |
| 234 | Ga0207677_10036712 | 3300026023 | Unclassified | 3197 |
| 235 | Ga0207703_10274232 | 3300026035 | Bacteria | 1529 |
| 236 | Ga0207639_10063628 | 3300026041 | Bacteria | 2857 |
| 237 | Ga0207639_10276646 | 3300026041 | Bacteria | 1475 |
| 238 | Ga0207678_10004649 | 3300026067 | Bacteria | 12329 |
| 239 | Ga0207702_10007555 | 3300026078 | Bacteria | 9266 |
| 240 | Ga0207702_10069529 | 3300026078 | Bacteria | 3027 |
| 241 | Ga0207648_10018872 | 3300026089 | Bacteria | 6231 |
| 242 | Ga0207676_10074732 | 3300026095 | Unclassified | 2732 |
| 243 | Ga0207676_10249384 | 3300026095 | Bacteria | 1597 |
| 244 | Ga0207674_10000042 | 3300026116 | Bacteria | 126790 |
| 245 | Ga0207674_10004196 | 3300026116 | Bacteria | 17388 |
| 246 | Ga0207674_10071734 | 3300026116 | Unclassified | 3479 |
| 247 | Ga0207683_10111839 | 3300026121 | Bacteria | 2445 |
| 248 | Ga0207698_10006089 | 3300026142 | Bacteria | 7505 |
| 249 | Ga0207698_10055625 | 3300026142 | Bacteria | 3051 |
| 250 | Ga0209995_1009365 | 3300027471 | Bacteria | 1583 |
| 251 | Ga0207428_10142806 | 3300027907 | Bacteria | 1826 |
| 252 | Ga0268266_10038860 | 3300028379 | Bacteria | 4052 |
| 253 | Ga0265337_1004614 | 3300028556 | Bacteria | 5676 |
| 254 | Ga0265334_10030658 | 3300028573 | Bacteria | 2151 |
| 255 | Ga0265338_10006310 | 3300028800 | Bacteria | 15156 |
| 256 | Ga0265338_10135247 | 3300028800 | Bacteria | 1939 |
| 257 | Ga0265320_10028280 | 3300031240 | Bacteria | 2913 |
| 258 | Ga0265340_10009286 | 3300031247 | Bacteria | 5281 |
| 259 | Ga0265340_10045283 | 3300031247 | Bacteria | 2150 |
| 260 | Ga0265313_10023853 | 3300031595 | Bacteria | 3285 |
| 261 | Ga0307514_10008253 | 3300031649 | Bacteria | 8887 |
| 262 | Ga0265314_10000503 | 3300031711 | Bacteria | 50401 |
| 263 | Ga0265314_10091245 | 3300031711 | Bacteria | 1983 |
| 264 | Ga0307516_10046117 | 3300031730 | Bacteria | 4302 |
| 265 | Ga0316577_10082895 | 3300031733 | Unclassified | 1794 |
| 266 | Ga0307510_10007386 | 3300033180 | Bacteria | 13103 |
| 267 | Ga0307510_10054704 | 3300033180 | Bacteria | 4177 |
| 268 | Ga0373934_0006121 | 3300035086 | Bacteria | 4457 |
| 269 | Ga0373934_0011706 | 3300035086 | Bacteria | 3303 |
| 270 | Ga0373923_0019041 | 3300035111 | Bacteria | 2652 |
| 271 | Ga0373923_0038528 | 3300035111 | Bacteria | 1959 |
| 272 | Ga0373923_0061490 | 3300035111 | Bacteria | 1596 |
| 273 | Ga0373936_0010781 | 3300035113 | Bacteria | 3450 |
| 274 | Ga0373953_0009641 | 3300035117 | Bacteria | 3331 |
| 275 | Ga0373954_0002721 | 3300035118 | Bacteria | 7445 |
| 276 | Ga0373954_0006277 | 3300035118 | Bacteria | 5181 |
| 277 | Ga0373954_0049152 | 3300035118 | Bacteria | 1977 |
| 278 | Ga0373956_0051409 | 3300035119 | Bacteria | 1852 |
| 279 | Ga0373956_0070830 | 3300035119 | Bacteria | 1591 |
| 280 | Ga0373956_0090159 | 3300035119 | Bacteria | 1414 |
| 281 | Ga0373956_0111867 | 3300035119 | Bacteria | 1271 |
| 282 | Ga0373956_0127876 | 3300035119 | Bacteria | 1188 |
| 283 | Ga0373957_0035068 | 3300035120 | Bacteria | 1862 |
| 284 | Ga0373943_0111305 | 3300035170 | Bacteria | 1445 |
| 285 | Ga0373955_0033496 | 3300035172 | Bacteria | 2706 |
| 286 | Ga0373955_0046947 | 3300035172 | Bacteria | 2337 |
| 287 | Ga0373924_0023130 | 3300035410 | Bacteria | 2434 |
| 288 | Ga0373933_0008498 | 3300035724 | Bacteria | 5603 |
| 289 | Ga0373933_0073328 | 3300035724 | Bacteria | 2085 |
| 290 | Ga0373937_0022414 | 3300036401 | Bacteria | 5678 |
| 291 | Ga0373937_0068216 | 3300036401 | Bacteria | 3278 |
| 292 | Ga0373937_0072145 | 3300036401 | Bacteria | 3184 |
| 293 | Ga0373937_0139648 | 3300036401 | Bacteria | 2266 |
| 294 | Ga0373925_0017557 | 3300037068 | Bacteria | 5189 |
| 295 | Ga0395900_0168880 | 3300037418 | Bacteria | 2228 |
| 296 | Ga0395898_0360400 | 3300037466 | Bacteria | 1386 |
| 297 | Ga0395905_0122180 | 3300037471 | Bacteria | 2448 |
| 298 | Ga0436364_0267374 | 3300037853 | Bacteria | 1365 |
| 299 | Ga0436361_1038323 | 3300039447 | Bacteria | 2363 |
| 300 | Ga0451839_0077038 | 3300041496 | Bacteria | 2526 |
| 301 | Ga0451841_0948534 | 3300041498 | Bacteria | 1785 |
| 302 | Ga0451845_0598475 | 3300041501 | Bacteria | 2328 |
| 303 | Ga0451847_0802911 | 3300041503 | Bacteria | 5131 |
| 304 | Ga0451849_0697350 | 3300041505 | Bacteria | 4693 |
| 305 | Ga0451851_0043303 | 3300041507 | Bacteria | 3730 |
| 306 | Ga0451851_0263386 | 3300041507 | Bacteria | 1740 |
| 307 | Ga0451843_1430367 | 3300041509 | Bacteria | 2686 |
| 308 | Ga0451853_0771661 | 3300041512 | Bacteria | 2980 |
| 309 | Ga0439449_0129596 | 3300042007 | Bacteria | 937 |
| 310 | Ga0451577_0090108 | 3300042876 | Bacteria | 2737 |
| 311 | Ga0466969_0003242 | 3300044656 | Bacteria | 8658 |
| 312 | Ga0466972_0000023 | 3300044658 | Bacteria | 192679 |
| 313 | Ga0466972_0000831 | 3300044658 | Bacteria | 14787 |
| 314 | Ga0466972_0012822 | 3300044658 | Bacteria | 4210 |
| 315 | Ga0466965_0001992 | 3300044683 | Bacteria | 8543 |
| 316 | Ga0466965_0020562 | 3300044683 | Bacteria | 3174 |
| 317 | Ga0466966_0004250 | 3300044684 | Bacteria | 9447 |
| 318 | Ga0466963_0002639 | 3300044694 | Bacteria | 10072 |
| 319 | Ga0466964_0000086 | 3300044706 | Bacteria | 21639 |
| 320 | Ga0466971_0000313 | 3300044719 | Bacteria | 18671 |
| 321 | Ga0466968_0029256 | 3300044735 | Bacteria | 2278 |
| 322 | Ga0466968_0029445 | 3300044735 | Bacteria | 2271 |
| 323 | Ga0466957_0035667 | 3300044842 | Bacteria | 2985 |
| 324 | Ga0466957_0125670 | 3300044842 | Bacteria | 1638 |
| 325 | Ga0466959_0014772 | 3300045049 | Bacteria | 5683 |
| 326 | Ga0466958_0084043 | 3300045836 | Bacteria | 1963 |
| 327 | Ga0466958_0125693 | 3300045836 | Bacteria | 1608 |
| 328 | Ga0495592_0028935 | 3300046454 | Bacteria | 4194 |
| 329 | Ga0495651_0054698 | 3300046462 | Bacteria | 3068 |
| 330 | Ga0495651_0062287 | 3300046462 | Bacteria | 2854 |
| 331 | Ga0495653_0052120 | 3300046463 | Bacteria | 3137 |
| 332 | Ga0495580_0103101 | 3300046472 | Bacteria | 1983 |
| 333 | Ga0495580_0212511 | 3300046472 | Bacteria | 1331 |
| 334 | Ga0495582_0002852 | 3300046473 | Bacteria | 9672 |
| 335 | Ga0495662_0055863 | 3300046476 | Bacteria | 1907 |
| 336 | Ga0495664_0045293 | 3300046477 | Bacteria | 2609 |
| 337 | Ga0495606_0012416 | 3300046507 | Bacteria | 6832 |
| 338 | Ga0495608_0012083 | 3300046511 | Bacteria | 6002 |
| 339 | Ga0495618_0009264 | 3300046514 | Bacteria | 5941 |
| 340 | Ga0495618_0077422 | 3300046514 | Bacteria | 2119 |
| 341 | Ga0495620_0017527 | 3300046515 | Bacteria | 3566 |
| 342 | Ga0495628_0009098 | 3300046516 | Bacteria | 8497 |
| 343 | Ga0495628_0095515 | 3300046516 | Bacteria | 2297 |
| 344 | Ga0495631_0035662 | 3300046518 | Bacteria | 2224 |
| 345 | Ga0495648_0007545 | 3300046524 | Bacteria | 8694 |
| 346 | Ga0495648_0030631 | 3300046524 | Bacteria | 3554 |
| 347 | Ga0495652_0058029 | 3300046529 | Bacteria | 3280 |
| 348 | Ga0495652_0331510 | 3300046529 | Unclassified | 1096 |
| 349 | Ga0495654_0000148 | 3300046530 | Bacteria | 72863 |
| 350 | Ga0495665_0063585 | 3300046531 | Bacteria | 1948 |
| 351 | Ga0495586_0009311 | 3300046535 | Bacteria | 5224 |
| 352 | Ga0495587_0160752 | 3300046536 | Bacteria | 1278 |
| 353 | Ga0495667_0043733 | 3300046559 | Bacteria | 2967 |
| 354 | Ga0495668_0013332 | 3300046616 | Bacteria | 4854 |
| 355 | Ga0495611_0091165 | 3300046648 | Bacteria | 1409 |
| 356 | Ga0495625_0020002 | 3300046660 | Bacteria | 5177 |
| 357 | Ga0495625_0091809 | 3300046660 | Bacteria | 2098 |
| 358 | Ga0495657_0083390 | 3300046675 | Bacteria | 2063 |
| 359 | Ga0495599_0038056 | 3300046678 | Bacteria | 3022 |
| 360 | Ga0495658_0072791 | 3300046683 | Bacteria | 1999 |
| 361 | Ga0495669_0001666 | 3300046684 | Bacteria | 9110 |
| 362 | Ga0495613_0049747 | 3300046689 | Bacteria | 3092 |
| 363 | Ga0495613_0206611 | 3300046689 | Bacteria | 1382 |
| 364 | Ga0495600_0034644 | 3300046809 | Bacteria | 3278 |
| 365 | Ga0495660_0026969 | 3300046810 | Bacteria | 3252 |
| 366 | Ga0495675_0167412 | 3300047444 | Bacteria | 1351 |
| 367 | Ga0495677_0023044 | 3300047445 | Bacteria | 2260 |
| 368 | Ga0495684_0008121 | 3300047471 | Bacteria | 8117 |
| 369 | Ga0495684_0063526 | 3300047471 | Bacteria | 2806 |
| 370 | Ga0495602_0315738 | 3300048088 | Bacteria | 1139 |
| 371 | Ga0496101_0161336 | 3300048904 | Bacteria | 1719 |
| 372 | Ga0496102_0088800 | 3300048905 | Bacteria | 2858 |
| 373 | Ga0496104_0075841 | 3300048907 | Bacteria | 3202 |
| 374 | Ga0496112_0044112 | 3300048915 | Bacteria | 4368 |
| 375 | Ga0496112_0428527 | 3300048915 | Bacteria | 1261 |
| 376 | Ga0496113_0052137 | 3300048916 | Bacteria | 3054 |
| 377 | Ga0496115_0184320 | 3300048918 | Bacteria | 1725 |
| 378 | Ga0496120_0020407 | 3300048923 | Bacteria | 4212 |
| 379 | Ga0496121_0023720 | 3300048924 | Bacteria | 5896 |
| 380 | Ga0496122_0063586 | 3300048925 | Bacteria | 2691 |
| 381 | Ga0496123_0073569 | 3300048926 | Bacteria | 2119 |
| 382 | Ga0496124_0001021 | 3300048927 | Bacteria | 44387 |
| 383 | Ga0496124_0025118 | 3300048927 | Bacteria | 5402 |
| 384 | Ga0496125_0020627 | 3300048928 | Bacteria | 6181 |
| 385 | Ga0496126_0003662 | 3300048929 | Bacteria | 19191 |
| 386 | Ga0496126_0040384 | 3300048929 | Bacteria | 4325 |
| 387 | Ga0501032_0150359 | 3300049569 | Bacteria | 1531 |
| 388 | Ga0501033_0323287 | 3300049570 | Bacteria | 1083 |
| 389 | Ga0501034_0302007 | 3300049571 | Bacteria | 1537 |
| 390 | Ga0501034_0372817 | 3300049571 | Bacteria | 1353 |
| 391 | Ga0501038_0095287 | 3300049574 | Bacteria | 2486 |
| 392 | Ga0501042_0007055 | 3300049578 | Bacteria | 7340 |
| 393 | Ga0501047_0420098 | 3300049581 | Bacteria | 1169 |
| 394 | Ga0501035_0071240 | 3300049822 | Bacteria | 3078 |
| 395 | Ga0501035_0246698 | 3300049822 | Bacteria | 1517 |
| 396 | Ga0501044_0323678 | 3300049823 | Bacteria | 1465 |
| 397 | Ga0501044_0389812 | 3300049823 | Bacteria | 1307 |
| 398 | nmdc:mga06z11_129552_c1 | 3300050494 | Bacteria | 1415 |
| 399 | nmdc:mga05p37_160448_c1 | 3300050507 | Bacteria | 2747 |
| 400 | nmdc:mga05p37_229846_c1 | 3300050507 | Bacteria | 2236 |
| 401 | nmdc:mga05p37_45803_c1 | 3300050507 | Bacteria | 5379 |
| 402 | nmdc:mga09592_121921_c1 | 3300050508 | Bacteria | 2239 |
| 403 | nmdc:mga09592_28533_c1 | 3300050508 | Bacteria | 4636 |
| 404 | nmdc:mga09592_86178_c1 | 3300050508 | Bacteria | 2680 |
| 405 | nmdc:mga0qj67_121702_c1 | 3300050509 | Bacteria | 2111 |
| 406 | nmdc:mga0qj67_341931_c1 | 3300050509 | Bacteria | 1210 |
| 407 | nmdc:mga06r32_51024_c1 | 3300050510 | Bacteria | 3958 |
| 408 | nmdc:mga08y16_106311_c1 | 3300050511 | Bacteria | 2921 |
| 409 | nmdc:mga0n895_527815_c1 | 3300050512 | Bacteria | 1188 |
| 410 | nmdc:mga08x19_36263_c1 | 3300050514 | Bacteria | 3123 |
| 411 | nmdc:mga0a205_236150_c1 | 3300050515 | Bacteria | 1710 |
| 412 | Ga0495612_0005485 | 3300053078 | Bacteria | 5244 |
| 413 | Ga0495619_0045523 | 3300053085 | Bacteria | 2883 |
| 414 | Ga0495619_0057718 | 3300053085 | Bacteria | 2576 |
| 415 | Ga0495619_0150978 | 3300053085 | Bacteria | 1603 |
| 416 | Ga0500578_0050774 | 3300053086 | Bacteria | 2659 |
| 417 | Ga0500643_003110 | 3300053087 | Bacteria | 8147 |
| 418 | Ga0500562_003493 | 3300053108 | Bacteria | 3940 |
| 419 | Ga0500592_002745 | 3300053116 | Bacteria | 2838 |
| 420 | Ga0500573_0016177 | 3300053140 | Bacteria | 4232 |
| 421 | Ga0500616_0000985 | 3300053153 | Bacteria | 30767 |
| 422 | Ga0500622_0001932 | 3300053156 | Bacteria | 15629 |
| 423 | Ga0466962_0000567 | 3300061719 | Bacteria | 16227 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041507 | Ga0451851_0263386 | Ga0451851_0263386_94_915 | 266 |
| 2 | 3300042007 | Ga0439449_0129596 | Ga0439449_0129596_61_915 | 276 |
| 3 | 3300048924 | Ga0496121_0023720 | Ga0496121_0023720_5004_5879 | 279 |
| 4 | 3300035119 | Ga0373956_0127876 | Ga0373956_0127876_270_1172 | 289 |
| 5 | 3300048928 | Ga0496125_0020627 | Ga0496125_0020627_4136_5059 | 295 |
| 6 | 3300005340 | Ga0070689_100214582 | Ga0070689_1002145821 | 311 |
| 7 | 3300025936 | Ga0207670_10242642 | Ga0207670_102426421 | 311 |
| 8 | 3300035119 | Ga0373956_0070830 | Ga0373956_0070830_495_1520 | 311 |
| 9 | 3300035172 | Ga0373955_0046947 | Ga0373955_0046947_285_1310 | 311 |
| 10 | 3300036401 | Ga0373937_0139648 | Ga0373937_0139648_1020_2045 | 311 |
| 11 | 3300046477 | Ga0495664_0045293 | Ga0495664_0045293_1128_2153 | 311 |
| 12 | iso_pu_bacteria | 2728369276 | 2729907723 | 312 |
| 13 | 3300044658 | Ga0466972_0000831 | Ga0466972_0000831_5659_6687 | 314 |
| 14 | 3300044683 | Ga0466965_0001992 | Ga0466965_0001992_3776_4804 | 314 |
| 15 | iso_pu_bacteria | 643348564 | 643599998 | 314 |
| 16 | 3300044683 | Ga0466965_0020562 | Ga0466965_0020562_896_1903 | 315 |
| 17 | 3300048927 | Ga0496124_0025118 | Ga0496124_0025118_1237_2220 | 315 |
| 18 | 3300005327 | Ga0070658_10216718 | Ga0070658_102167182 | 316 |
| 19 | 3300005435 | Ga0070714_100001231 | Ga0070714_10000123110 | 316 |
| 20 | 3300005539 | Ga0068853_100239339 | Ga0068853_1002393391 | 316 |
| 21 | 3300005548 | Ga0070665_100024306 | Ga0070665_1000243064 | 316 |
| 22 | 3300005563 | Ga0068855_100334767 | Ga0068855_1003347672 | 316 |
| 23 | 3300005578 | Ga0068854_100030046 | Ga0068854_1000300463 | 316 |
| 24 | 3300005616 | Ga0068852_100028722 | Ga0068852_1000287223 | 316 |
| 25 | 3300006028 | Ga0070717_10154700 | Ga0070717_101547002 | 316 |
| 26 | 3300009174 | Ga0105241_10000714 | Ga0105241_100007144 | 316 |
| 27 | 3300009545 | Ga0105237_10337965 | Ga0105237_103379651 | 316 |
| 28 | 3300010375 | Ga0105239_10325381 | Ga0105239_103253812 | 316 |
| 29 | 3300013296 | Ga0157374_10106294 | Ga0157374_101062942 | 316 |
| 30 | 3300025904 | Ga0207647_10005843 | Ga0207647_100058432 | 316 |
| 31 | 3300025913 | Ga0207695_10003542 | Ga0207695_100035423 | 316 |
| 32 | 3300025914 | Ga0207671_10000594 | Ga0207671_1000059432 | 316 |
| 33 | 3300025914 | Ga0207671_10000750 | Ga0207671_1000075026 | 316 |
| 34 | 3300025924 | Ga0207694_10004729 | Ga0207694_100047293 | 316 |
| 35 | 3300025929 | Ga0207664_10004048 | Ga0207664_100040489 | 316 |
| 36 | 3300026041 | Ga0207639_10276646 | Ga0207639_102766462 | 316 |
| 37 | 3300031649 | Ga0307514_10008253 | Ga0307514_100082533 | 316 |
| 38 | 3300031730 | Ga0307516_10046117 | Ga0307516_100461171 | 316 |
| 39 | 3300033180 | Ga0307510_10054704 | Ga0307510_100547042 | 316 |
| 40 | 3300046529 | Ga0495652_0058029 | Ga0495652_0058029_1004_1975 | 316 |
| 41 | 3300046530 | Ga0495654_0000148 | Ga0495654_0000148_40426_41400 | 316 |
| 42 | 3300049578 | Ga0501042_0007055 | Ga0501042_0007055_1909_2877 | 316 |
| 43 | 3300049581 | Ga0501047_0420098 | Ga0501047_0420098_29_1003 | 316 |
| 44 | 3300053078 | Ga0495612_0005485 | Ga0495612_0005485_1174_2145 | 316 |
| 45 | 3300053085 | Ga0495619_0045523 | Ga0495619_0045523_668_1639 | 316 |
| 46 | 3300053153 | Ga0500616_0000985 | Ga0500616_0000985_27251_28222 | 316 |
| 47 | 3300005290 | Ga0065712_10019742 | Ga0065712_100197423 | 317 |
| 48 | 3300005290 | Ga0065712_10119487 | Ga0065712_101194871 | 317 |
| 49 | 3300005293 | Ga0065715_10131967 | Ga0065715_101319672 | 317 |
| 50 | 3300005355 | Ga0070671_100175894 | Ga0070671_1001758942 | 317 |
| 51 | 3300025931 | Ga0207644_10145902 | Ga0207644_101459022 | 317 |
| 52 | 3300042876 | Ga0451577_0090108 | Ga0451577_0090108_687_1661 | 317 |
| 53 | 3300048905 | Ga0496102_0088800 | Ga0496102_0088800_204_1172 | 317 |
| 54 | 3300050494 | nmdc:mga06z11_129552_c1 | nmdc:mga06z11_129552_c1_141_1115 | 317 |
| 55 | 3300049570 | Ga0501033_0323287 | Ga0501033_0323287_80_1069 | 318 |
| 56 | 3300005549 | Ga0070704_100357178 | Ga0070704_1003571781 | 320 |
| 57 | 3300014497 | Ga0182008_10079634 | Ga0182008_100796342 | 320 |
| 58 | 3300015261 | Ga0182006_1017861 | Ga0182006_10178612 | 320 |
| 59 | 3300015262 | Ga0182007_10009845 | Ga0182007_100098452 | 320 |
| 60 | 3300021388 | Ga0213875_10105022 | Ga0213875_101050221 | 320 |
| 61 | 3300025939 | Ga0207665_10166935 | Ga0207665_101669352 | 320 |
| 62 | 3300037853 | Ga0436364_0267374 | Ga0436364_0267374_148_1167 | 320 |
| 63 | 3300046454 | Ga0495592_0028935 | Ga0495592_0028935_1022_1987 | 320 |
| 64 | 3300046472 | Ga0495580_0212511 | Ga0495580_0212511_190_1155 | 320 |
| 65 | 3300046476 | Ga0495662_0055863 | Ga0495662_0055863_521_1486 | 320 |
| 66 | 3300046678 | Ga0495599_0038056 | Ga0495599_0038056_1575_2540 | 320 |
| 67 | 3300046689 | Ga0495613_0049747 | Ga0495613_0049747_803_1768 | 320 |
| 68 | 3300048927 | Ga0496124_0001021 | Ga0496124_0001021_41609_42595 | 320 |
| 69 | 3300046529 | Ga0495652_0331510 | Ga0495652_0331510_102_1070 | 321 |
| 70 | 3300005547 | Ga0070693_100141658 | Ga0070693_1001416582 | 322 |
| 71 | 3300009147 | Ga0114129_10327559 | Ga0114129_103275591 | 322 |
| 72 | 3300013102 | Ga0157371_10188123 | Ga0157371_101881232 | 322 |
| 73 | 3300014326 | Ga0157380_10005132 | Ga0157380_100051326 | 322 |
| 74 | 3300046683 | Ga0495658_0072791 | Ga0495658_0072791_38_1015 | 322 |
| 75 | 3300048918 | Ga0496115_0184320 | Ga0496115_0184320_20_997 | 322 |
| 76 | 3300050507 | nmdc:mga05p37_160448_c1 | nmdc:mga05p37_160448_c1_23_1024 | 322 |
| 77 | 3300050507 | nmdc:mga05p37_45803_c1 | nmdc:mga05p37_45803_c1_3987_4988 | 322 |
| 78 | 3300050508 | nmdc:mga09592_28533_c1 | nmdc:mga09592_28533_c1_2450_3451 | 322 |
| 79 | 3300050512 | nmdc:mga0n895_527815_c1 | nmdc:mga0n895_527815_c1_28_1029 | 322 |
| 80 | 3300050515 | nmdc:mga0a205_236150_c1 | nmdc:mga0a205_236150_c1_105_1106 | 322 |
| 81 | 3300005436 | Ga0070713_100014373 | Ga0070713_1000143732 | 323 |
| 82 | 3300013105 | Ga0157369_10634603 | Ga0157369_106346031 | 323 |
| 83 | 3300039447 | Ga0436361_1038323 | Ga0436361_1038323_1341_2339 | 327 |
| 84 | 3300003320 | rootH2_10149170 | rootH2_101491701 | 328 |
| 85 | 3300005458 | Ga0070681_10104144 | Ga0070681_101041444 | 330 |
| 86 | 3300025912 | Ga0207707_10073135 | Ga0207707_100731355 | 330 |
| 87 | 3300031733 | Ga0316577_10082895 | Ga0316577_100828952 | 330 |
| 88 | 3300053108 | Ga0500562_003493 | Ga0500562_003493_2394_3443 | 330 |
| 89 | 3300005331 | Ga0070670_100104883 | Ga0070670_1001048832 | 331 |
| 90 | 3300005335 | Ga0070666_10000307 | Ga0070666_1000030727 | 331 |
| 91 | 3300005354 | Ga0070675_100023295 | Ga0070675_1000232952 | 331 |
| 92 | 3300005364 | Ga0070673_100008398 | Ga0070673_1000083984 | 331 |
| 93 | 3300005544 | Ga0070686_100079291 | Ga0070686_1000792912 | 331 |
| 94 | 3300005618 | Ga0068864_100017568 | Ga0068864_1000175683 | 331 |
| 95 | 3300005842 | Ga0068858_100024022 | Ga0068858_1000240223 | 331 |
| 96 | 3300006847 | Ga0075431_100033221 | Ga0075431_1000332212 | 331 |
| 97 | 3300006880 | Ga0075429_100065557 | Ga0075429_1000655574 | 331 |
| 98 | 3300013306 | Ga0163162_10001514 | Ga0163162_1000151411 | 331 |
| 99 | 3300014968 | Ga0157379_10348245 | Ga0157379_103482452 | 331 |
| 100 | 3300025925 | Ga0207650_10021072 | Ga0207650_100210722 | 331 |
| 101 | 3300025940 | Ga0207691_10034449 | Ga0207691_100344494 | 331 |
| 102 | 3300025986 | Ga0207658_10051933 | Ga0207658_100519333 | 331 |
| 103 | 3300026023 | Ga0207677_10036712 | Ga0207677_100367121 | 331 |
| 104 | 3300031595 | Ga0265313_10023853 | Ga0265313_100238533 | 331 |
| 105 | 3300050508 | nmdc:mga09592_121921_c1 | nmdc:mga09592_121921_c1_1169_2200 | 331 |
| 106 | 3300006844 | Ga0075428_100003973 | Ga0075428_1000039737 | 332 |
| 107 | 3300006846 | Ga0075430_100167527 | Ga0075430_1001675272 | 332 |
| 108 | 3300006847 | Ga0075431_100062562 | Ga0075431_1000625622 | 332 |
| 109 | 3300009147 | Ga0114129_10116601 | Ga0114129_101166012 | 332 |
| 110 | 3300017792 | Ga0163161_10060951 | Ga0163161_100609514 | 332 |
| 111 | 3300050509 | nmdc:mga0qj67_341931_c1 | nmdc:mga0qj67_341931_c1_146_1159 | 332 |
| 112 | 3300050510 | nmdc:mga06r32_51024_c1 | nmdc:mga06r32_51024_c1_1187_2200 | 332 |
| 113 | 3300027471 | Ga0209995_1009365 | Ga0209995_10093652 | 333 |
| 114 | 3300046684 | Ga0495669_0001666 | Ga0495669_0001666_6009_7040 | 333 |
| 115 | iso_pu_bacteria | 2795385470 | 2795785082 | 334 |
| 116 | iso_pu_bacteria | 8003314358 | 8003322592 | 334 |
| 117 | 3300009093 | Ga0105240_10171793 | Ga0105240_101717932 | 335 |
| 118 | iso_pu_bacteria | 2579778775 | 2580935473 | 335 |
| 119 | iso_pu_bacteria | 2619619294 | 2621277328 | 335 |
| 120 | 3300005344 | Ga0070661_100060265 | Ga0070661_1000602653 | 336 |
| 121 | 3300005564 | Ga0070664_100000069 | Ga0070664_1000000693 | 336 |
| 122 | 3300009177 | Ga0105248_10017519 | Ga0105248_100175196 | 336 |
| 123 | 3300014325 | Ga0163163_10246815 | Ga0163163_102468152 | 336 |
| 124 | 3300025920 | Ga0207649_10033256 | Ga0207649_100332562 | 336 |
| 125 | 3300025941 | Ga0207711_10031419 | Ga0207711_100314192 | 336 |
| 126 | 3300025945 | Ga0207679_10133661 | Ga0207679_101336612 | 336 |
| 127 | iso_pu_bacteria | 2512564039 | 2512733928 | 336 |
| 128 | iso_pu_bacteria | 2857465823 | 2857471890 | 336 |
| 129 | 3300009093 | Ga0105240_10069090 | Ga0105240_100690903 | 337 |
| 130 | 3300025909 | Ga0207705_10291331 | Ga0207705_102913311 | 337 |
| 131 | 3300028800 | Ga0265338_10135247 | Ga0265338_101352472 | 337 |
| 132 | 3300048929 | Ga0496126_0040384 | Ga0496126_0040384_258_1304 | 337 |
| 133 | 3300049571 | Ga0501034_0372817 | Ga0501034_0372817_112_1158 | 337 |
| 134 | 3300049822 | Ga0501035_0246698 | Ga0501035_0246698_129_1175 | 337 |
| 135 | 3300049823 | Ga0501044_0323678 | Ga0501044_0323678_355_1401 | 337 |
| 136 | iso_pu_bacteria | 2510461076 | 2510895551 | 337 |
| 137 | iso_pu_bacteria | 2515154114 | 2515645834 | 337 |
| 138 | iso_pu_bacteria | 2515154116 | 2515655177 | 337 |
| 139 | iso_pu_bacteria | 2517287029 | 2517407623 | 337 |
| 140 | iso_pu_bacteria | 2643221676 | 2644424594 | 337 |
| 141 | iso_pu_bacteria | 8005382845 | 8005388954 | 337 |
| 142 | iso_pu_bacteria | 8005395548 | 8005395937 | 337 |
| 143 | 3300005435 | Ga0070714_100277763 | Ga0070714_1002777631 | 338 |
| 144 | 3300005436 | Ga0070713_100083140 | Ga0070713_1000831404 | 338 |
| 145 | 3300005455 | Ga0070663_100001290 | Ga0070663_1000012904 | 338 |
| 146 | 3300005548 | Ga0070665_100017981 | Ga0070665_1000179815 | 338 |
| 147 | 3300005937 | Ga0081455_10000011 | Ga0081455_10000011193 | 338 |
| 148 | 3300006028 | Ga0070717_10096082 | Ga0070717_100960822 | 338 |
| 149 | 3300006028 | Ga0070717_10485719 | Ga0070717_104857191 | 338 |
| 150 | 3300009545 | Ga0105237_10213109 | Ga0105237_102131092 | 338 |
| 151 | 3300013105 | Ga0157369_10060843 | Ga0157369_100608433 | 338 |
| 152 | 3300025913 | Ga0207695_10139691 | Ga0207695_101396912 | 338 |
| 153 | 3300025915 | Ga0207693_10220941 | Ga0207693_102209412 | 338 |
| 154 | 3300025928 | Ga0207700_10150511 | Ga0207700_101505112 | 338 |
| 155 | 3300025929 | Ga0207664_10148382 | Ga0207664_101483823 | 338 |
| 156 | 3300026067 | Ga0207678_10004649 | Ga0207678_100046495 | 338 |
| 157 | 3300028379 | Ga0268266_10038860 | Ga0268266_100388603 | 338 |
| 158 | 3300028556 | Ga0265337_1004614 | Ga0265337_10046145 | 338 |
| 159 | 3300028573 | Ga0265334_10030658 | Ga0265334_100306582 | 338 |
| 160 | 3300028800 | Ga0265338_10006310 | Ga0265338_1000631014 | 338 |
| 161 | 3300031240 | Ga0265320_10028280 | Ga0265320_100282802 | 338 |
| 162 | 3300031247 | Ga0265340_10009286 | Ga0265340_100092865 | 338 |
| 163 | 3300031711 | Ga0265314_10091245 | Ga0265314_100912452 | 338 |
| 164 | 3300035086 | Ga0373934_0011706 | Ga0373934_0011706_1373_2422 | 338 |
| 165 | 3300035111 | Ga0373923_0061490 | Ga0373923_0061490_487_1536 | 338 |
| 166 | 3300035113 | Ga0373936_0010781 | Ga0373936_0010781_2051_3100 | 338 |
| 167 | 3300035118 | Ga0373954_0049152 | Ga0373954_0049152_895_1944 | 338 |
| 168 | 3300035170 | Ga0373943_0111305 | Ga0373943_0111305_288_1337 | 338 |
| 169 | 3300037418 | Ga0395900_0168880 | Ga0395900_0168880_319_1368 | 338 |
| 170 | 3300037466 | Ga0395898_0360400 | Ga0395898_0360400_226_1275 | 338 |
| 171 | 3300037471 | Ga0395905_0122180 | Ga0395905_0122180_374_1423 | 338 |
| 172 | 3300044694 | Ga0466963_0002639 | Ga0466963_0002639_7302_8351 | 338 |
| 173 | 3300044735 | Ga0466968_0029445 | Ga0466968_0029445_135_1241 | 338 |
| 174 | 3300044842 | Ga0466957_0035667 | Ga0466957_0035667_1897_2946 | 338 |
| 175 | 3300045836 | Ga0466958_0125693 | Ga0466958_0125693_38_1087 | 338 |
| 176 | 3300046462 | Ga0495651_0054698 | Ga0495651_0054698_1758_2807 | 338 |
| 177 | 3300046463 | Ga0495653_0052120 | Ga0495653_0052120_1773_2822 | 338 |
| 178 | 3300046514 | Ga0495618_0077422 | Ga0495618_0077422_89_1138 | 338 |
| 179 | 3300046516 | Ga0495628_0009098 | Ga0495628_0009098_6949_7998 | 338 |
| 180 | 3300046559 | Ga0495667_0043733 | Ga0495667_0043733_1523_2572 | 338 |
| 181 | 3300046675 | Ga0495657_0083390 | Ga0495657_0083390_93_1142 | 338 |
| 182 | 3300046809 | Ga0495600_0034644 | Ga0495600_0034644_1104_2153 | 338 |
| 183 | 3300047444 | Ga0495675_0167412 | Ga0495675_0167412_31_1080 | 338 |
| 184 | 3300047471 | Ga0495684_0063526 | Ga0495684_0063526_1490_2539 | 338 |
| 185 | 3300048088 | Ga0495602_0315738 | Ga0495602_0315738_20_1069 | 338 |
| 186 | 3300048904 | Ga0496101_0161336 | Ga0496101_0161336_643_1692 | 338 |
| 187 | 3300048915 | Ga0496112_0044112 | Ga0496112_0044112_1203_2252 | 338 |
| 188 | 3300048916 | Ga0496113_0052137 | Ga0496113_0052137_1564_2613 | 338 |
| 189 | 3300048923 | Ga0496120_0020407 | Ga0496120_0020407_2051_3100 | 338 |
| 190 | 3300048925 | Ga0496122_0063586 | Ga0496122_0063586_1614_2663 | 338 |
| 191 | 3300048926 | Ga0496123_0073569 | Ga0496123_0073569_866_1915 | 338 |
| 192 | 3300049569 | Ga0501032_0150359 | Ga0501032_0150359_57_1106 | 338 |
| 193 | 3300049571 | Ga0501034_0302007 | Ga0501034_0302007_71_1120 | 338 |
| 194 | 3300049574 | Ga0501038_0095287 | Ga0501038_0095287_65_1114 | 338 |
| 195 | 3300049822 | Ga0501035_0071240 | Ga0501035_0071240_807_1856 | 338 |
| 196 | 3300053085 | Ga0495619_0150978 | Ga0495619_0150978_336_1385 | 338 |
| 197 | 3300053116 | Ga0500592_002745 | Ga0500592_002745_109_1128 | 338 |
| 198 | iso_pu_bacteria | 2818991460 | 2819682001 | 338 |
| 199 | iso_pu_bacteria | 2929177148 | 2929178429 | 338 |
| 200 | iso_pu_bacteria | 2945977869 | 2945980829 | 338 |
| 201 | iso_pu_bacteria | 2946013367 | 2946019770 | 338 |
| 202 | 3300045836 | Ga0466958_0084043 | Ga0466958_0084043_180_1217 | 339 |
| 203 | 3300053140 | Ga0500573_0016177 | Ga0500573_0016177_3139_4182 | 339 |
| 204 | 3300005841 | Ga0068863_100080055 | Ga0068863_1000800554 | 340 |
| 205 | 3300005842 | Ga0068858_100387966 | Ga0068858_1003879661 | 340 |
| 206 | 3300006237 | Ga0097621_100009107 | Ga0097621_1000091072 | 340 |
| 207 | 3300006358 | Ga0068871_100057255 | Ga0068871_1000572551 | 340 |
| 208 | 3300009093 | Ga0105240_10000457 | Ga0105240_1000045750 | 340 |
| 209 | 3300025913 | Ga0207695_10000066 | Ga0207695_1000006650 | 340 |
| 210 | 3300025913 | Ga0207695_10000156 | Ga0207695_1000015659 | 340 |
| 211 | 3300026035 | Ga0207703_10274232 | Ga0207703_102742322 | 340 |
| 212 | 3300035119 | Ga0373956_0090159 | Ga0373956_0090159_333_1358 | 340 |
| 213 | 3300035120 | Ga0373957_0035068 | Ga0373957_0035068_302_1327 | 340 |
| 214 | 3300044658 | Ga0466972_0000023 | Ga0466972_0000023_86761_87783 | 340 |
| 215 | 3300046511 | Ga0495608_0012083 | Ga0495608_0012083_433_1458 | 340 |
| 216 | 3300046524 | Ga0495648_0030631 | Ga0495648_0030631_2128_3150 | 340 |
| 217 | 3300046616 | Ga0495668_0013332 | Ga0495668_0013332_831_1853 | 340 |
| 218 | 3300046660 | Ga0495625_0020002 | Ga0495625_0020002_4122_5144 | 340 |
| 219 | 3300046689 | Ga0495613_0206611 | Ga0495613_0206611_314_1339 | 340 |
| 220 | 3300047445 | Ga0495677_0023044 | Ga0495677_0023044_772_1794 | 340 |
| 221 | 3300048929 | Ga0496126_0003662 | Ga0496126_0003662_7354_8400 | 340 |
| 222 | 3300053087 | Ga0500643_003110 | Ga0500643_003110_7112_8134 | 340 |
| 223 | 3300005539 | Ga0068853_100004903 | Ga0068853_1000049035 | 341 |
| 224 | 3300006844 | Ga0075428_100262158 | Ga0075428_1002621582 | 341 |
| 225 | 3300006881 | Ga0068865_100020749 | Ga0068865_1000207494 | 341 |
| 226 | 3300009094 | Ga0111539_10227120 | Ga0111539_102271202 | 341 |
| 227 | 3300009551 | Ga0105238_10011865 | Ga0105238_100118652 | 341 |
| 228 | 3300010375 | Ga0105239_10393955 | Ga0105239_103939552 | 341 |
| 229 | 3300013296 | Ga0157374_10000015 | Ga0157374_10000015122 | 341 |
| 230 | 3300013306 | Ga0163162_10312512 | Ga0163162_103125121 | 341 |
| 231 | 3300014969 | Ga0157376_10012172 | Ga0157376_100121723 | 341 |
| 232 | 3300025913 | Ga0207695_10054011 | Ga0207695_100540114 | 341 |
| 233 | 3300025924 | Ga0207694_10057807 | Ga0207694_100578072 | 341 |
| 234 | 3300041496 | Ga0451839_0077038 | Ga0451839_0077038_291_1331 | 341 |
| 235 | 3300041498 | Ga0451841_0948534 | Ga0451841_0948534_230_1270 | 341 |
| 236 | 3300041501 | Ga0451845_0598475 | Ga0451845_0598475_1032_2072 | 341 |
| 237 | 3300041503 | Ga0451847_0802911 | Ga0451847_0802911_3060_4100 | 341 |
| 238 | 3300041505 | Ga0451849_0697350 | Ga0451849_0697350_1450_2490 | 341 |
| 239 | 3300041507 | Ga0451851_0043303 | Ga0451851_0043303_389_1429 | 341 |
| 240 | 3300041509 | Ga0451843_1430367 | Ga0451843_1430367_257_1297 | 341 |
| 241 | 3300041512 | Ga0451853_0771661 | Ga0451853_0771661_1023_2063 | 341 |
| 242 | 3300046515 | Ga0495620_0017527 | Ga0495620_0017527_273_1313 | 341 |
| 243 | 3300046518 | Ga0495631_0035662 | Ga0495631_0035662_254_1294 | 341 |
| 244 | 3300046524 | Ga0495648_0007545 | Ga0495648_0007545_5275_6315 | 341 |
| 245 | 3300046648 | Ga0495611_0091165 | Ga0495611_0091165_323_1363 | 341 |
| 246 | 3300046660 | Ga0495625_0091809 | Ga0495625_0091809_824_1864 | 341 |
| 247 | 3300046810 | Ga0495660_0026969 | Ga0495660_0026969_325_1365 | 341 |
| 248 | 3300001989 | JGI24739J22299_10004604 | JGI24739J22299_100046043 | 342 |
| 249 | 3300002737 | JGI25162J39368_1000223 | JGI25162J39368_100022326 | 342 |
| 250 | 3300002737 | JGI25162J39368_1000305 | JGI25162J39368_100030513 | 342 |
| 251 | 3300003215 | JGI25153J46596_10033647 | JGI25153J46596_100336472 | 342 |
| 252 | 3300003316 | rootH1_10057445 | rootH1_100574452 | 342 |
| 253 | 3300003320 | rootH2_10062707 | rootH2_1006270711 | 342 |
| 254 | 3300003320 | rootH2_10127796 | rootH2_101277962 | 342 |
| 255 | 3300003320 | rootH2_10235252 | rootH2_102352522 | 342 |
| 256 | 3300003320 | rootH2_10246733 | rootH2_102467332 | 342 |
| 257 | 3300003320 | rootH2_10295873 | rootH2_102958732 | 342 |
| 258 | 3300003322 | rootL2_10037395 | rootL2_100373951 | 342 |
| 259 | 3300003322 | rootL2_10175820 | rootL2_101758203 | 342 |
| 260 | 3300003323 | rootH1_10016736 | rootH1_1001673623 | 342 |
| 261 | 3300003323 | rootH1_10158222 | rootH1_101582224 | 342 |
| 262 | 3300003323 | rootH1_10345561 | rootH1_103455612 | 342 |
| 263 | 3300003771 | Ga0055526_1004431 | Ga0055526_10044312 | 342 |
| 264 | 3300003771 | Ga0055526_1018038 | Ga0055526_10180382 | 342 |
| 265 | 3300003790 | Ga0055528_1000180 | Ga0055528_100018028 | 342 |
| 266 | 3300005262 | Ga0065165_1000019 | Ga0065165_1000019177 | 342 |
| 267 | 3300005329 | Ga0070683_100001153 | Ga0070683_1000011538 | 342 |
| 268 | 3300005329 | Ga0070683_100003365 | Ga0070683_1000033653 | 342 |
| 269 | 3300005329 | Ga0070683_100005006 | Ga0070683_1000050066 | 342 |
| 270 | 3300005329 | Ga0070683_100009403 | Ga0070683_1000094037 | 342 |
| 271 | 3300005329 | Ga0070683_100185353 | Ga0070683_1001853532 | 342 |
| 272 | 3300005336 | Ga0070680_100003763 | Ga0070680_10000376312 | 342 |
| 273 | 3300005336 | Ga0070680_100056279 | Ga0070680_1000562793 | 342 |
| 274 | 3300005338 | Ga0068868_100193085 | Ga0068868_1001930852 | 342 |
| 275 | 3300005339 | Ga0070660_100021530 | Ga0070660_1000215303 | 342 |
| 276 | 3300005341 | Ga0070691_10005990 | Ga0070691_100059904 | 342 |
| 277 | 3300005343 | Ga0070687_100092305 | Ga0070687_1000923052 | 342 |
| 278 | 3300005435 | Ga0070714_100121064 | Ga0070714_1001210642 | 342 |
| 279 | 3300005456 | Ga0070678_100261273 | Ga0070678_1002612731 | 342 |
| 280 | 3300005457 | Ga0070662_100099275 | Ga0070662_1000992752 | 342 |
| 281 | 3300005458 | Ga0070681_10008049 | Ga0070681_1000804911 | 342 |
| 282 | 3300005458 | Ga0070681_10025709 | Ga0070681_100257091 | 342 |
| 283 | 3300005459 | Ga0068867_100050482 | Ga0068867_1000504825 | 342 |
| 284 | 3300005530 | Ga0070679_100017740 | Ga0070679_1000177407 | 342 |
| 285 | 3300005530 | Ga0070679_100068366 | Ga0070679_1000683665 | 342 |
| 286 | 3300005535 | Ga0070684_100002184 | Ga0070684_1000021842 | 342 |
| 287 | 3300005535 | Ga0070684_100021376 | Ga0070684_1000213763 | 342 |
| 288 | 3300005535 | Ga0070684_100094752 | Ga0070684_1000947522 | 342 |
| 289 | 3300005535 | Ga0070684_100191414 | Ga0070684_1001914142 | 342 |
| 290 | 3300005539 | Ga0068853_100041970 | Ga0068853_1000419706 | 342 |
| 291 | 3300005539 | Ga0068853_100184922 | Ga0068853_1001849221 | 342 |
| 292 | 3300005563 | Ga0068855_100004019 | Ga0068855_1000040199 | 342 |
| 293 | 3300005563 | Ga0068855_100014907 | Ga0068855_1000149077 | 342 |
| 294 | 3300005563 | Ga0068855_100287874 | Ga0068855_1002878742 | 342 |
| 295 | 3300005564 | Ga0070664_100064316 | Ga0070664_1000643162 | 342 |
| 296 | 3300005577 | Ga0068857_100004743 | Ga0068857_10000474312 | 342 |
| 297 | 3300005577 | Ga0068857_100044099 | Ga0068857_1000440992 | 342 |
| 298 | 3300005577 | Ga0068857_100053344 | Ga0068857_1000533443 | 342 |
| 299 | 3300005614 | Ga0068856_100004931 | Ga0068856_1000049313 | 342 |
| 300 | 3300005614 | Ga0068856_100015863 | Ga0068856_1000158632 | 342 |
| 301 | 3300005614 | Ga0068856_100071334 | Ga0068856_1000713343 | 342 |
| 302 | 3300005616 | Ga0068852_100077300 | Ga0068852_1000773002 | 342 |
| 303 | 3300005834 | Ga0068851_10032028 | Ga0068851_100320285 | 342 |
| 304 | 3300006237 | Ga0097621_100026778 | Ga0097621_1000267783 | 342 |
| 305 | 3300006358 | Ga0068871_100047211 | Ga0068871_1000472115 | 342 |
| 306 | 3300006844 | Ga0075428_100116247 | Ga0075428_1001162472 | 342 |
| 307 | 3300006846 | Ga0075430_100120712 | Ga0075430_1001207122 | 342 |
| 308 | 3300006847 | Ga0075431_100347645 | Ga0075431_1003476451 | 342 |
| 309 | 3300006871 | Ga0075434_100222702 | Ga0075434_1002227022 | 342 |
| 310 | 3300006880 | Ga0075429_100060518 | Ga0075429_1000605183 | 342 |
| 311 | 3300006914 | Ga0075436_100049111 | Ga0075436_1000491111 | 342 |
| 312 | 3300009093 | Ga0105240_10142486 | Ga0105240_101424863 | 342 |
| 313 | 3300009094 | Ga0111539_10149909 | Ga0111539_101499091 | 342 |
| 314 | 3300009098 | Ga0105245_10000995 | Ga0105245_1000099518 | 342 |
| 315 | 3300009147 | Ga0114129_10350344 | Ga0114129_103503442 | 342 |
| 316 | 3300009174 | Ga0105241_10003993 | Ga0105241_1000399312 | 342 |
| 317 | 3300009174 | Ga0105241_10057595 | Ga0105241_100575952 | 342 |
| 318 | 3300009174 | Ga0105241_10059953 | Ga0105241_100599533 | 342 |
| 319 | 3300009176 | Ga0105242_10064141 | Ga0105242_100641412 | 342 |
| 320 | 3300009176 | Ga0105242_10166588 | Ga0105242_101665881 | 342 |
| 321 | 3300009177 | Ga0105248_10010010 | Ga0105248_100100106 | 342 |
| 322 | 3300009545 | Ga0105237_10004841 | Ga0105237_1000484112 | 342 |
| 323 | 3300009545 | Ga0105237_10011895 | Ga0105237_100118955 | 342 |
| 324 | 3300009545 | Ga0105237_10014459 | Ga0105237_100144599 | 342 |
| 325 | 3300009551 | Ga0105238_10003582 | Ga0105238_1000358213 | 342 |
| 326 | 3300009551 | Ga0105238_10008740 | Ga0105238_1000874011 | 342 |
| 327 | 3300010375 | Ga0105239_10000604 | Ga0105239_1000060419 | 342 |
| 328 | 3300010375 | Ga0105239_10001438 | Ga0105239_100014384 | 342 |
| 329 | 3300010375 | Ga0105239_10001560 | Ga0105239_1000156022 | 342 |
| 330 | 3300010375 | Ga0105239_10004033 | Ga0105239_100040333 | 342 |
| 331 | 3300010375 | Ga0105239_10035014 | Ga0105239_100350146 | 342 |
| 332 | 3300010375 | Ga0105239_10442003 | Ga0105239_104420032 | 342 |
| 333 | 3300013104 | Ga0157370_10012271 | Ga0157370_100122719 | 342 |
| 334 | 3300013105 | Ga0157369_10003094 | Ga0157369_100030945 | 342 |
| 335 | 3300013105 | Ga0157369_10159337 | Ga0157369_101593373 | 342 |
| 336 | 3300013296 | Ga0157374_10105479 | Ga0157374_101054792 | 342 |
| 337 | 3300013297 | Ga0157378_10003102 | Ga0157378_100031023 | 342 |
| 338 | 3300013307 | Ga0157372_10010127 | Ga0157372_1001012712 | 342 |
| 339 | 3300013307 | Ga0157372_10010551 | Ga0157372_100105519 | 342 |
| 340 | 3300013307 | Ga0157372_10190592 | Ga0157372_101905924 | 342 |
| 341 | 3300025233 | Ga0209437_100070 | Ga0209437_100070263 | 342 |
| 342 | 3300025273 | Ga0209673_1000042 | Ga0209673_100004290 | 342 |
| 343 | 3300025295 | Ga0209564_1000840 | Ga0209564_100084011 | 342 |
| 344 | 3300025295 | Ga0209564_1004230 | Ga0209564_10042302 | 342 |
| 345 | 3300025295 | Ga0209564_1029372 | Ga0209564_10293722 | 342 |
| 346 | 3300025297 | Ga0209758_1001003 | Ga0209758_10010038 | 342 |
| 347 | 3300025297 | Ga0209758_1003437 | Ga0209758_10034377 | 342 |
| 348 | 3300025298 | Ga0209050_1000308 | Ga0209050_100030828 | 342 |
| 349 | 3300025302 | Ga0207426_1000934 | Ga0207426_10009342 | 342 |
| 350 | 3300025303 | Ga0209051_1039253 | Ga0209051_10392532 | 342 |
| 351 | 3300025304 | Ga0209257_1001059 | Ga0209257_100105917 | 342 |
| 352 | 3300025321 | Ga0207656_10049059 | Ga0207656_100490592 | 342 |
| 353 | 3300025911 | Ga0207654_10027991 | Ga0207654_100279913 | 342 |
| 354 | 3300025912 | Ga0207707_10001082 | Ga0207707_1000108212 | 342 |
| 355 | 3300025912 | Ga0207707_10018467 | Ga0207707_1001846713 | 342 |
| 356 | 3300025913 | Ga0207695_10000778 | Ga0207695_1000077838 | 342 |
| 357 | 3300025913 | Ga0207695_10001264 | Ga0207695_1000126414 | 342 |
| 358 | 3300025913 | Ga0207695_10125850 | Ga0207695_101258502 | 342 |
| 359 | 3300025914 | Ga0207671_10003366 | Ga0207671_100033664 | 342 |
| 360 | 3300025914 | Ga0207671_10008731 | Ga0207671_100087313 | 342 |
| 361 | 3300025918 | Ga0207662_10130155 | Ga0207662_101301553 | 342 |
| 362 | 3300025919 | Ga0207657_10018771 | Ga0207657_100187713 | 342 |
| 363 | 3300025919 | Ga0207657_10086454 | Ga0207657_100864542 | 342 |
| 364 | 3300025921 | Ga0207652_10006515 | Ga0207652_100065152 | 342 |
| 365 | 3300025924 | Ga0207694_10000985 | Ga0207694_1000098514 | 342 |
| 366 | 3300025924 | Ga0207694_10013630 | Ga0207694_100136305 | 342 |
| 367 | 3300025924 | Ga0207694_10027019 | Ga0207694_100270195 | 342 |
| 368 | 3300025927 | Ga0207687_10001118 | Ga0207687_100011182 | 342 |
| 369 | 3300025927 | Ga0207687_10001962 | Ga0207687_100019629 | 342 |
| 370 | 3300025929 | Ga0207664_10086034 | Ga0207664_100860342 | 342 |
| 371 | 3300025933 | Ga0207706_10184679 | Ga0207706_101846793 | 342 |
| 372 | 3300025934 | Ga0207686_10029808 | Ga0207686_100298081 | 342 |
| 373 | 3300025934 | Ga0207686_10054779 | Ga0207686_100547792 | 342 |
| 374 | 3300025941 | Ga0207711_10009271 | Ga0207711_100092718 | 342 |
| 375 | 3300025944 | Ga0207661_10000365 | Ga0207661_1000036528 | 342 |
| 376 | 3300025944 | Ga0207661_10069133 | Ga0207661_100691332 | 342 |
| 377 | 3300025949 | Ga0207667_10002201 | Ga0207667_1000220114 | 342 |
| 378 | 3300025949 | Ga0207667_10006940 | Ga0207667_100069409 | 342 |
| 379 | 3300025949 | Ga0207667_10008600 | Ga0207667_1000860011 | 342 |
| 380 | 3300025949 | Ga0207667_10278127 | Ga0207667_102781272 | 342 |
| 381 | 3300026041 | Ga0207639_10063628 | Ga0207639_100636283 | 342 |
| 382 | 3300026078 | Ga0207702_10007555 | Ga0207702_100075553 | 342 |
| 383 | 3300026078 | Ga0207702_10069529 | Ga0207702_100695293 | 342 |
| 384 | 3300026089 | Ga0207648_10018872 | Ga0207648_100188726 | 342 |
| 385 | 3300026095 | Ga0207676_10074732 | Ga0207676_100747323 | 342 |
| 386 | 3300026095 | Ga0207676_10249384 | Ga0207676_102493841 | 342 |
| 387 | 3300026116 | Ga0207674_10000042 | Ga0207674_1000004230 | 342 |
| 388 | 3300026116 | Ga0207674_10004196 | Ga0207674_1000419615 | 342 |
| 389 | 3300026116 | Ga0207674_10071734 | Ga0207674_100717343 | 342 |
| 390 | 3300026121 | Ga0207683_10111839 | Ga0207683_101118392 | 342 |
| 391 | 3300026142 | Ga0207698_10006089 | Ga0207698_100060897 | 342 |
| 392 | 3300026142 | Ga0207698_10055625 | Ga0207698_100556253 | 342 |
| 393 | 3300027907 | Ga0207428_10142806 | Ga0207428_101428061 | 342 |
| 394 | 3300031247 | Ga0265340_10045283 | Ga0265340_100452832 | 342 |
| 395 | 3300031711 | Ga0265314_10000503 | Ga0265314_1000050318 | 342 |
| 396 | 3300033180 | Ga0307510_10007386 | Ga0307510_100073862 | 342 |
| 397 | 3300035086 | Ga0373934_0006121 | Ga0373934_0006121_835_1872 | 342 |
| 398 | 3300035111 | Ga0373923_0019041 | Ga0373923_0019041_1164_2201 | 342 |
| 399 | 3300035111 | Ga0373923_0038528 | Ga0373923_0038528_52_1089 | 342 |
| 400 | 3300035117 | Ga0373953_0009641 | Ga0373953_0009641_1487_2524 | 342 |
| 401 | 3300035118 | Ga0373954_0002721 | Ga0373954_0002721_3887_4924 | 342 |
| 402 | 3300035118 | Ga0373954_0006277 | Ga0373954_0006277_1380_2417 | 342 |
| 403 | 3300035119 | Ga0373956_0051409 | Ga0373956_0051409_527_1573 | 342 |
| 404 | 3300035119 | Ga0373956_0111867 | Ga0373956_0111867_11_1048 | 342 |
| 405 | 3300035172 | Ga0373955_0033496 | Ga0373955_0033496_841_1878 | 342 |
| 406 | 3300035410 | Ga0373924_0023130 | Ga0373924_0023130_683_1720 | 342 |
| 407 | 3300035724 | Ga0373933_0008498 | Ga0373933_0008498_106_1152 | 342 |
| 408 | 3300035724 | Ga0373933_0073328 | Ga0373933_0073328_983_2020 | 342 |
| 409 | 3300036401 | Ga0373937_0022414 | Ga0373937_0022414_1922_2959 | 342 |
| 410 | 3300036401 | Ga0373937_0068216 | Ga0373937_0068216_738_1784 | 342 |
| 411 | 3300036401 | Ga0373937_0072145 | Ga0373937_0072145_1345_2382 | 342 |
| 412 | 3300037068 | Ga0373925_0017557 | Ga0373925_0017557_4060_5097 | 342 |
| 413 | 3300044656 | Ga0466969_0003242 | Ga0466969_0003242_4044_5105 | 342 |
| 414 | 3300044658 | Ga0466972_0012822 | Ga0466972_0012822_31_1068 | 342 |
| 415 | 3300044684 | Ga0466966_0004250 | Ga0466966_0004250_6411_7472 | 342 |
| 416 | 3300044706 | Ga0466964_0000086 | Ga0466964_0000086_20439_21500 | 342 |
| 417 | 3300044719 | Ga0466971_0000313 | Ga0466971_0000313_13644_14705 | 342 |
| 418 | 3300044735 | Ga0466968_0029256 | Ga0466968_0029256_896_2062 | 342 |
| 419 | 3300044842 | Ga0466957_0125670 | Ga0466957_0125670_497_1558 | 342 |
| 420 | 3300045049 | Ga0466959_0014772 | Ga0466959_0014772_1081_2142 | 342 |
| 421 | 3300046462 | Ga0495651_0062287 | Ga0495651_0062287_881_1918 | 342 |
| 422 | 3300046472 | Ga0495580_0103101 | Ga0495580_0103101_300_1340 | 342 |
| 423 | 3300046473 | Ga0495582_0002852 | Ga0495582_0002852_596_1633 | 342 |
| 424 | 3300046507 | Ga0495606_0012416 | Ga0495606_0012416_3716_4744 | 342 |
| 425 | 3300046514 | Ga0495618_0009264 | Ga0495618_0009264_1613_2671 | 342 |
| 426 | 3300046516 | Ga0495628_0095515 | Ga0495628_0095515_249_1286 | 342 |
| 427 | 3300046531 | Ga0495665_0063585 | Ga0495665_0063585_384_1421 | 342 |
| 428 | 3300046535 | Ga0495586_0009311 | Ga0495586_0009311_1383_2441 | 342 |
| 429 | 3300046536 | Ga0495587_0160752 | Ga0495587_0160752_180_1217 | 342 |
| 430 | 3300047471 | Ga0495684_0008121 | Ga0495684_0008121_5860_6897 | 342 |
| 431 | 3300048907 | Ga0496104_0075841 | Ga0496104_0075841_1871_2908 | 342 |
| 432 | 3300048915 | Ga0496112_0428527 | Ga0496112_0428527_51_1088 | 342 |
| 433 | 3300049823 | Ga0501044_0389812 | Ga0501044_0389812_234_1271 | 342 |
| 434 | 3300050507 | nmdc:mga05p37_229846_c1 | nmdc:mga05p37_229846_c1_21_1079 | 342 |
| 435 | 3300050508 | nmdc:mga09592_86178_c1 | nmdc:mga09592_86178_c1_1097_2155 | 342 |
| 436 | 3300050509 | nmdc:mga0qj67_121702_c1 | nmdc:mga0qj67_121702_c1_876_1934 | 342 |
| 437 | 3300050511 | nmdc:mga08y16_106311_c1 | nmdc:mga08y16_106311_c1_1510_2568 | 342 |
| 438 | 3300050514 | nmdc:mga08x19_36263_c1 | nmdc:mga08x19_36263_c1_949_2007 | 342 |
| 439 | 3300053085 | Ga0495619_0057718 | Ga0495619_0057718_991_2028 | 342 |
| 440 | 3300053086 | Ga0500578_0050774 | Ga0500578_0050774_914_1996 | 342 |
| 441 | 3300053156 | Ga0500622_0001932 | Ga0500622_0001932_5347_6375 | 342 |
| 442 | 3300061719 | Ga0466962_0000567 | Ga0466962_0000567_4229_5290 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7utf-assembly2.cif.gz_D | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9632 | 1 | 324 |
| 4xk2-assembly2.cif.gz_B | crystal structure of aldo-keto reductase from polaromonas sp. js666 | 0.9571 | 1 | 330 |
| 7utf-assembly1.cif.gz_C | structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol | 0.9536 | 1 | 332 |
| 4xk2-assembly1.cif.gz_C | crystal structure of aldo-keto reductase from polaromonas sp. js666 | 0.9497 | 1 | 330 |
| 4xk2-assembly1.cif.gz_A | crystal structure of aldo-keto reductase from polaromonas sp. js666 | 0.9446 | 1 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xk2A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9446 | 1 | 330 | 3.20.20.100 |
| af_P77735_1_322_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9235 | 1 | 321 | 3.20.20.100 |
| af_P77735_1_322_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9152 | 1 | 321 | 3.20.20.100 |
| 4xk2A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9101 | 1 | 330 | 3.20.20.100 |
| 4xapA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.91 | 6 | 321 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833G235-F1-model_v4 | Aldo/keto reductase | 0.9951 | 1 | 219 |
GO:0005829
GO:0016491 |
| AF-A0A7W5N933-F1-model_v4 | deleted | 0.9924 | 1 | 341 |
|
| AF-A0A3D3L2Q3-F1-model_v4 | Aldo/keto reductase | 0.9918 | 43 | 194 |
GO:0005829
GO:0016491 |
| AF-A0A1Y2T1F3-F1-model_v4 | Aldo/keto reductase | 0.9907 | 1 | 216 |
GO:0005829
GO:0016491 |
| AF-A0A2M7MLN7-F1-model_v4 | NADP-dependent oxidoreductase domain-containing protein | 0.9903 | 1 | 166 |
GO:0005829
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar