F444928

General Info

Members Datasets Scaffolds Average Seq Length
442 281 884 284

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0000072|Ga0466960_0000072_12687_13532
Length 274
Sequence MTARILDGSGTAASLLSQVADRVALLRASGLTPKLATVLVGDDGASKTYVQMKVNRCADVGIESVRVDLAGSITTAQLVDAIRELSADPGVHGILLQHPVPGHIDERAAFEAIAPDKDVDGVTLTSFAAMSLGVPAFQSCTPGGIMRLLDAHGIELSGRTAVVVGRSPILGLPMGMLLLRRDATVTYCHSRTADVADAVRRADLLVAAVGRPDFIGAVVVDAGYNPGNRGDVDPAAADVASWFTPVPGGVGPMTIATLLDQTVTAAELRHGVRP

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
65 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
66 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
67 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
90 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
93 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
94 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
95 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
96 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
97 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
98 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
99 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
222 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
223 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 2508501039 Frankia saprophytica CN3 Isolate Nodule
229 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
230 2517572101 Frankia sp. DC12 Isolate Nodule
231 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
232 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
233 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
234 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
235 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
236 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
237 2643221647 Streptomyces sp. Root369 Isolate Unclassified
238 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
239 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
240 2687453737 Frankia sp. BMG5.36 Isolate Nodule
241 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
242 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
243 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
244 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
245 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
246 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
247 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
248 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
249 2862574272 Streptomyces sp. AcE210 Isolate Nodule
250 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
251 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
252 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
253 2867428634 Streptomyces sp. RP5T Isolate Unclassified
254 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
255 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
256 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
257 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
258 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
259 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
260 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
261 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
262 2922554459 Rhodococcus sp. 66b Isolate Unclassified
263 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
264 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
265 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
266 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
267 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
268 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
269 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
270 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
271 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
272 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
273 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
274 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
275 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
276 8002775197 Frankia nepalensis CN7 Isolate Nodule
277 8002784119 Frankia sp. AgB1.9 Isolate Nodule
278 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
279 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
280 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
281 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.56
Metatranscriptomes 0.23
Isolates 12.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.75
Nodule 1.81
Rhizoplane 3.39
Rhizosphere 73.53
Stem 0
Stem Tuber 0.23
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0000072 3300044901 Bacteria 32828
2 JGI24739J22299_10005585 3300001989 Bacteria 4770
3 JGI24737J22298_10038561 3300001990 Bacteria 1471
4 Ga0006562J51391_1047480 3300003578 Bacteria 1640
5 Ga0055540_1004277 3300003792 Bacteria 6528
6 Ga0070667_100021310 3300005367 Bacteria 5383
7 Ga0068853_100041276 3300005539 Bacteria 3940
8 Ga0070665_100022718 3300005548 Bacteria 6314
9 Ga0070665_100054508 3300005548 Bacteria 4010
10 Ga0068855_100018816 3300005563 Bacteria 8302
11 Ga0068854_100101779 3300005578 Bacteria 2155
12 Ga0068856_100118969 3300005614 Bacteria 2643
13 Ga0068859_100000147 3300005617 Bacteria 66782
14 Ga0068859_100005236 3300005617 Bacteria 13181
15 Ga0068859_100017785 3300005617 Bacteria 7146
16 Ga0068864_100577016 3300005618 Bacteria 1089
17 Ga0068863_100000350 3300005841 Bacteria 46893
18 Ga0068863_100000626 3300005841 Bacteria 35805
19 Ga0068858_100131783 3300005842 Bacteria 2344
20 Ga0068860_100000155 3300005843 Bacteria 111737
21 Ga0068862_100000228 3300005844 Bacteria 62540
22 Ga0068862_100000490 3300005844 Bacteria 42284
23 Ga0081455_10038879 3300005937 Bacteria 4210
24 Ga0081455_10138042 3300005937 Bacteria 1897
25 Ga0081539_10004531 3300005985 Bacteria 15253
26 Ga0075363_100041780 3300006048 Bacteria 2419
27 Ga0075363_100075268 3300006048 Bacteria 1839
28 Ga0075364_10017383 3300006051 Bacteria 4492
29 Ga0075367_10004685 3300006178 Bacteria 6713
30 Ga0075369_10004331 3300006186 Bacteria 5235
31 Ga0075428_100000311 3300006844 Bacteria 47950
32 Ga0075430_100001261 3300006846 Bacteria 20394
33 Ga0075431_100245477 3300006847 Bacteria 1820
34 Ga0075431_100343063 3300006847 Bacteria 1503
35 Ga0075429_100003530 3300006880 Bacteria 13324
36 Ga0097620_100000147 3300006931 Bacteria 66782
37 Ga0097620_100005236 3300006931 Bacteria 13181
38 Ga0097620_100017784 3300006931 Bacteria 7146
39 Ga0105247_10000040 3300009101 Bacteria 158975
40 Ga0114129_10028725 3300009147 Bacteria 7880
41 Ga0105241_10001932 3300009174 Bacteria 15679
42 Ga0105248_10000140 3300009177 Bacteria 82939
43 Ga0105248_10005695 3300009177 Bacteria 13689
44 Ga0105237_10017412 3300009545 Bacteria 7450
45 Ga0105237_10371798 3300009545 Bacteria 1434
46 Ga0105238_10021477 3300009551 Bacteria 6575
47 Ga0105249_10000069 3300009553 Bacteria 148118
48 Ga0105249_10015021 3300009553 Bacteria 6850
49 Ga0105239_10047883 3300010375 Bacteria 4685
50 Ga0157374_10052595 3300013296 Bacteria 3794
51 Ga0163163_10034198 3300014325 Bacteria 4920
52 Ga0163163_10034905 3300014325 Bacteria 4875
53 Ga0183367_1004 3300015688 Bacteria 716880
54 Ga0209758_1034520 3300025297 Bacteria 2010
55 Ga0207426_1004184 3300025302 Bacteria 7199
56 Ga0207426_1007181 3300025302 Bacteria 4701
57 Ga0209051_1000330 3300025303 Bacteria 71428
58 Ga0207710_10000050 3300025900 Bacteria 186453
59 Ga0207647_10001499 3300025904 Bacteria 17946
60 Ga0207647_10013278 3300025904 Bacteria 5717
61 Ga0207647_10066209 3300025904 Bacteria 2192
62 Ga0207654_10013696 3300025911 Bacteria 4176
63 Ga0207695_10000324 3300025913 Bacteria 114066
64 Ga0207671_10000133 3300025914 Bacteria 114011
65 Ga0207671_10313166 3300025914 Bacteria 1241
66 Ga0207652_10072561 3300025921 Bacteria 2993
67 Ga0207694_10000161 3300025924 Bacteria 68691
68 Ga0207711_10000082 3300025941 Bacteria 102386
69 Ga0207711_10000182 3300025941 Bacteria 67307
70 Ga0207712_10000084 3300025961 Bacteria 107789
71 Ga0207712_10003487 3300025961 Bacteria 9925
72 Ga0207640_10292779 3300025981 Bacteria 1284
73 Ga0207658_10000868 3300025986 Bacteria 25220
74 Ga0207658_10014570 3300025986 Bacteria 5383
75 Ga0207639_10039147 3300026041 Bacteria 3531
76 Ga0207678_10016105 3300026067 Bacteria 6566
77 Ga0207702_10161528 3300026078 Bacteria 2046
78 Ga0207641_10001121 3300026088 Bacteria 26928
79 Ga0207641_10009822 3300026088 Bacteria 7879
80 Ga0207676_10023847 3300026095 Bacteria 4521
81 Ga0207674_10440163 3300026116 Bacteria 1260
82 Ga0268266_10044036 3300028379 Bacteria 3814
83 Ga0268266_10106250 3300028379 Bacteria 2481
84 Ga0268265_10000239 3300028380 Bacteria 62567
85 Ga0268265_10000473 3300028380 Bacteria 42300
86 Ga0268264_10000219 3300028381 Bacteria 111751
87 Ga0265337_1000762 3300028556 Bacteria 16965
88 Ga0265326_10003264 3300028558 Bacteria 5346
89 Ga0265319_1000065 3300028563 Bacteria 85273
90 Ga0265318_10000518 3300028577 Bacteria 27733
91 Ga0265322_10006465 3300028654 Bacteria 3450
92 Ga0265336_10000001 3300028666 Bacteria 916179
93 Ga0307517_10031640 3300028786 Bacteria 6148
94 Ga0307515_10006168 3300028794 Bacteria 24095
95 Ga0307515_10041851 3300028794 Bacteria 7189
96 Ga0307515_10216564 3300028794 Bacteria 1744
97 Ga0265338_10000004 3300028800 Bacteria 644793
98 Ga0265324_10002161 3300029957 Bacteria 10310
99 Ga0307511_10000186 3300030521 Bacteria 61499
100 Ga0307511_10099169 3300030521 Bacteria 1924
101 Ga0307512_10041695 3300030522 Bacteria 3811
102 Ga0265340_10000002 3300031247 Bacteria 711693
103 Ga0265339_10017390 3300031249 Bacteria 4261
104 Ga0307513_10007316 3300031456 Bacteria 14335
105 Ga0307513_10188550 3300031456 Bacteria 1916
106 Ga0307509_10038763 3300031507 Bacteria 5196
107 Ga0307509_10039783 3300031507 Bacteria 5119
108 Ga0307509_10069005 3300031507 Bacteria 3697
109 Ga0307509_10114985 3300031507 Bacteria 2684
110 Ga0307508_10060016 3300031616 Bacteria 3364
111 Ga0307508_10252795 3300031616 Bacteria 1358
112 Ga0307514_10038801 3300031649 Bacteria 3764
113 Ga0307514_10144708 3300031649 Bacteria 1608
114 Ga0307516_10017447 3300031730 Bacteria 7485
115 Ga0307516_10157232 3300031730 Bacteria 2027
116 Ga0307518_10092618 3300031838 Bacteria 2172
117 Ga0307416_100182815 3300032002 Bacteria 1967
118 Ga0307507_10032989 3300033179 Bacteria 5386
119 Ga0307507_10039253 3300033179 Bacteria 4782
120 Ga0307510_10007451 3300033180 Bacteria 13039
121 Ga0307510_10102315 3300033180 Bacteria 2647
122 Ga0307510_10111369 3300033180 Bacteria 2478
123 Ga0395898_0001353 3300037466 Bacteria 35343
124 Ga0395898_0039230 3300037466 Bacteria 4688
125 Ga0395901_0071801 3300038443 Bacteria 3608
126 Ga0436365_0379644 3300039437 Bacteria 1460
127 Ga0439436_0005173 3300041404 Bacteria 4001
128 Ga0451795_1385555 3300041456 Bacteria 1676
129 Ga0451853_1767468 3300041512 Bacteria 2668
130 Ga0439433_0000072 3300041999 Bacteria 13049
131 Ga0439442_014681 3300042002 Bacteria 1613
132 Ga0439455_0008165 3300042012 Bacteria 2238
133 Ga0439457_016731 3300042014 Bacteria 1632
134 Ga0450898_003255 3300042134 Bacteria 2324
135 Ga0450903_000957 3300042138 Bacteria 5537
136 Ga0439458_0001219 3300042157 Bacteria 6499
137 Ga0450901_003036 3300042533 Bacteria 1768
138 Ga0466969_0045494 3300044656 Bacteria 2179
139 Ga0466969_0080527 3300044656 Bacteria 1555
140 Ga0466969_0120964 3300044656 Bacteria 1219
141 Ga0466972_0008405 3300044658 Bacteria 5176
142 Ga0466972_0023132 3300044658 Bacteria 3092
143 Ga0466965_0061773 3300044683 Bacteria 1873
144 Ga0466965_0090613 3300044683 Bacteria 1555
145 Ga0466966_0027791 3300044684 Bacteria 3688
146 Ga0466961_0002400 3300044693 Bacteria 11641
147 Ga0466961_0010767 3300044693 Bacteria 5842
148 Ga0466961_0026870 3300044693 Bacteria 3701
149 Ga0466961_0040434 3300044693 Bacteria 2990
150 Ga0466961_0137056 3300044693 Bacteria 1533
151 Ga0466963_0000184 3300044694 Bacteria 26087
152 Ga0466964_0020653 3300044706 Bacteria 2538
153 Ga0466971_0001168 3300044719 Bacteria 10914
154 Ga0466968_0007590 3300044735 Bacteria 4129
155 Ga0466968_0050429 3300044735 Bacteria 1776
156 Ga0466970_0002860 3300044765 Bacteria 8346
157 Ga0466970_0013054 3300044765 Bacteria 4257
158 Ga0466970_0065876 3300044765 Bacteria 1944
159 Ga0466957_0000619 3300044842 Bacteria 17948
160 Ga0466957_0281570 3300044842 Bacteria 1113
161 Ga0466960_0002066 3300044901 Bacteria 7465
162 Ga0466960_0046692 3300044901 Bacteria 2074
163 Ga0466960_0082163 3300044901 Bacteria 1626
164 Ga0466959_0009364 3300045049 Bacteria 6961
165 Ga0466959_0011845 3300045049 Bacteria 6279
166 Ga0466958_0008106 3300045836 Bacteria 5812
167 Ga0466967_0059047 3300045976 Bacteria 3393
168 Ga0466967_0142389 3300045976 Bacteria 2234
169 Ga0466967_0500227 3300045976 Bacteria 1193
170 Ga0466967_0654117 3300045976 Bacteria 1039
171 Ga0495617_028255 3300046452 Bacteria 1885
172 Ga0495592_0003676 3300046454 Bacteria 11051
173 Ga0495603_0007238 3300046455 Bacteria 6661
174 Ga0495603_0015772 3300046455 Bacteria 4568
175 Ga0495603_0023557 3300046455 Bacteria 3723
176 Ga0495603_0076127 3300046455 Bacteria 1969
177 Ga0495629_0021526 3300046459 Bacteria 4601
178 Ga0495629_0030119 3300046459 Bacteria 3848
179 Ga0495629_0041637 3300046459 Bacteria 3232
180 Ga0495629_0096481 3300046459 Bacteria 2062
181 Ga0495651_0026114 3300046462 Bacteria 4547
182 Ga0495580_0058416 3300046472 Bacteria 2713
183 Ga0495580_0121388 3300046472 Bacteria 1814
184 Ga0495605_0002415 3300046474 Bacteria 11546
185 Ga0495605_0130568 3300046474 Bacteria 1133
186 Ga0495639_0030542 3300046475 Bacteria 2395
187 Ga0495662_0003724 3300046476 Bacteria 7679
188 Ga0495662_0003896 3300046476 Bacteria 7527
189 Ga0495662_0008284 3300046476 Bacteria 5117
190 Ga0495664_0030107 3300046477 Bacteria 3178
191 Ga0495664_0091388 3300046477 Bacteria 1830
192 Ga0495664_0171842 3300046477 Bacteria 1314
193 Ga0495585_0086397 3300046492 Bacteria 1694
194 Ga0495585_0089796 3300046492 Bacteria 1656
195 Ga0495594_0002678 3300046499 Bacteria 9268
196 Ga0495594_0050142 3300046499 Bacteria 2295
197 Ga0495607_0030528 3300046501 Bacteria 3307
198 Ga0495583_0144526 3300046506 Bacteria 988
199 Ga0495606_0019299 3300046507 Bacteria 5077
200 Ga0495608_0220680 3300046511 Bacteria 1189
201 Ga0495610_0046509 3300046512 Bacteria 2140
202 Ga0495616_0005693 3300046513 Bacteria 7634
203 Ga0495618_0117278 3300046514 Bacteria 1704
204 Ga0495620_0006602 3300046515 Bacteria 6361
205 Ga0495628_0065430 3300046516 Bacteria 2843
206 Ga0495628_0344451 3300046516 Bacteria 1096
207 Ga0495630_0017510 3300046517 Bacteria 5250
208 Ga0495630_0091117 3300046517 Bacteria 2303
209 Ga0495631_0010119 3300046518 Bacteria 4682
210 Ga0495632_0100900 3300046519 Bacteria 1361
211 Ga0495643_0001303 3300046522 Bacteria 23710
212 Ga0495666_0017634 3300046526 Bacteria 3554
213 Ga0495642_0033335 3300046528 Bacteria 2071
214 Ga0495652_0001972 3300046529 Bacteria 21850
215 Ga0495665_0043273 3300046531 Bacteria 2395
216 Ga0495640_0019817 3300046533 Bacteria 4960
217 Ga0495586_0003139 3300046535 Bacteria 8891
218 Ga0495586_0020615 3300046535 Bacteria 3510
219 Ga0495587_0013452 3300046536 Bacteria 5143
220 Ga0495587_0019662 3300046536 Bacteria 4177
221 Ga0495587_0098809 3300046536 Bacteria 1682
222 Ga0495597_0061556 3300046542 Bacteria 1634
223 Ga0495645_0005026 3300046543 Bacteria 9062
224 Ga0495645_0008545 3300046543 Bacteria 7151
225 Ga0495622_0011638 3300046557 Bacteria 4066
226 Ga0495622_0060596 3300046557 Bacteria 1753
227 Ga0495622_0064713 3300046557 Bacteria 1691
228 Ga0495633_0068761 3300046558 Bacteria 1653
229 Ga0495667_0101584 3300046559 Bacteria 1860
230 Ga0495668_0003669 3300046616 Bacteria 11342
231 Ga0495668_0010603 3300046616 Bacteria 5567
232 Ga0495668_0032591 3300046616 Bacteria 2930
233 Ga0495634_0015204 3300046642 Bacteria 5533
234 Ga0495611_0011872 3300046648 Bacteria 3698
235 Ga0495611_0013457 3300046648 Bacteria 3484
236 Ga0495625_0042284 3300046660 Bacteria 3313
237 Ga0495635_0007364 3300046663 Bacteria 7678
238 Ga0495635_0292605 3300046663 Bacteria 1092
239 Ga0495588_0001409 3300046674 Bacteria 10273
240 Ga0495588_0043376 3300046674 Bacteria 2301
241 Ga0495657_0007656 3300046675 Bacteria 8315
242 Ga0495657_0018015 3300046675 Bacteria 5119
243 Ga0495657_0055042 3300046675 Bacteria 2655
244 Ga0495657_0177584 3300046675 Bacteria 1308
245 Ga0495646_0004866 3300046680 Bacteria 8487
246 Ga0495646_0012644 3300046680 Bacteria 5362
247 Ga0495658_0019800 3300046683 Bacteria 3518
248 Ga0495613_0005827 3300046689 Bacteria 9223
249 Ga0495613_0008660 3300046689 Bacteria 7547
250 Ga0495613_0009858 3300046689 Bacteria 7105
251 Ga0495613_0037608 3300046689 Bacteria 3587
252 Ga0495613_0040895 3300046689 Bacteria 3433
253 Ga0495671_0030768 3300046692 Bacteria 2747
254 Ga0495649_0116286 3300046694 Bacteria 1416
255 Ga0495589_0015887 3300046794 Bacteria 3870
256 Ga0495589_0025933 3300046794 Bacteria 2971
257 Ga0495600_0005528 3300046809 Bacteria 7626
258 Ga0495600_0044987 3300046809 Bacteria 2879
259 Ga0495600_0109508 3300046809 Bacteria 1798
260 Ga0495600_0473535 3300046809 Bacteria 772
261 Ga0495581_0007895 3300047315 Bacteria 6160
262 Ga0495581_0008076 3300047315 Bacteria 6092
263 Ga0495581_0024990 3300047315 Bacteria 3461
264 Ga0495581_0215182 3300047315 Bacteria 1123
265 Ga0495604_0002938 3300047317 Bacteria 13655
266 Ga0495604_0008476 3300047317 Bacteria 8118
267 Ga0495604_0010161 3300047317 Bacteria 7454
268 Ga0495604_0024015 3300047317 Bacteria 4866
269 Ga0495636_0000910 3300047318 Bacteria 11010
270 Ga0495636_0006705 3300047318 Bacteria 4529
271 Ga0495636_0060423 3300047318 Bacteria 1601
272 Ga0495636_0088367 3300047318 Bacteria 1343
273 Ga0495674_0055385 3300047319 Bacteria 3479
274 Ga0495674_0672105 3300047319 Bacteria 815
275 Ga0495672_0163980 3300047320 Bacteria 1140
276 Ga0495676_0001288 3300047321 Bacteria 21499
277 Ga0495676_0032646 3300047321 Bacteria 4392
278 Ga0495676_0033424 3300047321 Bacteria 4331
279 Ga0495676_0035845 3300047321 Bacteria 4147
280 Ga0495676_0087568 3300047321 Bacteria 2339
281 Ga0495680_0014939 3300047322 Bacteria 6709
282 Ga0495683_0148832 3300047323 Bacteria 1091
283 Ga0495687_001922 3300047443 Bacteria 17816
284 Ga0495687_006729 3300047443 Bacteria 6964
285 Ga0495687_017438 3300047443 Bacteria 3583
286 Ga0495687_058191 3300047443 Bacteria 1604
287 Ga0495687_077320 3300047443 Bacteria 1314
288 Ga0495675_0006346 3300047444 Bacteria 7239
289 Ga0495685_011916 3300047447 Bacteria 2941
290 Ga0495685_018356 3300047447 Bacteria 2400
291 Ga0495685_024752 3300047447 Bacteria 2066
292 Ga0495685_027875 3300047447 Bacteria 1942
293 Ga0495684_0137666 3300047471 Bacteria 1832
294 Ga0495684_0150000 3300047471 Bacteria 1743
295 Ga0495686_0019134 3300047472 Bacteria 4580
296 Ga0495593_0015225 3300047673 Bacteria 4362
297 Ga0495602_0079212 3300048088 Bacteria 2772
298 Ga0495602_0204123 3300048088 Bacteria 1505
299 Ga0495614_0000221 3300048089 Bacteria 22151
300 Ga0495614_0002063 3300048089 Bacteria 8852
301 Ga0495614_0016953 3300048089 Bacteria 3166
302 Ga0495614_0023904 3300048089 Bacteria 2637
303 Ga0496100_0001824 3300048903 Bacteria 10643
304 Ga0496101_0000229 3300048904 Bacteria 41526
305 Ga0496102_0000006 3300048905 Bacteria 471494
306 Ga0496102_0000716 3300048905 Bacteria 32822
307 Ga0496102_0006330 3300048905 Bacteria 10093
308 Ga0496102_0176595 3300048905 Bacteria 2011
309 Ga0496103_0000006 3300048906 Bacteria 470539
310 Ga0496103_0000767 3300048906 Bacteria 23698
311 Ga0496103_0005351 3300048906 Bacteria 7692
312 Ga0496103_0080112 3300048906 Bacteria 2053
313 Ga0496106_0150213 3300048909 Bacteria 1837
314 Ga0496107_0010473 3300048910 Bacteria 6444
315 Ga0496107_0021472 3300048910 Bacteria 4563
316 Ga0496114_0083950 3300048917 Bacteria 2696
317 Ga0496116_0000025 3300048919 Bacteria 470539
318 Ga0496116_0000099 3300048919 Bacteria 195607
319 Ga0496116_0040870 3300048919 Bacteria 3187
320 Ga0496116_0064670 3300048919 Bacteria 2351
321 Ga0496117_0000006 3300048920 Bacteria 758420
322 Ga0496117_0004185 3300048920 Bacteria 16123
323 Ga0496117_0004749 3300048920 Bacteria 14751
324 Ga0496117_0005894 3300048920 Bacteria 12660
325 Ga0496118_0000004 3300048921 Bacteria 758420
326 Ga0496118_0001678 3300048921 Bacteria 32430
327 Ga0496118_0003018 3300048921 Bacteria 21736
328 Ga0496118_0009058 3300048921 Bacteria 10142
329 Ga0496118_0036859 3300048921 Bacteria 3946
330 Ga0496118_0087014 3300048921 Bacteria 2169
331 Ga0496119_0000035 3300048922 Bacteria 217007
332 Ga0496119_0008840 3300048922 Bacteria 8759
333 Ga0496119_0027018 3300048922 Bacteria 3960
334 Ga0496120_0000079 3300048923 Bacteria 160413
335 Ga0496120_0031679 3300048923 Bacteria 3198
336 Ga0496121_0000090 3300048924 Bacteria 217920
337 Ga0496121_0083717 3300048924 Bacteria 2517
338 Ga0496121_0123051 3300048924 Bacteria 1955
339 Ga0496121_0158083 3300048924 Bacteria 1661
340 Ga0496124_0228633 3300048927 Bacteria 1392
341 Ga0496125_0007556 3300048928 Bacteria 11545
342 Ga0496126_0001750 3300048929 Bacteria 32173
343 Ga0496126_0060056 3300048929 Bacteria 3421
344 Ga0501031_0017153 3300049568 Bacteria 4705
345 Ga0501032_0015165 3300049569 Bacteria 5443
346 Ga0501033_0187189 3300049570 Bacteria 1482
347 Ga0501034_0015596 3300049571 Bacteria 7804
348 Ga0501036_0001654 3300049572 Bacteria 17267
349 Ga0501036_0006127 3300049572 Bacteria 9759
350 Ga0501036_0016449 3300049572 Bacteria 6177
351 Ga0501038_0052977 3300049574 Bacteria 3496
352 Ga0501038_0074246 3300049574 Bacteria 2877
353 Ga0501039_0150558 3300049575 Bacteria 1828
354 Ga0501039_0184125 3300049575 Bacteria 1642
355 Ga0501042_0012340 3300049578 Bacteria 5785
356 Ga0501047_0015791 3300049581 Bacteria 7197
357 Ga0501047_0060430 3300049581 Bacteria 3657
358 Ga0501048_0006999 3300049582 Bacteria 8568
359 Ga0501070_0045431 3300049586 Bacteria 3653
360 Ga0501070_0201672 3300049586 Bacteria 1634
361 Ga0501070_0299152 3300049586 Bacteria 1311
362 Ga0501070_0355877 3300049586 Bacteria 1188
363 Ga0501073_0009626 3300049589 Bacteria 7128
364 Ga0501074_0002014 3300049590 Bacteria 13996
365 Ga0501074_0401040 3300049590 Bacteria 973
366 Ga0501081_0014216 3300049743 Bacteria 5249
367 Ga0501044_0029613 3300049823 Bacteria 5771
368 Ga0501044_0076112 3300049823 Bacteria 3407
369 Ga0501044_0171247 3300049823 Bacteria 2143
370 Ga0501044_0546990 3300049823 Bacteria 1055
371 nmdc:mga03n38_32957_c1 3300050490 Bacteria 2200
372 nmdc:mga00v17_1550_c1 3300050491 Bacteria 11997
373 nmdc:mga06z11_3877_c1 3300050494 Bacteria 5831
374 nmdc:mga05p37_30428_c1 3300050507 Bacteria 6587
375 nmdc:mga09592_93105_c1 3300050508 Bacteria 2577
376 nmdc:mga0qj67_605_c1 3300050509 Bacteria 24545
377 nmdc:mga06r32_21294_c1 3300050510 Bacteria 5984
378 nmdc:mga06r32_8115_c1 3300050510 Bacteria 9447
379 Ga0495612_0033718 3300053078 Bacteria 2072
380 Ga0500583_0030009 3300053092 Bacteria 2377
381 Ga0500583_0100870 3300053092 Bacteria 1414
382 Ga0500640_020459 3300053095 Bacteria 2844
383 Ga0500560_003117 3300053107 Bacteria 3298
384 Ga0500572_004530 3300053111 Bacteria 3156
385 Ga0500573_0034333 3300053140 Bacteria 2926
386 Ga0500616_0009688 3300053153 Bacteria 5829
387 Ga0500624_002791 3300053157 Bacteria 2324
388 Ga0466962_0000902 3300061719 Bacteria 13479
389 2508677522 2508501039 Bacteria 9978592
390 2516092114 2515154203 Bacteria 5458536
391 2517763633 2517572101 Bacteria 6884336
392 2566992775 2565956761 Bacteria 6601618
393 2585296413 2582581312 Bacteria 7308206
394 2585303228 2582581313 Bacteria 10042643
395 2585312594 2582581314 Bacteria 11452267
396 2616696422 2616644814 Bacteria 11555299
397 2643946839 2643221587 Bacteria 7586415
398 2644266817 2643221647 Bacteria 10741251
399 2644435020 2643221677 Bacteria 7584031
400 2676199491 2675902999 Bacteria 9438463
401 2689961791 2687453737 Bacteria 11203906
402 2768645850 2767802112 Bacteria 6465194
403 2774844069 2773857921 Bacteria 9435764
404 2785374054 2784746768 Bacteria 10036182
405 2786674301 2786546132 Bacteria 10419719
406 2804843850 2802429296 Bacteria 7227771
407 2812334588 2811994874 Bacteria 5367947
408 2812353836 2811994879 Bacteria 9313447
409 2862283795 2862281513 Bacteria 9621493
410 2862574669 2862574272 Bacteria 10567477
411 2867307486 2867302475 Bacteria 7087181
412 2867317997 2867312974 Bacteria 7058875
413 2867324184 2867319477 Bacteria 7069771
414 2867434805 2867428634 Bacteria 9590268
415 2873319854 2873314349 Bacteria 8512634
416 2877677233 2877676314 Bacteria 9512378
417 2899376366 2899370129 Bacteria 6781179
418 2902840805 2902837492 Bacteria 6697721
419 2904540291 2904535858 Bacteria 6308016
420 2912715560 2912715099 Bacteria 9460473
421 2912728357 2912723979 Bacteria 8557534
422 2918508507 2918501144 Bacteria 8668083
423 2922556321 2922554459 Bacteria 6683962
424 2929219830 2929212328 Bacteria 7708288
425 2946071860 2946064051 Bacteria 8957905
426 2947232741 2947224130 Bacteria 9938529
427 2954381960 2954380949 Bacteria 10050426
428 2954681110 2954673503 Bacteria 9685905
429 2954683047 2954682443 Bacteria 9862841
430 2954692769 2954691527 Bacteria 10720516
431 2954707842 2954701450 Bacteria 10834262
432 2954719747 2954711539 Bacteria 10867210
433 2954729782 2954721474 Bacteria 10456478
434 2954748687 2954740390 Bacteria 10229294
435 2954750966 2954749733 Bacteria 10366972
436 2995465194 2995463766 Bacteria 8577691
437 8002777412 8002775197 Bacteria 10728764
438 8002792401 8002784119 Bacteria 9788632
439 8008575486 8008574985 Bacteria 7815457
440 8025418799 8025413630 Bacteria 7014048
441 8054160621 8054160619 Bacteria 7783213
442 8056834832 8056829672 Bacteria 9045328
443 Ga0466960_0000072
444 JGI24739J22299_10005585
445 JGI24737J22298_10038561
446 Ga0006562J51391_1047480
447 Ga0055540_1004277
448 Ga0070667_100021310
449 Ga0068853_100041276
450 Ga0070665_100022718
451 Ga0070665_100054508
452 Ga0068855_100018816
453 Ga0068854_100101779
454 Ga0068856_100118969
455 Ga0068859_100000147
456 Ga0068859_100005236
457 Ga0068859_100017785
458 Ga0068864_100577016
459 Ga0068863_100000350
460 Ga0068863_100000626
461 Ga0068858_100131783
462 Ga0068860_100000155
463 Ga0068862_100000228
464 Ga0068862_100000490
465 Ga0081455_10038879
466 Ga0081455_10138042
467 Ga0081539_10004531
468 Ga0075363_100041780
469 Ga0075363_100075268
470 Ga0075364_10017383
471 Ga0075367_10004685
472 Ga0075369_10004331
473 Ga0075428_100000311
474 Ga0075430_100001261
475 Ga0075431_100245477
476 Ga0075431_100343063
477 Ga0075429_100003530
478 Ga0097620_100000147
479 Ga0097620_100005236
480 Ga0097620_100017784
481 Ga0105247_10000040
482 Ga0114129_10028725
483 Ga0105241_10001932
484 Ga0105248_10000140
485 Ga0105248_10005695
486 Ga0105237_10017412
487 Ga0105237_10371798
488 Ga0105238_10021477
489 Ga0105249_10000069
490 Ga0105249_10015021
491 Ga0105239_10047883
492 Ga0157374_10052595
493 Ga0163163_10034198
494 Ga0163163_10034905
495 Ga0183367_1004
496 Ga0209758_1034520
497 Ga0207426_1004184
498 Ga0207426_1007181
499 Ga0209051_1000330
500 Ga0207710_10000050
501 Ga0207647_10001499
502 Ga0207647_10013278
503 Ga0207647_10066209
504 Ga0207654_10013696
505 Ga0207695_10000324
506 Ga0207671_10000133
507 Ga0207671_10313166
508 Ga0207652_10072561
509 Ga0207694_10000161
510 Ga0207711_10000082
511 Ga0207711_10000182
512 Ga0207712_10000084
513 Ga0207712_10003487
514 Ga0207640_10292779
515 Ga0207658_10000868
516 Ga0207658_10014570
517 Ga0207639_10039147
518 Ga0207678_10016105
519 Ga0207702_10161528
520 Ga0207641_10001121
521 Ga0207641_10009822
522 Ga0207676_10023847
523 Ga0207674_10440163
524 Ga0268266_10044036
525 Ga0268266_10106250
526 Ga0268265_10000239
527 Ga0268265_10000473
528 Ga0268264_10000219
529 Ga0265337_1000762
530 Ga0265326_10003264
531 Ga0265319_1000065
532 Ga0265318_10000518
533 Ga0265322_10006465
534 Ga0265336_10000001
535 Ga0307517_10031640
536 Ga0307515_10006168
537 Ga0307515_10041851
538 Ga0307515_10216564
539 Ga0265338_10000004
540 Ga0265324_10002161
541 Ga0307511_10000186
542 Ga0307511_10099169
543 Ga0307512_10041695
544 Ga0265340_10000002
545 Ga0265339_10017390
546 Ga0307513_10007316
547 Ga0307513_10188550
548 Ga0307509_10038763
549 Ga0307509_10039783
550 Ga0307509_10069005
551 Ga0307509_10114985
552 Ga0307508_10060016
553 Ga0307508_10252795
554 Ga0307514_10038801
555 Ga0307514_10144708
556 Ga0307516_10017447
557 Ga0307516_10157232
558 Ga0307518_10092618
559 Ga0307416_100182815
560 Ga0307507_10032989
561 Ga0307507_10039253
562 Ga0307510_10007451
563 Ga0307510_10102315
564 Ga0307510_10111369
565 Ga0395898_0001353
566 Ga0395898_0039230
567 Ga0395901_0071801
568 Ga0436365_0379644
569 Ga0439436_0005173
570 Ga0451795_1385555
571 Ga0451853_1767468
572 Ga0439433_0000072
573 Ga0439442_014681
574 Ga0439455_0008165
575 Ga0439457_016731
576 Ga0450898_003255
577 Ga0450903_000957
578 Ga0439458_0001219
579 Ga0450901_003036
580 Ga0466969_0045494
581 Ga0466969_0080527
582 Ga0466969_0120964
583 Ga0466972_0008405
584 Ga0466972_0023132
585 Ga0466965_0061773
586 Ga0466965_0090613
587 Ga0466966_0027791
588 Ga0466961_0002400
589 Ga0466961_0010767
590 Ga0466961_0026870
591 Ga0466961_0040434
592 Ga0466961_0137056
593 Ga0466963_0000184
594 Ga0466964_0020653
595 Ga0466971_0001168
596 Ga0466968_0007590
597 Ga0466968_0050429
598 Ga0466970_0002860
599 Ga0466970_0013054
600 Ga0466970_0065876
601 Ga0466957_0000619
602 Ga0466957_0281570
603 Ga0466960_0002066
604 Ga0466960_0046692
605 Ga0466960_0082163
606 Ga0466959_0009364
607 Ga0466959_0011845
608 Ga0466958_0008106
609 Ga0466967_0059047
610 Ga0466967_0142389
611 Ga0466967_0500227
612 Ga0466967_0654117
613 Ga0495617_028255
614 Ga0495592_0003676
615 Ga0495603_0007238
616 Ga0495603_0015772
617 Ga0495603_0023557
618 Ga0495603_0076127
619 Ga0495629_0021526
620 Ga0495629_0030119
621 Ga0495629_0041637
622 Ga0495629_0096481
623 Ga0495651_0026114
624 Ga0495580_0058416
625 Ga0495580_0121388
626 Ga0495605_0002415
627 Ga0495605_0130568
628 Ga0495639_0030542
629 Ga0495662_0003724
630 Ga0495662_0003896
631 Ga0495662_0008284
632 Ga0495664_0030107
633 Ga0495664_0091388
634 Ga0495664_0171842
635 Ga0495585_0086397
636 Ga0495585_0089796
637 Ga0495594_0002678
638 Ga0495594_0050142
639 Ga0495607_0030528
640 Ga0495583_0144526
641 Ga0495606_0019299
642 Ga0495608_0220680
643 Ga0495610_0046509
644 Ga0495616_0005693
645 Ga0495618_0117278
646 Ga0495620_0006602
647 Ga0495628_0065430
648 Ga0495628_0344451
649 Ga0495630_0017510
650 Ga0495630_0091117
651 Ga0495631_0010119
652 Ga0495632_0100900
653 Ga0495643_0001303
654 Ga0495666_0017634
655 Ga0495642_0033335
656 Ga0495652_0001972
657 Ga0495665_0043273
658 Ga0495640_0019817
659 Ga0495586_0003139
660 Ga0495586_0020615
661 Ga0495587_0013452
662 Ga0495587_0019662
663 Ga0495587_0098809
664 Ga0495597_0061556
665 Ga0495645_0005026
666 Ga0495645_0008545
667 Ga0495622_0011638
668 Ga0495622_0060596
669 Ga0495622_0064713
670 Ga0495633_0068761
671 Ga0495667_0101584
672 Ga0495668_0003669
673 Ga0495668_0010603
674 Ga0495668_0032591
675 Ga0495634_0015204
676 Ga0495611_0011872
677 Ga0495611_0013457
678 Ga0495625_0042284
679 Ga0495635_0007364
680 Ga0495635_0292605
681 Ga0495588_0001409
682 Ga0495588_0043376
683 Ga0495657_0007656
684 Ga0495657_0018015
685 Ga0495657_0055042
686 Ga0495657_0177584
687 Ga0495646_0004866
688 Ga0495646_0012644
689 Ga0495658_0019800
690 Ga0495613_0005827
691 Ga0495613_0008660
692 Ga0495613_0009858
693 Ga0495613_0037608
694 Ga0495613_0040895
695 Ga0495671_0030768
696 Ga0495649_0116286
697 Ga0495589_0015887
698 Ga0495589_0025933
699 Ga0495600_0005528
700 Ga0495600_0044987
701 Ga0495600_0109508
702 Ga0495600_0473535
703 Ga0495581_0007895
704 Ga0495581_0008076
705 Ga0495581_0024990
706 Ga0495581_0215182
707 Ga0495604_0002938
708 Ga0495604_0008476
709 Ga0495604_0010161
710 Ga0495604_0024015
711 Ga0495636_0000910
712 Ga0495636_0006705
713 Ga0495636_0060423
714 Ga0495636_0088367
715 Ga0495674_0055385
716 Ga0495674_0672105
717 Ga0495672_0163980
718 Ga0495676_0001288
719 Ga0495676_0032646
720 Ga0495676_0033424
721 Ga0495676_0035845
722 Ga0495676_0087568
723 Ga0495680_0014939
724 Ga0495683_0148832
725 Ga0495687_001922
726 Ga0495687_006729
727 Ga0495687_017438
728 Ga0495687_058191
729 Ga0495687_077320
730 Ga0495675_0006346
731 Ga0495685_011916
732 Ga0495685_018356
733 Ga0495685_024752
734 Ga0495685_027875
735 Ga0495684_0137666
736 Ga0495684_0150000
737 Ga0495686_0019134
738 Ga0495593_0015225
739 Ga0495602_0079212
740 Ga0495602_0204123
741 Ga0495614_0000221
742 Ga0495614_0002063
743 Ga0495614_0016953
744 Ga0495614_0023904
745 Ga0496100_0001824
746 Ga0496101_0000229
747 Ga0496102_0000006
748 Ga0496102_0000716
749 Ga0496102_0006330
750 Ga0496102_0176595
751 Ga0496103_0000006
752 Ga0496103_0000767
753 Ga0496103_0005351
754 Ga0496103_0080112
755 Ga0496106_0150213
756 Ga0496107_0010473
757 Ga0496107_0021472
758 Ga0496114_0083950
759 Ga0496116_0000025
760 Ga0496116_0000099
761 Ga0496116_0040870
762 Ga0496116_0064670
763 Ga0496117_0000006
764 Ga0496117_0004185
765 Ga0496117_0004749
766 Ga0496117_0005894
767 Ga0496118_0000004
768 Ga0496118_0001678
769 Ga0496118_0003018
770 Ga0496118_0009058
771 Ga0496118_0036859
772 Ga0496118_0087014
773 Ga0496119_0000035
774 Ga0496119_0008840
775 Ga0496119_0027018
776 Ga0496120_0000079
777 Ga0496120_0031679
778 Ga0496121_0000090
779 Ga0496121_0083717
780 Ga0496121_0123051
781 Ga0496121_0158083
782 Ga0496124_0228633
783 Ga0496125_0007556
784 Ga0496126_0001750
785 Ga0496126_0060056
786 Ga0501031_0017153
787 Ga0501032_0015165
788 Ga0501033_0187189
789 Ga0501034_0015596
790 Ga0501036_0001654
791 Ga0501036_0006127
792 Ga0501036_0016449
793 Ga0501038_0052977
794 Ga0501038_0074246
795 Ga0501039_0150558
796 Ga0501039_0184125
797 Ga0501042_0012340
798 Ga0501047_0015791
799 Ga0501047_0060430
800 Ga0501048_0006999
801 Ga0501070_0045431
802 Ga0501070_0201672
803 Ga0501070_0299152
804 Ga0501070_0355877
805 Ga0501073_0009626
806 Ga0501074_0002014
807 Ga0501074_0401040
808 Ga0501081_0014216
809 Ga0501044_0029613
810 Ga0501044_0076112
811 Ga0501044_0171247
812 Ga0501044_0546990
813 nmdc:mga03n38_32957_c1
814 nmdc:mga00v17_1550_c1
815 nmdc:mga06z11_3877_c1
816 nmdc:mga05p37_30428_c1
817 nmdc:mga09592_93105_c1
818 nmdc:mga0qj67_605_c1
819 nmdc:mga06r32_21294_c1
820 nmdc:mga06r32_8115_c1
821 Ga0495612_0033718
822 Ga0500583_0030009
823 Ga0500583_0100870
824 Ga0500640_020459
825 Ga0500560_003117
826 Ga0500572_004530
827 Ga0500573_0034333
828 Ga0500616_0009688
829 Ga0500624_002791
830 Ga0466962_0000902
831 2508677522
832 2516092114
833 2517763633
834 2566992775
835 2585296413
836 2585303228
837 2585312594
838 2616696422
839 2643946839
840 2644266817
841 2644435020
842 2676199491
843 2689961791
844 2768645850
845 2774844069
846 2785374054
847 2786674301
848 2804843850
849 2812334588
850 2812353836
851 2862283795
852 2862574669
853 2867307486
854 2867317997
855 2867324184
856 2867434805
857 2873319854
858 2877677233
859 2899376366
860 2902840805
861 2904540291
862 2912715560
863 2912728357
864 2918508507
865 2922556321
866 2929219830
867 2946071860
868 2947232741
869 2954381960
870 2954681110
871 2954683047
872 2954692769
873 2954707842
874 2954719747
875 2954729782
876 2954748687
877 2954750966
878 2995465194
879 8002777412
880 8002792401
881 8008575486
882 8025418799
883 8054160621
884 8056834832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

6

120

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

123

270

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b4w-assembly1.cif.gz_A crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and an inhibitor 0.9726 4 281
6ecr-assembly1.cif.gz_A the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp 0.9586 2 280
6ecq-assembly1.cif.gz_A the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp and inhibitor ly345899 0.9579 2 280
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9575 4 278
4cjx-assembly1.cif.gz_B the crystal structure of trypanosoma brucei n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and inhibitor 0.9559 1 282
ID Description Score Start End Superfamily
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9853 35 116 3.40.50.10860
4b4uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9776 31 116 3.40.50.10860
af_Q54VK0_115_197_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9766 35 115 3.40.50.10860
af_K7KDB4_41_138_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9755 142 234 3.40.50.720
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9719 35 115 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A499VIN7-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9933 54 281 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A839NIW7-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.993 2 278 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A7K2Q3D8-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9918 8 281 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A4R7ZW58-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9917 3 281 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A7C6LHP9-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9907 3 281 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Map