F444926

General Info

Members Datasets Scaffolds Average Seq Length
442 279 423 343

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0029256|Ga0466968_0029256_896_2062
Length 388
Sequence MAKKNLQRCFVRVKPKIIRIQQPCLNAGNYFCRVIDEPSQTKYMEYTTLGNTGLIVSKLAFGAMTFGNDASIKSVYKVDQQLAQEMINRSLEAGINFFDTADGYSNGQSETMLGKLLAPHRHEVIISTKVGFRTGQPVTQAGLSKKHILFSCEQSLKRLNTDYIDLYILHKEDPFTPLEETLAALNSLVEAGKVRYVGYSNWSAWKSALAYQLQKDNGWATFCNGQMNYSLVGRDVEYDVIPFMQHAGIGMTVWSPLASGFLSGKYTRENLKDPNNRLSGFDLLPFDKEQGFKVVDVLKEIASQQQASVAQTALAWLLAKPVVSSVIVGASKMHQLEDNLKAINVKLNPAQIQQLDAITKPGILYPHWFNQQLIDQKHKEIFSSTTQG

Samples

Sample ID Description Type Environment
1 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
4 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
5 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
6 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
7 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
8 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
9 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
10 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
11 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
12 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
13 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
14 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
15 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
182 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
183 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
184 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
185 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
186 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
187 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
271 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
272 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
277 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
278 8005382845 Rhizobium sp. R634 Isolate Nodule
279 8005395548 Rhizobium sp. R339 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 0
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 1.58
Rhizoplane 1.58
Rhizosphere 81.22
Stem 0
Stem Tuber 0
Unclassified 9.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004604 3300001989 Bacteria 5274
2 JGI25162J39368_1000223 3300002737 Bacteria 58437
3 JGI25162J39368_1000305 3300002737 Bacteria 45039
4 JGI25153J46596_10033647 3300003215 Bacteria 1689
5 rootH1_10057445 3300003316 Bacteria 15175
6 rootH2_10062707 3300003320 Bacteria 26576
7 rootH2_10127796 3300003320 Bacteria 3621
8 rootH2_10149170 3300003320 Unclassified 3344
9 rootH2_10235252 3300003320 Bacteria 1475
10 rootH2_10246733 3300003320 Bacteria 1474
11 rootH2_10295873 3300003320 Unclassified 2596
12 rootL2_10037395 3300003322 Bacteria 9152
13 rootL2_10175820 3300003322 Bacteria 2101
14 rootH1_10016736 3300003323 Bacteria 27879
15 rootH1_10158222 3300003323 Bacteria 3085
16 rootH1_10345561 3300003323 Unclassified 1611
17 Ga0055526_1004431 3300003771 Bacteria 8439
18 Ga0055526_1018038 3300003771 Bacteria 2657
19 Ga0055528_1000180 3300003790 Bacteria 53597
20 Ga0065165_1000019 3300005262 Bacteria 271815
21 Ga0065712_10019742 3300005290 Bacteria 2246
22 Ga0065712_10119487 3300005290 Bacteria 1683
23 Ga0065715_10131967 3300005293 Bacteria 1977
24 Ga0070658_10216718 3300005327 Bacteria 1618
25 Ga0070683_100001153 3300005329 Bacteria 20002
26 Ga0070683_100003365 3300005329 Bacteria 12956
27 Ga0070683_100005006 3300005329 Bacteria 10998
28 Ga0070683_100009403 3300005329 Bacteria 8359
29 Ga0070683_100185353 3300005329 Bacteria 1975
30 Ga0070670_100104883 3300005331 Unclassified 2435
31 Ga0070666_10000307 3300005335 Bacteria 31713
32 Ga0070680_100003763 3300005336 Bacteria 11338
33 Ga0070680_100056279 3300005336 Unclassified 3215
34 Ga0068868_100193085 3300005338 Bacteria 1694
35 Ga0070660_100021530 3300005339 Bacteria 4756
36 Ga0070689_100214582 3300005340 Unclassified 1576
37 Ga0070691_10005990 3300005341 Bacteria 5548
38 Ga0070687_100092305 3300005343 Unclassified 1677
39 Ga0070661_100060265 3300005344 Unclassified 2785
40 Ga0070675_100023295 3300005354 Unclassified 4950
41 Ga0070671_100175894 3300005355 Bacteria 1811
42 Ga0070673_100008398 3300005364 Bacteria 6864
43 Ga0070714_100001231 3300005435 Bacteria 18476
44 Ga0070714_100121064 3300005435 Bacteria 2328
45 Ga0070714_100277763 3300005435 Bacteria 1555
46 Ga0070713_100014373 3300005436 Bacteria 5877
47 Ga0070713_100083140 3300005436 Bacteria 2736
48 Ga0070663_100001290 3300005455 Bacteria 13731
49 Ga0070678_100261273 3300005456 Bacteria 1456
50 Ga0070662_100099275 3300005457 Bacteria 2200
51 Ga0070681_10008049 3300005458 Bacteria 10318
52 Ga0070681_10025709 3300005458 Bacteria 5921
53 Ga0070681_10104144 3300005458 Bacteria 2780
54 Ga0068867_100050482 3300005459 Bacteria 3066
55 Ga0070679_100017740 3300005530 Bacteria 6890
56 Ga0070679_100068366 3300005530 Bacteria 3544
57 Ga0070684_100002184 3300005535 Bacteria 14445
58 Ga0070684_100021376 3300005535 Bacteria 5383
59 Ga0070684_100094752 3300005535 Bacteria 2659
60 Ga0070684_100191414 3300005535 Bacteria 1861
61 Ga0068853_100004903 3300005539 Bacteria 10413
62 Ga0068853_100041970 3300005539 Bacteria 3909
63 Ga0068853_100184922 3300005539 Unclassified 1891
64 Ga0068853_100239339 3300005539 Bacteria 1663
65 Ga0070686_100079291 3300005544 Unclassified 2170
66 Ga0070693_100141658 3300005547 Bacteria 1514
67 Ga0070665_100017981 3300005548 Bacteria 7097
68 Ga0070665_100024306 3300005548 Bacteria 6100
69 Ga0070704_100357178 3300005549 Bacteria 1235
70 Ga0068855_100004019 3300005563 Bacteria 17967
71 Ga0068855_100014907 3300005563 Bacteria 9364
72 Ga0068855_100287874 3300005563 Bacteria 1822
73 Ga0068855_100334767 3300005563 Bacteria 1670
74 Ga0070664_100000069 3300005564 Bacteria 63932
75 Ga0070664_100064316 3300005564 Bacteria 3129
76 Ga0068857_100004743 3300005577 Bacteria 11517
77 Ga0068857_100044099 3300005577 Unclassified 3955
78 Ga0068857_100053344 3300005577 Unclassified 3587
79 Ga0068854_100030046 3300005578 Bacteria 3766
80 Ga0068856_100004931 3300005614 Bacteria 13214
81 Ga0068856_100015863 3300005614 Bacteria 7285
82 Ga0068856_100071334 3300005614 Unclassified 3439
83 Ga0068852_100028722 3300005616 Bacteria 4558
84 Ga0068852_100077300 3300005616 Bacteria 2942
85 Ga0068864_100017568 3300005618 Bacteria 5963
86 Ga0068851_10032028 3300005834 Bacteria 2614
87 Ga0068863_100080055 3300005841 Bacteria 3094
88 Ga0068858_100024022 3300005842 Bacteria 5680
89 Ga0068858_100387966 3300005842 Bacteria 1341
90 Ga0081455_10000011 3300005937 Bacteria 203132
91 Ga0070717_10096082 3300006028 Bacteria 2509
92 Ga0070717_10154700 3300006028 Bacteria 1986
93 Ga0070717_10485719 3300006028 Bacteria 1115
94 Ga0097621_100009107 3300006237 Bacteria 7195
95 Ga0097621_100026778 3300006237 Bacteria 4527
96 Ga0068871_100047211 3300006358 Bacteria 3472
97 Ga0068871_100057255 3300006358 Bacteria 3171
98 Ga0075428_100003973 3300006844 Bacteria 16228
99 Ga0075428_100116247 3300006844 Bacteria 2913
100 Ga0075428_100262158 3300006844 Bacteria 1861
101 Ga0075430_100120712 3300006846 Bacteria 2185
102 Ga0075430_100167527 3300006846 Bacteria 1828
103 Ga0075431_100033221 3300006847 Bacteria 5317
104 Ga0075431_100062562 3300006847 Bacteria 3840
105 Ga0075431_100347645 3300006847 Bacteria 1491
106 Ga0075434_100222702 3300006871 Bacteria 1906
107 Ga0075429_100060518 3300006880 Bacteria 3298
108 Ga0075429_100065557 3300006880 Bacteria 3162
109 Ga0068865_100020749 3300006881 Bacteria 4264
110 Ga0075436_100049111 3300006914 Bacteria 2911
111 Ga0105240_10000457 3300009093 Bacteria 75275
112 Ga0105240_10069090 3300009093 Unclassified 4373
113 Ga0105240_10142486 3300009093 Bacteria 2864
114 Ga0105240_10171793 3300009093 Bacteria 2566
115 Ga0111539_10149909 3300009094 Bacteria 2730
116 Ga0111539_10227120 3300009094 Bacteria 2174
117 Ga0105245_10000995 3300009098 Bacteria 25730
118 Ga0114129_10116601 3300009147 Bacteria 3680
119 Ga0114129_10327559 3300009147 Bacteria 2035
120 Ga0114129_10350344 3300009147 Bacteria 1956
121 Ga0105241_10000714 3300009174 Bacteria 25119
122 Ga0105241_10003993 3300009174 Bacteria 10905
123 Ga0105241_10057595 3300009174 Bacteria 2982
124 Ga0105241_10059953 3300009174 Bacteria 2927
125 Ga0105242_10064141 3300009176 Bacteria 3027
126 Ga0105242_10166588 3300009176 Bacteria 1933
127 Ga0105248_10010010 3300009177 Bacteria 10438
128 Ga0105248_10017519 3300009177 Bacteria 7899
129 Ga0105237_10004841 3300009545 Bacteria 15465
130 Ga0105237_10011895 3300009545 Bacteria 9203
131 Ga0105237_10014459 3300009545 Bacteria 8251
132 Ga0105237_10213109 3300009545 Bacteria 1931
133 Ga0105237_10337965 3300009545 Bacteria 1510
134 Ga0105238_10003582 3300009551 Bacteria 15484
135 Ga0105238_10008740 3300009551 Bacteria 10133
136 Ga0105238_10011865 3300009551 Bacteria 8776
137 Ga0105239_10000604 3300010375 Bacteria 51154
138 Ga0105239_10001438 3300010375 Bacteria 31747
139 Ga0105239_10001560 3300010375 Bacteria 30320
140 Ga0105239_10004033 3300010375 Bacteria 17765
141 Ga0105239_10035014 3300010375 Bacteria 5514
142 Ga0105239_10325381 3300010375 Bacteria 1734
143 Ga0105239_10393955 3300010375 Bacteria 1567
144 Ga0105239_10442003 3300010375 Bacteria 1475
145 Ga0157371_10188123 3300013102 Bacteria 1478
146 Ga0157370_10012271 3300013104 Bacteria 8894
147 Ga0157369_10003094 3300013105 Bacteria 19881
148 Ga0157369_10060843 3300013105 Bacteria 4072
149 Ga0157369_10159337 3300013105 Bacteria 2383
150 Ga0157369_10634603 3300013105 Bacteria 1102
151 Ga0157374_10000015 3300013296 Bacteria 296773
152 Ga0157374_10105479 3300013296 Bacteria 2707
153 Ga0157374_10106294 3300013296 Bacteria 2696
154 Ga0157378_10003102 3300013297 Bacteria 14775
155 Ga0163162_10001514 3300013306 Bacteria 21645
156 Ga0163162_10312512 3300013306 Bacteria 1704
157 Ga0157372_10010127 3300013307 Bacteria 10015
158 Ga0157372_10010551 3300013307 Bacteria 9825
159 Ga0157372_10190592 3300013307 Bacteria 2375
160 Ga0163163_10246815 3300014325 Unclassified 1835
161 Ga0157380_10005132 3300014326 Bacteria 9151
162 Ga0182008_10079634 3300014497 Bacteria 1612
163 Ga0157379_10348245 3300014968 Unclassified 1356
164 Ga0157376_10012172 3300014969 Bacteria 6375
165 Ga0182006_1017861 3300015261 Bacteria 3006
166 Ga0182007_10009845 3300015262 Bacteria 3815
167 Ga0163161_10060951 3300017792 Bacteria 2747
168 Ga0213875_10105022 3300021388 Bacteria 1319
169 Ga0209437_100070 3300025233 Bacteria 306718
170 Ga0209673_1000042 3300025273 Bacteria 300704
171 Ga0209564_1000840 3300025295 Bacteria 41373
172 Ga0209564_1004230 3300025295 Bacteria 8928
173 Ga0209564_1029372 3300025295 Bacteria 1732
174 Ga0209758_1001003 3300025297 Bacteria 37543
175 Ga0209758_1003437 3300025297 Bacteria 14408
176 Ga0209050_1000308 3300025298 Bacteria 99516
177 Ga0207426_1000934 3300025302 Bacteria 29145
178 Ga0209051_1039253 3300025303 Bacteria 1713
179 Ga0209257_1001059 3300025304 Bacteria 36382
180 Ga0207656_10049059 3300025321 Bacteria 1819
181 Ga0207647_10005843 3300025904 Bacteria 8973
182 Ga0207705_10291331 3300025909 Bacteria 1251
183 Ga0207654_10027991 3300025911 Bacteria 3069
184 Ga0207707_10001082 3300025912 Bacteria 26051
185 Ga0207707_10018467 3300025912 Bacteria 6080
186 Ga0207707_10073135 3300025912 Bacteria 2989
187 Ga0207695_10000066 3300025913 Bacteria 334103
188 Ga0207695_10000156 3300025913 Bacteria 204576
189 Ga0207695_10000778 3300025913 Bacteria 60342
190 Ga0207695_10001264 3300025913 Bacteria 43057
191 Ga0207695_10003542 3300025913 Bacteria 21871
192 Ga0207695_10054011 3300025913 Bacteria 4199
193 Ga0207695_10125850 3300025913 Bacteria 2525
194 Ga0207695_10139691 3300025913 Bacteria 2372
195 Ga0207671_10000594 3300025914 Bacteria 48267
196 Ga0207671_10000750 3300025914 Bacteria 41189
197 Ga0207671_10003366 3300025914 Bacteria 16036
198 Ga0207671_10008731 3300025914 Bacteria 8540
199 Ga0207693_10220941 3300025915 Bacteria 1488
200 Ga0207662_10130155 3300025918 Unclassified 1586
201 Ga0207657_10018771 3300025919 Bacteria 6588
202 Ga0207657_10086454 3300025919 Bacteria 2624
203 Ga0207649_10033256 3300025920 Bacteria 3079
204 Ga0207652_10006515 3300025921 Bacteria 9413
205 Ga0207694_10000985 3300025924 Bacteria 24968
206 Ga0207694_10004729 3300025924 Bacteria 10594
207 Ga0207694_10013630 3300025924 Bacteria 6129
208 Ga0207694_10027019 3300025924 Bacteria 4369
209 Ga0207694_10057807 3300025924 Bacteria 3016
210 Ga0207650_10021072 3300025925 Bacteria 4605
211 Ga0207687_10001118 3300025927 Bacteria 18248
212 Ga0207687_10001962 3300025927 Bacteria 14159
213 Ga0207700_10150511 3300025928 Bacteria 1922
214 Ga0207664_10004048 3300025929 Bacteria 9877
215 Ga0207664_10086034 3300025929 Bacteria 2567
216 Ga0207664_10148382 3300025929 Bacteria 1990
217 Ga0207644_10145902 3300025931 Bacteria 1827
218 Ga0207706_10184679 3300025933 Bacteria 1831
219 Ga0207686_10029808 3300025934 Bacteria 3223
220 Ga0207686_10054779 3300025934 Bacteria 2500
221 Ga0207670_10242642 3300025936 Unclassified 1389
222 Ga0207665_10166935 3300025939 Bacteria 1587
223 Ga0207691_10034449 3300025940 Bacteria 4708
224 Ga0207711_10009271 3300025941 Bacteria 8217
225 Ga0207711_10031419 3300025941 Bacteria 4482
226 Ga0207661_10000365 3300025944 Bacteria 29025
227 Ga0207661_10069133 3300025944 Bacteria 2878
228 Ga0207679_10133661 3300025945 Unclassified 1994
229 Ga0207667_10002201 3300025949 Bacteria 24454
230 Ga0207667_10006940 3300025949 Bacteria 13685
231 Ga0207667_10008600 3300025949 Bacteria 12112
232 Ga0207667_10278127 3300025949 Bacteria 1711
233 Ga0207658_10051933 3300025986 Unclassified 3023
234 Ga0207677_10036712 3300026023 Unclassified 3197
235 Ga0207703_10274232 3300026035 Bacteria 1529
236 Ga0207639_10063628 3300026041 Bacteria 2857
237 Ga0207639_10276646 3300026041 Bacteria 1475
238 Ga0207678_10004649 3300026067 Bacteria 12329
239 Ga0207702_10007555 3300026078 Bacteria 9266
240 Ga0207702_10069529 3300026078 Bacteria 3027
241 Ga0207648_10018872 3300026089 Bacteria 6231
242 Ga0207676_10074732 3300026095 Unclassified 2732
243 Ga0207676_10249384 3300026095 Bacteria 1597
244 Ga0207674_10000042 3300026116 Bacteria 126790
245 Ga0207674_10004196 3300026116 Bacteria 17388
246 Ga0207674_10071734 3300026116 Unclassified 3479
247 Ga0207683_10111839 3300026121 Bacteria 2445
248 Ga0207698_10006089 3300026142 Bacteria 7505
249 Ga0207698_10055625 3300026142 Bacteria 3051
250 Ga0209995_1009365 3300027471 Bacteria 1583
251 Ga0207428_10142806 3300027907 Bacteria 1826
252 Ga0268266_10038860 3300028379 Bacteria 4052
253 Ga0265337_1004614 3300028556 Bacteria 5676
254 Ga0265334_10030658 3300028573 Bacteria 2151
255 Ga0265338_10006310 3300028800 Bacteria 15156
256 Ga0265338_10135247 3300028800 Bacteria 1939
257 Ga0265320_10028280 3300031240 Bacteria 2913
258 Ga0265340_10009286 3300031247 Bacteria 5281
259 Ga0265340_10045283 3300031247 Bacteria 2150
260 Ga0265313_10023853 3300031595 Bacteria 3285
261 Ga0307514_10008253 3300031649 Bacteria 8887
262 Ga0265314_10000503 3300031711 Bacteria 50401
263 Ga0265314_10091245 3300031711 Bacteria 1983
264 Ga0307516_10046117 3300031730 Bacteria 4302
265 Ga0316577_10082895 3300031733 Unclassified 1794
266 Ga0307510_10007386 3300033180 Bacteria 13103
267 Ga0307510_10054704 3300033180 Bacteria 4177
268 Ga0373934_0006121 3300035086 Bacteria 4457
269 Ga0373934_0011706 3300035086 Bacteria 3303
270 Ga0373923_0019041 3300035111 Bacteria 2652
271 Ga0373923_0038528 3300035111 Bacteria 1959
272 Ga0373923_0061490 3300035111 Bacteria 1596
273 Ga0373936_0010781 3300035113 Bacteria 3450
274 Ga0373953_0009641 3300035117 Bacteria 3331
275 Ga0373954_0002721 3300035118 Bacteria 7445
276 Ga0373954_0006277 3300035118 Bacteria 5181
277 Ga0373954_0049152 3300035118 Bacteria 1977
278 Ga0373956_0051409 3300035119 Bacteria 1852
279 Ga0373956_0070830 3300035119 Bacteria 1591
280 Ga0373956_0090159 3300035119 Bacteria 1414
281 Ga0373956_0111867 3300035119 Bacteria 1271
282 Ga0373956_0127876 3300035119 Bacteria 1188
283 Ga0373957_0035068 3300035120 Bacteria 1862
284 Ga0373943_0111305 3300035170 Bacteria 1445
285 Ga0373955_0033496 3300035172 Bacteria 2706
286 Ga0373955_0046947 3300035172 Bacteria 2337
287 Ga0373924_0023130 3300035410 Bacteria 2434
288 Ga0373933_0008498 3300035724 Bacteria 5603
289 Ga0373933_0073328 3300035724 Bacteria 2085
290 Ga0373937_0022414 3300036401 Bacteria 5678
291 Ga0373937_0068216 3300036401 Bacteria 3278
292 Ga0373937_0072145 3300036401 Bacteria 3184
293 Ga0373937_0139648 3300036401 Bacteria 2266
294 Ga0373925_0017557 3300037068 Bacteria 5189
295 Ga0395900_0168880 3300037418 Bacteria 2228
296 Ga0395898_0360400 3300037466 Bacteria 1386
297 Ga0395905_0122180 3300037471 Bacteria 2448
298 Ga0436364_0267374 3300037853 Bacteria 1365
299 Ga0436361_1038323 3300039447 Bacteria 2363
300 Ga0451839_0077038 3300041496 Bacteria 2526
301 Ga0451841_0948534 3300041498 Bacteria 1785
302 Ga0451845_0598475 3300041501 Bacteria 2328
303 Ga0451847_0802911 3300041503 Bacteria 5131
304 Ga0451849_0697350 3300041505 Bacteria 4693
305 Ga0451851_0043303 3300041507 Bacteria 3730
306 Ga0451851_0263386 3300041507 Bacteria 1740
307 Ga0451843_1430367 3300041509 Bacteria 2686
308 Ga0451853_0771661 3300041512 Bacteria 2980
309 Ga0439449_0129596 3300042007 Bacteria 937
310 Ga0451577_0090108 3300042876 Bacteria 2737
311 Ga0466969_0003242 3300044656 Bacteria 8658
312 Ga0466972_0000023 3300044658 Bacteria 192679
313 Ga0466972_0000831 3300044658 Bacteria 14787
314 Ga0466972_0012822 3300044658 Bacteria 4210
315 Ga0466965_0001992 3300044683 Bacteria 8543
316 Ga0466965_0020562 3300044683 Bacteria 3174
317 Ga0466966_0004250 3300044684 Bacteria 9447
318 Ga0466963_0002639 3300044694 Bacteria 10072
319 Ga0466964_0000086 3300044706 Bacteria 21639
320 Ga0466971_0000313 3300044719 Bacteria 18671
321 Ga0466968_0029256 3300044735 Bacteria 2278
322 Ga0466968_0029445 3300044735 Bacteria 2271
323 Ga0466957_0035667 3300044842 Bacteria 2985
324 Ga0466957_0125670 3300044842 Bacteria 1638
325 Ga0466959_0014772 3300045049 Bacteria 5683
326 Ga0466958_0084043 3300045836 Bacteria 1963
327 Ga0466958_0125693 3300045836 Bacteria 1608
328 Ga0495592_0028935 3300046454 Bacteria 4194
329 Ga0495651_0054698 3300046462 Bacteria 3068
330 Ga0495651_0062287 3300046462 Bacteria 2854
331 Ga0495653_0052120 3300046463 Bacteria 3137
332 Ga0495580_0103101 3300046472 Bacteria 1983
333 Ga0495580_0212511 3300046472 Bacteria 1331
334 Ga0495582_0002852 3300046473 Bacteria 9672
335 Ga0495662_0055863 3300046476 Bacteria 1907
336 Ga0495664_0045293 3300046477 Bacteria 2609
337 Ga0495606_0012416 3300046507 Bacteria 6832
338 Ga0495608_0012083 3300046511 Bacteria 6002
339 Ga0495618_0009264 3300046514 Bacteria 5941
340 Ga0495618_0077422 3300046514 Bacteria 2119
341 Ga0495620_0017527 3300046515 Bacteria 3566
342 Ga0495628_0009098 3300046516 Bacteria 8497
343 Ga0495628_0095515 3300046516 Bacteria 2297
344 Ga0495631_0035662 3300046518 Bacteria 2224
345 Ga0495648_0007545 3300046524 Bacteria 8694
346 Ga0495648_0030631 3300046524 Bacteria 3554
347 Ga0495652_0058029 3300046529 Bacteria 3280
348 Ga0495652_0331510 3300046529 Unclassified 1096
349 Ga0495654_0000148 3300046530 Bacteria 72863
350 Ga0495665_0063585 3300046531 Bacteria 1948
351 Ga0495586_0009311 3300046535 Bacteria 5224
352 Ga0495587_0160752 3300046536 Bacteria 1278
353 Ga0495667_0043733 3300046559 Bacteria 2967
354 Ga0495668_0013332 3300046616 Bacteria 4854
355 Ga0495611_0091165 3300046648 Bacteria 1409
356 Ga0495625_0020002 3300046660 Bacteria 5177
357 Ga0495625_0091809 3300046660 Bacteria 2098
358 Ga0495657_0083390 3300046675 Bacteria 2063
359 Ga0495599_0038056 3300046678 Bacteria 3022
360 Ga0495658_0072791 3300046683 Bacteria 1999
361 Ga0495669_0001666 3300046684 Bacteria 9110
362 Ga0495613_0049747 3300046689 Bacteria 3092
363 Ga0495613_0206611 3300046689 Bacteria 1382
364 Ga0495600_0034644 3300046809 Bacteria 3278
365 Ga0495660_0026969 3300046810 Bacteria 3252
366 Ga0495675_0167412 3300047444 Bacteria 1351
367 Ga0495677_0023044 3300047445 Bacteria 2260
368 Ga0495684_0008121 3300047471 Bacteria 8117
369 Ga0495684_0063526 3300047471 Bacteria 2806
370 Ga0495602_0315738 3300048088 Bacteria 1139
371 Ga0496101_0161336 3300048904 Bacteria 1719
372 Ga0496102_0088800 3300048905 Bacteria 2858
373 Ga0496104_0075841 3300048907 Bacteria 3202
374 Ga0496112_0044112 3300048915 Bacteria 4368
375 Ga0496112_0428527 3300048915 Bacteria 1261
376 Ga0496113_0052137 3300048916 Bacteria 3054
377 Ga0496115_0184320 3300048918 Bacteria 1725
378 Ga0496120_0020407 3300048923 Bacteria 4212
379 Ga0496121_0023720 3300048924 Bacteria 5896
380 Ga0496122_0063586 3300048925 Bacteria 2691
381 Ga0496123_0073569 3300048926 Bacteria 2119
382 Ga0496124_0001021 3300048927 Bacteria 44387
383 Ga0496124_0025118 3300048927 Bacteria 5402
384 Ga0496125_0020627 3300048928 Bacteria 6181
385 Ga0496126_0003662 3300048929 Bacteria 19191
386 Ga0496126_0040384 3300048929 Bacteria 4325
387 Ga0501032_0150359 3300049569 Bacteria 1531
388 Ga0501033_0323287 3300049570 Bacteria 1083
389 Ga0501034_0302007 3300049571 Bacteria 1537
390 Ga0501034_0372817 3300049571 Bacteria 1353
391 Ga0501038_0095287 3300049574 Bacteria 2486
392 Ga0501042_0007055 3300049578 Bacteria 7340
393 Ga0501047_0420098 3300049581 Bacteria 1169
394 Ga0501035_0071240 3300049822 Bacteria 3078
395 Ga0501035_0246698 3300049822 Bacteria 1517
396 Ga0501044_0323678 3300049823 Bacteria 1465
397 Ga0501044_0389812 3300049823 Bacteria 1307
398 nmdc:mga06z11_129552_c1 3300050494 Bacteria 1415
399 nmdc:mga05p37_160448_c1 3300050507 Bacteria 2747
400 nmdc:mga05p37_229846_c1 3300050507 Bacteria 2236
401 nmdc:mga05p37_45803_c1 3300050507 Bacteria 5379
402 nmdc:mga09592_121921_c1 3300050508 Bacteria 2239
403 nmdc:mga09592_28533_c1 3300050508 Bacteria 4636
404 nmdc:mga09592_86178_c1 3300050508 Bacteria 2680
405 nmdc:mga0qj67_121702_c1 3300050509 Bacteria 2111
406 nmdc:mga0qj67_341931_c1 3300050509 Bacteria 1210
407 nmdc:mga06r32_51024_c1 3300050510 Bacteria 3958
408 nmdc:mga08y16_106311_c1 3300050511 Bacteria 2921
409 nmdc:mga0n895_527815_c1 3300050512 Bacteria 1188
410 nmdc:mga08x19_36263_c1 3300050514 Bacteria 3123
411 nmdc:mga0a205_236150_c1 3300050515 Bacteria 1710
412 Ga0495612_0005485 3300053078 Bacteria 5244
413 Ga0495619_0045523 3300053085 Bacteria 2883
414 Ga0495619_0057718 3300053085 Bacteria 2576
415 Ga0495619_0150978 3300053085 Bacteria 1603
416 Ga0500578_0050774 3300053086 Bacteria 2659
417 Ga0500643_003110 3300053087 Bacteria 8147
418 Ga0500562_003493 3300053108 Bacteria 3940
419 Ga0500592_002745 3300053116 Bacteria 2838
420 Ga0500573_0016177 3300053140 Bacteria 4232
421 Ga0500616_0000985 3300053153 Bacteria 30767
422 Ga0500622_0001932 3300053156 Bacteria 15629
423 Ga0466962_0000567 3300061719 Bacteria 16227

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041507 Ga0451851_0263386 Ga0451851_0263386_94_915 266
2 3300042007 Ga0439449_0129596 Ga0439449_0129596_61_915 276
3 3300048924 Ga0496121_0023720 Ga0496121_0023720_5004_5879 279
4 3300035119 Ga0373956_0127876 Ga0373956_0127876_270_1172 289
5 3300048928 Ga0496125_0020627 Ga0496125_0020627_4136_5059 295
6 3300005340 Ga0070689_100214582 Ga0070689_1002145821 311
7 3300025936 Ga0207670_10242642 Ga0207670_102426421 311
8 3300035119 Ga0373956_0070830 Ga0373956_0070830_495_1520 311
9 3300035172 Ga0373955_0046947 Ga0373955_0046947_285_1310 311
10 3300036401 Ga0373937_0139648 Ga0373937_0139648_1020_2045 311
11 3300046477 Ga0495664_0045293 Ga0495664_0045293_1128_2153 311
12 iso_pu_bacteria 2728369276 2729907723 312
13 3300044658 Ga0466972_0000831 Ga0466972_0000831_5659_6687 314
14 3300044683 Ga0466965_0001992 Ga0466965_0001992_3776_4804 314
15 iso_pu_bacteria 643348564 643599998 314
16 3300044683 Ga0466965_0020562 Ga0466965_0020562_896_1903 315
17 3300048927 Ga0496124_0025118 Ga0496124_0025118_1237_2220 315
18 3300005327 Ga0070658_10216718 Ga0070658_102167182 316
19 3300005435 Ga0070714_100001231 Ga0070714_10000123110 316
20 3300005539 Ga0068853_100239339 Ga0068853_1002393391 316
21 3300005548 Ga0070665_100024306 Ga0070665_1000243064 316
22 3300005563 Ga0068855_100334767 Ga0068855_1003347672 316
23 3300005578 Ga0068854_100030046 Ga0068854_1000300463 316
24 3300005616 Ga0068852_100028722 Ga0068852_1000287223 316
25 3300006028 Ga0070717_10154700 Ga0070717_101547002 316
26 3300009174 Ga0105241_10000714 Ga0105241_100007144 316
27 3300009545 Ga0105237_10337965 Ga0105237_103379651 316
28 3300010375 Ga0105239_10325381 Ga0105239_103253812 316
29 3300013296 Ga0157374_10106294 Ga0157374_101062942 316
30 3300025904 Ga0207647_10005843 Ga0207647_100058432 316
31 3300025913 Ga0207695_10003542 Ga0207695_100035423 316
32 3300025914 Ga0207671_10000594 Ga0207671_1000059432 316
33 3300025914 Ga0207671_10000750 Ga0207671_1000075026 316
34 3300025924 Ga0207694_10004729 Ga0207694_100047293 316
35 3300025929 Ga0207664_10004048 Ga0207664_100040489 316
36 3300026041 Ga0207639_10276646 Ga0207639_102766462 316
37 3300031649 Ga0307514_10008253 Ga0307514_100082533 316
38 3300031730 Ga0307516_10046117 Ga0307516_100461171 316
39 3300033180 Ga0307510_10054704 Ga0307510_100547042 316
40 3300046529 Ga0495652_0058029 Ga0495652_0058029_1004_1975 316
41 3300046530 Ga0495654_0000148 Ga0495654_0000148_40426_41400 316
42 3300049578 Ga0501042_0007055 Ga0501042_0007055_1909_2877 316
43 3300049581 Ga0501047_0420098 Ga0501047_0420098_29_1003 316
44 3300053078 Ga0495612_0005485 Ga0495612_0005485_1174_2145 316
45 3300053085 Ga0495619_0045523 Ga0495619_0045523_668_1639 316
46 3300053153 Ga0500616_0000985 Ga0500616_0000985_27251_28222 316
47 3300005290 Ga0065712_10019742 Ga0065712_100197423 317
48 3300005290 Ga0065712_10119487 Ga0065712_101194871 317
49 3300005293 Ga0065715_10131967 Ga0065715_101319672 317
50 3300005355 Ga0070671_100175894 Ga0070671_1001758942 317
51 3300025931 Ga0207644_10145902 Ga0207644_101459022 317
52 3300042876 Ga0451577_0090108 Ga0451577_0090108_687_1661 317
53 3300048905 Ga0496102_0088800 Ga0496102_0088800_204_1172 317
54 3300050494 nmdc:mga06z11_129552_c1 nmdc:mga06z11_129552_c1_141_1115 317
55 3300049570 Ga0501033_0323287 Ga0501033_0323287_80_1069 318
56 3300005549 Ga0070704_100357178 Ga0070704_1003571781 320
57 3300014497 Ga0182008_10079634 Ga0182008_100796342 320
58 3300015261 Ga0182006_1017861 Ga0182006_10178612 320
59 3300015262 Ga0182007_10009845 Ga0182007_100098452 320
60 3300021388 Ga0213875_10105022 Ga0213875_101050221 320
61 3300025939 Ga0207665_10166935 Ga0207665_101669352 320
62 3300037853 Ga0436364_0267374 Ga0436364_0267374_148_1167 320
63 3300046454 Ga0495592_0028935 Ga0495592_0028935_1022_1987 320
64 3300046472 Ga0495580_0212511 Ga0495580_0212511_190_1155 320
65 3300046476 Ga0495662_0055863 Ga0495662_0055863_521_1486 320
66 3300046678 Ga0495599_0038056 Ga0495599_0038056_1575_2540 320
67 3300046689 Ga0495613_0049747 Ga0495613_0049747_803_1768 320
68 3300048927 Ga0496124_0001021 Ga0496124_0001021_41609_42595 320
69 3300046529 Ga0495652_0331510 Ga0495652_0331510_102_1070 321
70 3300005547 Ga0070693_100141658 Ga0070693_1001416582 322
71 3300009147 Ga0114129_10327559 Ga0114129_103275591 322
72 3300013102 Ga0157371_10188123 Ga0157371_101881232 322
73 3300014326 Ga0157380_10005132 Ga0157380_100051326 322
74 3300046683 Ga0495658_0072791 Ga0495658_0072791_38_1015 322
75 3300048918 Ga0496115_0184320 Ga0496115_0184320_20_997 322
76 3300050507 nmdc:mga05p37_160448_c1 nmdc:mga05p37_160448_c1_23_1024 322
77 3300050507 nmdc:mga05p37_45803_c1 nmdc:mga05p37_45803_c1_3987_4988 322
78 3300050508 nmdc:mga09592_28533_c1 nmdc:mga09592_28533_c1_2450_3451 322
79 3300050512 nmdc:mga0n895_527815_c1 nmdc:mga0n895_527815_c1_28_1029 322
80 3300050515 nmdc:mga0a205_236150_c1 nmdc:mga0a205_236150_c1_105_1106 322
81 3300005436 Ga0070713_100014373 Ga0070713_1000143732 323
82 3300013105 Ga0157369_10634603 Ga0157369_106346031 323
83 3300039447 Ga0436361_1038323 Ga0436361_1038323_1341_2339 327
84 3300003320 rootH2_10149170 rootH2_101491701 328
85 3300005458 Ga0070681_10104144 Ga0070681_101041444 330
86 3300025912 Ga0207707_10073135 Ga0207707_100731355 330
87 3300031733 Ga0316577_10082895 Ga0316577_100828952 330
88 3300053108 Ga0500562_003493 Ga0500562_003493_2394_3443 330
89 3300005331 Ga0070670_100104883 Ga0070670_1001048832 331
90 3300005335 Ga0070666_10000307 Ga0070666_1000030727 331
91 3300005354 Ga0070675_100023295 Ga0070675_1000232952 331
92 3300005364 Ga0070673_100008398 Ga0070673_1000083984 331
93 3300005544 Ga0070686_100079291 Ga0070686_1000792912 331
94 3300005618 Ga0068864_100017568 Ga0068864_1000175683 331
95 3300005842 Ga0068858_100024022 Ga0068858_1000240223 331
96 3300006847 Ga0075431_100033221 Ga0075431_1000332212 331
97 3300006880 Ga0075429_100065557 Ga0075429_1000655574 331
98 3300013306 Ga0163162_10001514 Ga0163162_1000151411 331
99 3300014968 Ga0157379_10348245 Ga0157379_103482452 331
100 3300025925 Ga0207650_10021072 Ga0207650_100210722 331
101 3300025940 Ga0207691_10034449 Ga0207691_100344494 331
102 3300025986 Ga0207658_10051933 Ga0207658_100519333 331
103 3300026023 Ga0207677_10036712 Ga0207677_100367121 331
104 3300031595 Ga0265313_10023853 Ga0265313_100238533 331
105 3300050508 nmdc:mga09592_121921_c1 nmdc:mga09592_121921_c1_1169_2200 331
106 3300006844 Ga0075428_100003973 Ga0075428_1000039737 332
107 3300006846 Ga0075430_100167527 Ga0075430_1001675272 332
108 3300006847 Ga0075431_100062562 Ga0075431_1000625622 332
109 3300009147 Ga0114129_10116601 Ga0114129_101166012 332
110 3300017792 Ga0163161_10060951 Ga0163161_100609514 332
111 3300050509 nmdc:mga0qj67_341931_c1 nmdc:mga0qj67_341931_c1_146_1159 332
112 3300050510 nmdc:mga06r32_51024_c1 nmdc:mga06r32_51024_c1_1187_2200 332
113 3300027471 Ga0209995_1009365 Ga0209995_10093652 333
114 3300046684 Ga0495669_0001666 Ga0495669_0001666_6009_7040 333
115 iso_pu_bacteria 2795385470 2795785082 334
116 iso_pu_bacteria 8003314358 8003322592 334
117 3300009093 Ga0105240_10171793 Ga0105240_101717932 335
118 iso_pu_bacteria 2579778775 2580935473 335
119 iso_pu_bacteria 2619619294 2621277328 335
120 3300005344 Ga0070661_100060265 Ga0070661_1000602653 336
121 3300005564 Ga0070664_100000069 Ga0070664_1000000693 336
122 3300009177 Ga0105248_10017519 Ga0105248_100175196 336
123 3300014325 Ga0163163_10246815 Ga0163163_102468152 336
124 3300025920 Ga0207649_10033256 Ga0207649_100332562 336
125 3300025941 Ga0207711_10031419 Ga0207711_100314192 336
126 3300025945 Ga0207679_10133661 Ga0207679_101336612 336
127 iso_pu_bacteria 2512564039 2512733928 336
128 iso_pu_bacteria 2857465823 2857471890 336
129 3300009093 Ga0105240_10069090 Ga0105240_100690903 337
130 3300025909 Ga0207705_10291331 Ga0207705_102913311 337
131 3300028800 Ga0265338_10135247 Ga0265338_101352472 337
132 3300048929 Ga0496126_0040384 Ga0496126_0040384_258_1304 337
133 3300049571 Ga0501034_0372817 Ga0501034_0372817_112_1158 337
134 3300049822 Ga0501035_0246698 Ga0501035_0246698_129_1175 337
135 3300049823 Ga0501044_0323678 Ga0501044_0323678_355_1401 337
136 iso_pu_bacteria 2510461076 2510895551 337
137 iso_pu_bacteria 2515154114 2515645834 337
138 iso_pu_bacteria 2515154116 2515655177 337
139 iso_pu_bacteria 2517287029 2517407623 337
140 iso_pu_bacteria 2643221676 2644424594 337
141 iso_pu_bacteria 8005382845 8005388954 337
142 iso_pu_bacteria 8005395548 8005395937 337
143 3300005435 Ga0070714_100277763 Ga0070714_1002777631 338
144 3300005436 Ga0070713_100083140 Ga0070713_1000831404 338
145 3300005455 Ga0070663_100001290 Ga0070663_1000012904 338
146 3300005548 Ga0070665_100017981 Ga0070665_1000179815 338
147 3300005937 Ga0081455_10000011 Ga0081455_10000011193 338
148 3300006028 Ga0070717_10096082 Ga0070717_100960822 338
149 3300006028 Ga0070717_10485719 Ga0070717_104857191 338
150 3300009545 Ga0105237_10213109 Ga0105237_102131092 338
151 3300013105 Ga0157369_10060843 Ga0157369_100608433 338
152 3300025913 Ga0207695_10139691 Ga0207695_101396912 338
153 3300025915 Ga0207693_10220941 Ga0207693_102209412 338
154 3300025928 Ga0207700_10150511 Ga0207700_101505112 338
155 3300025929 Ga0207664_10148382 Ga0207664_101483823 338
156 3300026067 Ga0207678_10004649 Ga0207678_100046495 338
157 3300028379 Ga0268266_10038860 Ga0268266_100388603 338
158 3300028556 Ga0265337_1004614 Ga0265337_10046145 338
159 3300028573 Ga0265334_10030658 Ga0265334_100306582 338
160 3300028800 Ga0265338_10006310 Ga0265338_1000631014 338
161 3300031240 Ga0265320_10028280 Ga0265320_100282802 338
162 3300031247 Ga0265340_10009286 Ga0265340_100092865 338
163 3300031711 Ga0265314_10091245 Ga0265314_100912452 338
164 3300035086 Ga0373934_0011706 Ga0373934_0011706_1373_2422 338
165 3300035111 Ga0373923_0061490 Ga0373923_0061490_487_1536 338
166 3300035113 Ga0373936_0010781 Ga0373936_0010781_2051_3100 338
167 3300035118 Ga0373954_0049152 Ga0373954_0049152_895_1944 338
168 3300035170 Ga0373943_0111305 Ga0373943_0111305_288_1337 338
169 3300037418 Ga0395900_0168880 Ga0395900_0168880_319_1368 338
170 3300037466 Ga0395898_0360400 Ga0395898_0360400_226_1275 338
171 3300037471 Ga0395905_0122180 Ga0395905_0122180_374_1423 338
172 3300044694 Ga0466963_0002639 Ga0466963_0002639_7302_8351 338
173 3300044735 Ga0466968_0029445 Ga0466968_0029445_135_1241 338
174 3300044842 Ga0466957_0035667 Ga0466957_0035667_1897_2946 338
175 3300045836 Ga0466958_0125693 Ga0466958_0125693_38_1087 338
176 3300046462 Ga0495651_0054698 Ga0495651_0054698_1758_2807 338
177 3300046463 Ga0495653_0052120 Ga0495653_0052120_1773_2822 338
178 3300046514 Ga0495618_0077422 Ga0495618_0077422_89_1138 338
179 3300046516 Ga0495628_0009098 Ga0495628_0009098_6949_7998 338
180 3300046559 Ga0495667_0043733 Ga0495667_0043733_1523_2572 338
181 3300046675 Ga0495657_0083390 Ga0495657_0083390_93_1142 338
182 3300046809 Ga0495600_0034644 Ga0495600_0034644_1104_2153 338
183 3300047444 Ga0495675_0167412 Ga0495675_0167412_31_1080 338
184 3300047471 Ga0495684_0063526 Ga0495684_0063526_1490_2539 338
185 3300048088 Ga0495602_0315738 Ga0495602_0315738_20_1069 338
186 3300048904 Ga0496101_0161336 Ga0496101_0161336_643_1692 338
187 3300048915 Ga0496112_0044112 Ga0496112_0044112_1203_2252 338
188 3300048916 Ga0496113_0052137 Ga0496113_0052137_1564_2613 338
189 3300048923 Ga0496120_0020407 Ga0496120_0020407_2051_3100 338
190 3300048925 Ga0496122_0063586 Ga0496122_0063586_1614_2663 338
191 3300048926 Ga0496123_0073569 Ga0496123_0073569_866_1915 338
192 3300049569 Ga0501032_0150359 Ga0501032_0150359_57_1106 338
193 3300049571 Ga0501034_0302007 Ga0501034_0302007_71_1120 338
194 3300049574 Ga0501038_0095287 Ga0501038_0095287_65_1114 338
195 3300049822 Ga0501035_0071240 Ga0501035_0071240_807_1856 338
196 3300053085 Ga0495619_0150978 Ga0495619_0150978_336_1385 338
197 3300053116 Ga0500592_002745 Ga0500592_002745_109_1128 338
198 iso_pu_bacteria 2818991460 2819682001 338
199 iso_pu_bacteria 2929177148 2929178429 338
200 iso_pu_bacteria 2945977869 2945980829 338
201 iso_pu_bacteria 2946013367 2946019770 338
202 3300045836 Ga0466958_0084043 Ga0466958_0084043_180_1217 339
203 3300053140 Ga0500573_0016177 Ga0500573_0016177_3139_4182 339
204 3300005841 Ga0068863_100080055 Ga0068863_1000800554 340
205 3300005842 Ga0068858_100387966 Ga0068858_1003879661 340
206 3300006237 Ga0097621_100009107 Ga0097621_1000091072 340
207 3300006358 Ga0068871_100057255 Ga0068871_1000572551 340
208 3300009093 Ga0105240_10000457 Ga0105240_1000045750 340
209 3300025913 Ga0207695_10000066 Ga0207695_1000006650 340
210 3300025913 Ga0207695_10000156 Ga0207695_1000015659 340
211 3300026035 Ga0207703_10274232 Ga0207703_102742322 340
212 3300035119 Ga0373956_0090159 Ga0373956_0090159_333_1358 340
213 3300035120 Ga0373957_0035068 Ga0373957_0035068_302_1327 340
214 3300044658 Ga0466972_0000023 Ga0466972_0000023_86761_87783 340
215 3300046511 Ga0495608_0012083 Ga0495608_0012083_433_1458 340
216 3300046524 Ga0495648_0030631 Ga0495648_0030631_2128_3150 340
217 3300046616 Ga0495668_0013332 Ga0495668_0013332_831_1853 340
218 3300046660 Ga0495625_0020002 Ga0495625_0020002_4122_5144 340
219 3300046689 Ga0495613_0206611 Ga0495613_0206611_314_1339 340
220 3300047445 Ga0495677_0023044 Ga0495677_0023044_772_1794 340
221 3300048929 Ga0496126_0003662 Ga0496126_0003662_7354_8400 340
222 3300053087 Ga0500643_003110 Ga0500643_003110_7112_8134 340
223 3300005539 Ga0068853_100004903 Ga0068853_1000049035 341
224 3300006844 Ga0075428_100262158 Ga0075428_1002621582 341
225 3300006881 Ga0068865_100020749 Ga0068865_1000207494 341
226 3300009094 Ga0111539_10227120 Ga0111539_102271202 341
227 3300009551 Ga0105238_10011865 Ga0105238_100118652 341
228 3300010375 Ga0105239_10393955 Ga0105239_103939552 341
229 3300013296 Ga0157374_10000015 Ga0157374_10000015122 341
230 3300013306 Ga0163162_10312512 Ga0163162_103125121 341
231 3300014969 Ga0157376_10012172 Ga0157376_100121723 341
232 3300025913 Ga0207695_10054011 Ga0207695_100540114 341
233 3300025924 Ga0207694_10057807 Ga0207694_100578072 341
234 3300041496 Ga0451839_0077038 Ga0451839_0077038_291_1331 341
235 3300041498 Ga0451841_0948534 Ga0451841_0948534_230_1270 341
236 3300041501 Ga0451845_0598475 Ga0451845_0598475_1032_2072 341
237 3300041503 Ga0451847_0802911 Ga0451847_0802911_3060_4100 341
238 3300041505 Ga0451849_0697350 Ga0451849_0697350_1450_2490 341
239 3300041507 Ga0451851_0043303 Ga0451851_0043303_389_1429 341
240 3300041509 Ga0451843_1430367 Ga0451843_1430367_257_1297 341
241 3300041512 Ga0451853_0771661 Ga0451853_0771661_1023_2063 341
242 3300046515 Ga0495620_0017527 Ga0495620_0017527_273_1313 341
243 3300046518 Ga0495631_0035662 Ga0495631_0035662_254_1294 341
244 3300046524 Ga0495648_0007545 Ga0495648_0007545_5275_6315 341
245 3300046648 Ga0495611_0091165 Ga0495611_0091165_323_1363 341
246 3300046660 Ga0495625_0091809 Ga0495625_0091809_824_1864 341
247 3300046810 Ga0495660_0026969 Ga0495660_0026969_325_1365 341
248 3300001989 JGI24739J22299_10004604 JGI24739J22299_100046043 342
249 3300002737 JGI25162J39368_1000223 JGI25162J39368_100022326 342
250 3300002737 JGI25162J39368_1000305 JGI25162J39368_100030513 342
251 3300003215 JGI25153J46596_10033647 JGI25153J46596_100336472 342
252 3300003316 rootH1_10057445 rootH1_100574452 342
253 3300003320 rootH2_10062707 rootH2_1006270711 342
254 3300003320 rootH2_10127796 rootH2_101277962 342
255 3300003320 rootH2_10235252 rootH2_102352522 342
256 3300003320 rootH2_10246733 rootH2_102467332 342
257 3300003320 rootH2_10295873 rootH2_102958732 342
258 3300003322 rootL2_10037395 rootL2_100373951 342
259 3300003322 rootL2_10175820 rootL2_101758203 342
260 3300003323 rootH1_10016736 rootH1_1001673623 342
261 3300003323 rootH1_10158222 rootH1_101582224 342
262 3300003323 rootH1_10345561 rootH1_103455612 342
263 3300003771 Ga0055526_1004431 Ga0055526_10044312 342
264 3300003771 Ga0055526_1018038 Ga0055526_10180382 342
265 3300003790 Ga0055528_1000180 Ga0055528_100018028 342
266 3300005262 Ga0065165_1000019 Ga0065165_1000019177 342
267 3300005329 Ga0070683_100001153 Ga0070683_1000011538 342
268 3300005329 Ga0070683_100003365 Ga0070683_1000033653 342
269 3300005329 Ga0070683_100005006 Ga0070683_1000050066 342
270 3300005329 Ga0070683_100009403 Ga0070683_1000094037 342
271 3300005329 Ga0070683_100185353 Ga0070683_1001853532 342
272 3300005336 Ga0070680_100003763 Ga0070680_10000376312 342
273 3300005336 Ga0070680_100056279 Ga0070680_1000562793 342
274 3300005338 Ga0068868_100193085 Ga0068868_1001930852 342
275 3300005339 Ga0070660_100021530 Ga0070660_1000215303 342
276 3300005341 Ga0070691_10005990 Ga0070691_100059904 342
277 3300005343 Ga0070687_100092305 Ga0070687_1000923052 342
278 3300005435 Ga0070714_100121064 Ga0070714_1001210642 342
279 3300005456 Ga0070678_100261273 Ga0070678_1002612731 342
280 3300005457 Ga0070662_100099275 Ga0070662_1000992752 342
281 3300005458 Ga0070681_10008049 Ga0070681_1000804911 342
282 3300005458 Ga0070681_10025709 Ga0070681_100257091 342
283 3300005459 Ga0068867_100050482 Ga0068867_1000504825 342
284 3300005530 Ga0070679_100017740 Ga0070679_1000177407 342
285 3300005530 Ga0070679_100068366 Ga0070679_1000683665 342
286 3300005535 Ga0070684_100002184 Ga0070684_1000021842 342
287 3300005535 Ga0070684_100021376 Ga0070684_1000213763 342
288 3300005535 Ga0070684_100094752 Ga0070684_1000947522 342
289 3300005535 Ga0070684_100191414 Ga0070684_1001914142 342
290 3300005539 Ga0068853_100041970 Ga0068853_1000419706 342
291 3300005539 Ga0068853_100184922 Ga0068853_1001849221 342
292 3300005563 Ga0068855_100004019 Ga0068855_1000040199 342
293 3300005563 Ga0068855_100014907 Ga0068855_1000149077 342
294 3300005563 Ga0068855_100287874 Ga0068855_1002878742 342
295 3300005564 Ga0070664_100064316 Ga0070664_1000643162 342
296 3300005577 Ga0068857_100004743 Ga0068857_10000474312 342
297 3300005577 Ga0068857_100044099 Ga0068857_1000440992 342
298 3300005577 Ga0068857_100053344 Ga0068857_1000533443 342
299 3300005614 Ga0068856_100004931 Ga0068856_1000049313 342
300 3300005614 Ga0068856_100015863 Ga0068856_1000158632 342
301 3300005614 Ga0068856_100071334 Ga0068856_1000713343 342
302 3300005616 Ga0068852_100077300 Ga0068852_1000773002 342
303 3300005834 Ga0068851_10032028 Ga0068851_100320285 342
304 3300006237 Ga0097621_100026778 Ga0097621_1000267783 342
305 3300006358 Ga0068871_100047211 Ga0068871_1000472115 342
306 3300006844 Ga0075428_100116247 Ga0075428_1001162472 342
307 3300006846 Ga0075430_100120712 Ga0075430_1001207122 342
308 3300006847 Ga0075431_100347645 Ga0075431_1003476451 342
309 3300006871 Ga0075434_100222702 Ga0075434_1002227022 342
310 3300006880 Ga0075429_100060518 Ga0075429_1000605183 342
311 3300006914 Ga0075436_100049111 Ga0075436_1000491111 342
312 3300009093 Ga0105240_10142486 Ga0105240_101424863 342
313 3300009094 Ga0111539_10149909 Ga0111539_101499091 342
314 3300009098 Ga0105245_10000995 Ga0105245_1000099518 342
315 3300009147 Ga0114129_10350344 Ga0114129_103503442 342
316 3300009174 Ga0105241_10003993 Ga0105241_1000399312 342
317 3300009174 Ga0105241_10057595 Ga0105241_100575952 342
318 3300009174 Ga0105241_10059953 Ga0105241_100599533 342
319 3300009176 Ga0105242_10064141 Ga0105242_100641412 342
320 3300009176 Ga0105242_10166588 Ga0105242_101665881 342
321 3300009177 Ga0105248_10010010 Ga0105248_100100106 342
322 3300009545 Ga0105237_10004841 Ga0105237_1000484112 342
323 3300009545 Ga0105237_10011895 Ga0105237_100118955 342
324 3300009545 Ga0105237_10014459 Ga0105237_100144599 342
325 3300009551 Ga0105238_10003582 Ga0105238_1000358213 342
326 3300009551 Ga0105238_10008740 Ga0105238_1000874011 342
327 3300010375 Ga0105239_10000604 Ga0105239_1000060419 342
328 3300010375 Ga0105239_10001438 Ga0105239_100014384 342
329 3300010375 Ga0105239_10001560 Ga0105239_1000156022 342
330 3300010375 Ga0105239_10004033 Ga0105239_100040333 342
331 3300010375 Ga0105239_10035014 Ga0105239_100350146 342
332 3300010375 Ga0105239_10442003 Ga0105239_104420032 342
333 3300013104 Ga0157370_10012271 Ga0157370_100122719 342
334 3300013105 Ga0157369_10003094 Ga0157369_100030945 342
335 3300013105 Ga0157369_10159337 Ga0157369_101593373 342
336 3300013296 Ga0157374_10105479 Ga0157374_101054792 342
337 3300013297 Ga0157378_10003102 Ga0157378_100031023 342
338 3300013307 Ga0157372_10010127 Ga0157372_1001012712 342
339 3300013307 Ga0157372_10010551 Ga0157372_100105519 342
340 3300013307 Ga0157372_10190592 Ga0157372_101905924 342
341 3300025233 Ga0209437_100070 Ga0209437_100070263 342
342 3300025273 Ga0209673_1000042 Ga0209673_100004290 342
343 3300025295 Ga0209564_1000840 Ga0209564_100084011 342
344 3300025295 Ga0209564_1004230 Ga0209564_10042302 342
345 3300025295 Ga0209564_1029372 Ga0209564_10293722 342
346 3300025297 Ga0209758_1001003 Ga0209758_10010038 342
347 3300025297 Ga0209758_1003437 Ga0209758_10034377 342
348 3300025298 Ga0209050_1000308 Ga0209050_100030828 342
349 3300025302 Ga0207426_1000934 Ga0207426_10009342 342
350 3300025303 Ga0209051_1039253 Ga0209051_10392532 342
351 3300025304 Ga0209257_1001059 Ga0209257_100105917 342
352 3300025321 Ga0207656_10049059 Ga0207656_100490592 342
353 3300025911 Ga0207654_10027991 Ga0207654_100279913 342
354 3300025912 Ga0207707_10001082 Ga0207707_1000108212 342
355 3300025912 Ga0207707_10018467 Ga0207707_1001846713 342
356 3300025913 Ga0207695_10000778 Ga0207695_1000077838 342
357 3300025913 Ga0207695_10001264 Ga0207695_1000126414 342
358 3300025913 Ga0207695_10125850 Ga0207695_101258502 342
359 3300025914 Ga0207671_10003366 Ga0207671_100033664 342
360 3300025914 Ga0207671_10008731 Ga0207671_100087313 342
361 3300025918 Ga0207662_10130155 Ga0207662_101301553 342
362 3300025919 Ga0207657_10018771 Ga0207657_100187713 342
363 3300025919 Ga0207657_10086454 Ga0207657_100864542 342
364 3300025921 Ga0207652_10006515 Ga0207652_100065152 342
365 3300025924 Ga0207694_10000985 Ga0207694_1000098514 342
366 3300025924 Ga0207694_10013630 Ga0207694_100136305 342
367 3300025924 Ga0207694_10027019 Ga0207694_100270195 342
368 3300025927 Ga0207687_10001118 Ga0207687_100011182 342
369 3300025927 Ga0207687_10001962 Ga0207687_100019629 342
370 3300025929 Ga0207664_10086034 Ga0207664_100860342 342
371 3300025933 Ga0207706_10184679 Ga0207706_101846793 342
372 3300025934 Ga0207686_10029808 Ga0207686_100298081 342
373 3300025934 Ga0207686_10054779 Ga0207686_100547792 342
374 3300025941 Ga0207711_10009271 Ga0207711_100092718 342
375 3300025944 Ga0207661_10000365 Ga0207661_1000036528 342
376 3300025944 Ga0207661_10069133 Ga0207661_100691332 342
377 3300025949 Ga0207667_10002201 Ga0207667_1000220114 342
378 3300025949 Ga0207667_10006940 Ga0207667_100069409 342
379 3300025949 Ga0207667_10008600 Ga0207667_1000860011 342
380 3300025949 Ga0207667_10278127 Ga0207667_102781272 342
381 3300026041 Ga0207639_10063628 Ga0207639_100636283 342
382 3300026078 Ga0207702_10007555 Ga0207702_100075553 342
383 3300026078 Ga0207702_10069529 Ga0207702_100695293 342
384 3300026089 Ga0207648_10018872 Ga0207648_100188726 342
385 3300026095 Ga0207676_10074732 Ga0207676_100747323 342
386 3300026095 Ga0207676_10249384 Ga0207676_102493841 342
387 3300026116 Ga0207674_10000042 Ga0207674_1000004230 342
388 3300026116 Ga0207674_10004196 Ga0207674_1000419615 342
389 3300026116 Ga0207674_10071734 Ga0207674_100717343 342
390 3300026121 Ga0207683_10111839 Ga0207683_101118392 342
391 3300026142 Ga0207698_10006089 Ga0207698_100060897 342
392 3300026142 Ga0207698_10055625 Ga0207698_100556253 342
393 3300027907 Ga0207428_10142806 Ga0207428_101428061 342
394 3300031247 Ga0265340_10045283 Ga0265340_100452832 342
395 3300031711 Ga0265314_10000503 Ga0265314_1000050318 342
396 3300033180 Ga0307510_10007386 Ga0307510_100073862 342
397 3300035086 Ga0373934_0006121 Ga0373934_0006121_835_1872 342
398 3300035111 Ga0373923_0019041 Ga0373923_0019041_1164_2201 342
399 3300035111 Ga0373923_0038528 Ga0373923_0038528_52_1089 342
400 3300035117 Ga0373953_0009641 Ga0373953_0009641_1487_2524 342
401 3300035118 Ga0373954_0002721 Ga0373954_0002721_3887_4924 342
402 3300035118 Ga0373954_0006277 Ga0373954_0006277_1380_2417 342
403 3300035119 Ga0373956_0051409 Ga0373956_0051409_527_1573 342
404 3300035119 Ga0373956_0111867 Ga0373956_0111867_11_1048 342
405 3300035172 Ga0373955_0033496 Ga0373955_0033496_841_1878 342
406 3300035410 Ga0373924_0023130 Ga0373924_0023130_683_1720 342
407 3300035724 Ga0373933_0008498 Ga0373933_0008498_106_1152 342
408 3300035724 Ga0373933_0073328 Ga0373933_0073328_983_2020 342
409 3300036401 Ga0373937_0022414 Ga0373937_0022414_1922_2959 342
410 3300036401 Ga0373937_0068216 Ga0373937_0068216_738_1784 342
411 3300036401 Ga0373937_0072145 Ga0373937_0072145_1345_2382 342
412 3300037068 Ga0373925_0017557 Ga0373925_0017557_4060_5097 342
413 3300044656 Ga0466969_0003242 Ga0466969_0003242_4044_5105 342
414 3300044658 Ga0466972_0012822 Ga0466972_0012822_31_1068 342
415 3300044684 Ga0466966_0004250 Ga0466966_0004250_6411_7472 342
416 3300044706 Ga0466964_0000086 Ga0466964_0000086_20439_21500 342
417 3300044719 Ga0466971_0000313 Ga0466971_0000313_13644_14705 342
418 3300044735 Ga0466968_0029256 Ga0466968_0029256_896_2062 342
419 3300044842 Ga0466957_0125670 Ga0466957_0125670_497_1558 342
420 3300045049 Ga0466959_0014772 Ga0466959_0014772_1081_2142 342
421 3300046462 Ga0495651_0062287 Ga0495651_0062287_881_1918 342
422 3300046472 Ga0495580_0103101 Ga0495580_0103101_300_1340 342
423 3300046473 Ga0495582_0002852 Ga0495582_0002852_596_1633 342
424 3300046507 Ga0495606_0012416 Ga0495606_0012416_3716_4744 342
425 3300046514 Ga0495618_0009264 Ga0495618_0009264_1613_2671 342
426 3300046516 Ga0495628_0095515 Ga0495628_0095515_249_1286 342
427 3300046531 Ga0495665_0063585 Ga0495665_0063585_384_1421 342
428 3300046535 Ga0495586_0009311 Ga0495586_0009311_1383_2441 342
429 3300046536 Ga0495587_0160752 Ga0495587_0160752_180_1217 342
430 3300047471 Ga0495684_0008121 Ga0495684_0008121_5860_6897 342
431 3300048907 Ga0496104_0075841 Ga0496104_0075841_1871_2908 342
432 3300048915 Ga0496112_0428527 Ga0496112_0428527_51_1088 342
433 3300049823 Ga0501044_0389812 Ga0501044_0389812_234_1271 342
434 3300050507 nmdc:mga05p37_229846_c1 nmdc:mga05p37_229846_c1_21_1079 342
435 3300050508 nmdc:mga09592_86178_c1 nmdc:mga09592_86178_c1_1097_2155 342
436 3300050509 nmdc:mga0qj67_121702_c1 nmdc:mga0qj67_121702_c1_876_1934 342
437 3300050511 nmdc:mga08y16_106311_c1 nmdc:mga08y16_106311_c1_1510_2568 342
438 3300050514 nmdc:mga08x19_36263_c1 nmdc:mga08x19_36263_c1_949_2007 342
439 3300053085 Ga0495619_0057718 Ga0495619_0057718_991_2028 342
440 3300053086 Ga0500578_0050774 Ga0500578_0050774_914_1996 342
441 3300053156 Ga0500622_0001932 Ga0500622_0001932_5347_6375 342
442 3300061719 Ga0466962_0000567 Ga0466962_0000567_4229_5290 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

58

360

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9632 1 324
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9571 1 330
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9536 1 332
4xk2-assembly1.cif.gz_C crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9497 1 330
4xk2-assembly1.cif.gz_A crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9446 1 330
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9446 1 330 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9235 1 321 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9152 1 321 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9101 1 330 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.91 6 321 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A833G235-F1-model_v4 Aldo/keto reductase 0.9951 1 219 GO:0005829
GO:0016491
AF-A0A7W5N933-F1-model_v4 deleted 0.9924 1 341
AF-A0A3D3L2Q3-F1-model_v4 Aldo/keto reductase 0.9918 43 194 GO:0005829
GO:0016491
AF-A0A1Y2T1F3-F1-model_v4 Aldo/keto reductase 0.9907 1 216 GO:0005829
GO:0016491
AF-A0A2M7MLN7-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9903 1 166 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.93 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map