F444948

General Info

Members Datasets Scaffolds Average Seq Length
442 338 884 172

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0279360|Ga0495632_0279360_82_708
Length 208
Sequence VKAGFLRERAECDEGLTLIHISIILESLKRGLAQMNVIDNSKIQENDIDLGLLLSVLTGAKDSPLIFYYDGKAVKPGYHVTEVKAGQFSALDCGANPEAWAEIFIQLWDIEEGDRTHMPAGKFQAIIRKVSDYVQLDGSAKLTFEVSDGVRPMQLYCAAMPVLRAGAVHVTLSPRPASCKPRDRWLAQENSKAAACCGPQAATSGCCA

Samples

Sample ID Description Type Environment
1 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
37 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
38 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
43 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
46 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
47 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
78 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
79 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
80 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
81 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
82 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
83 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
84 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
85 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
86 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
87 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
88 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
89 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
90 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
91 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
92 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
93 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
158 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
159 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
160 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
165 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
166 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
167 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
168 2509276019 Ensifer aridi TW10 Isolate Nodule
169 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
170 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
171 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
172 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
173 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
174 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
175 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
176 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
177 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
178 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
179 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
180 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
181 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
182 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
183 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
184 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
185 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
186 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
187 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
188 2519899620 Rhizobium sp. Pop5 Isolate Nodule
189 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
190 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
191 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
192 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
193 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
194 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
195 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
196 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
197 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
198 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
199 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
200 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
201 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
202 2643221557 Ensifer sp. Root558 Isolate Unclassified
203 2643221610 Ensifer sp. Root74 Isolate Unclassified
204 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
205 2643221668 Ensifer sp. Root423 Isolate Unclassified
206 2643221675 Ensifer sp. Root1298 Isolate Unclassified
207 2643221680 Ensifer sp. Root1312 Isolate Unclassified
208 2643221723 Ensifer sp. Root278 Isolate Unclassified
209 2643221726 Ensifer sp. Root954 Isolate Unclassified
210 2718217882 Rhizobium sp. N741 Isolate Nodule
211 2718218009 Rhizobium sp. N561 Isolate Nodule
212 2718218363 Rhizobium sp. N113 Isolate Nodule
213 2718218365 Rhizobium sp. N731 Isolate Nodule
214 2718218366 Rhizobium sp. N621 Isolate Nodule
215 2721755514 Rhizobium sp. N6212 Isolate Nodule
216 2721755810 Rhizobium sp. N871 Isolate Nodule
217 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
218 2728369365 Rhizobium sp. N1341 Isolate Nodule
219 2728369397 Rhizobium sp. N1314 Isolate Nodule
220 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
221 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
222 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
223 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
224 2791355256 Rhizobium sp. M10 Isolate Nodule
225 2791355260 Rhizobium sp. L9 Isolate Nodule
226 2791355261 Rhizobium sp. J15 Isolate Nodule
227 2791355262 Rhizobium sp. M1 Isolate Nodule
228 2791355263 Rhizobium chutanense C5 Isolate Nodule
229 2791355264 Rhizobium sp. S9 Isolate Nodule
230 2791355266 Rhizobium sp. L43 Isolate Nodule
231 2791355267 Rhizobium sp. L18 Isolate Nodule
232 2802429633 Rhizobium anhuiense J3 Isolate Nodule
233 2802429634 Rhizobium anhuiense S10 Isolate Nodule
234 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
235 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
236 2802429637 Rhizobium anhuiense C15 Isolate Nodule
237 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
238 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
239 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
240 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
241 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
242 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
243 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
244 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
245 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
246 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
247 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
248 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
249 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
250 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
251 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
252 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
253 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
254 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
255 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
256 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
257 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
258 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
259 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
260 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
261 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
262 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
263 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
264 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
265 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
266 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
267 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
268 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
269 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
270 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
271 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
272 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
273 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
274 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
275 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
276 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
277 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
278 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
279 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
280 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
281 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
282 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
283 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
284 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
285 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
286 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
287 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
288 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
289 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
290 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
291 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
292 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
293 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
294 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
295 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
296 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
297 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
298 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
299 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
300 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
301 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
302 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
303 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
304 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
305 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
306 2936381700 Rhizobium chutanense C16 Isolate Unclassified
307 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
308 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
309 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
310 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
311 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
312 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
313 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
314 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
315 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
316 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
317 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
318 2996893221 Rhizobium sp. R635 Isolate Nodule
319 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
320 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
321 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
322 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
323 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
324 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
325 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
326 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
327 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
328 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
329 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
330 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
331 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
332 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
333 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
334 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
335 8024501048 Rhizobium sp. H4 Isolate Nodule
336 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
337 8056382006 Rhizobium croatiense 13T Isolate Nodule
338 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.09
Metatranscriptomes 0
Isolates 38.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.02
Nodule 31.22
Rhizoplane 4.75
Rhizosphere 20.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495632_0279360 3300046519 Bacteria 744
2 JGI25158J39367_1000149 3300002739 Bacteria 16457
3 JGI25158J39367_1004670 3300002739 Bacteria 2047
4 JGI25150J39212_1002376 3300002774 Bacteria 4719
5 JGI25159J45721_1000013 3300002987 Bacteria 148953
6 JGI25159J45721_1000183 3300002987 Bacteria 28912
7 JGI25151J46595_10007410 3300003187 Bacteria 5385
8 JGI25153J46596_10028758 3300003215 Bacteria 1922
9 rootH1_10023105 3300003316 Bacteria 4667
10 rootH2_10023790 3300003320 Bacteria 13062
11 rootH2_10101047 3300003320 Bacteria 2092
12 rootL2_10003492 3300003322 Bacteria 36420
13 rootL2_10244177 3300003322 Bacteria 1106
14 rootH1_10030430 3300003323 Bacteria 6026
15 JGI25160J50197_1000013 3300003354 Bacteria 263367
16 JGI25160J50197_1004330 3300003354 Bacteria 6152
17 JGI25160J50197_1032985 3300003354 Bacteria 1308
18 JGI25161J50226_1000295 3300003374 Bacteria 28072
19 JGI25161J50226_1000579 3300003374 Bacteria 15493
20 Ga0055526_1002352 3300003771 Bacteria 12840
21 Ga0055526_1033430 3300003771 Bacteria 1428
22 Ga0055524_1000470 3300003775 Bacteria 32352
23 Ga0055524_1018489 3300003775 Bacteria 2417
24 Ga0055524_1031485 3300003775 Bacteria 1524
25 Ga0055524_1032628 3300003775 Bacteria 1473
26 Ga0055536_1000412 3300003781 Bacteria 30810
27 Ga0055528_1000240 3300003790 Bacteria 45988
28 Ga0055528_1023402 3300003790 Bacteria 1886
29 Ga0055528_1029836 3300003790 Bacteria 1463
30 Ga0055530_10005269 3300003791 Bacteria 6220
31 Ga0055530_10041106 3300003791 Bacteria 1130
32 Ga0055530_10050477 3300003791 Bacteria 969
33 Ga0055540_1000281 3300003792 Bacteria 45821
34 Ga0055540_1015447 3300003792 Bacteria 2222
35 Ga0055531_10022973 3300003794 Bacteria 2357
36 Ga0055531_10025740 3300003794 Bacteria 2125
37 Ga0055531_10053064 3300003794 Bacteria 1050
38 Ga0055543_1000066 3300004625 Bacteria 97081
39 Ga0055543_1000606 3300004625 Bacteria 19421
40 Ga0065165_1000021 3300005262 Bacteria 262983
41 Ga0065165_1008827 3300005262 Bacteria 4635
42 Ga0070668_100313297 3300005347 Bacteria 1319
43 Ga0070669_100975276 3300005353 Bacteria 726
44 Ga0070671_100033364 3300005355 Bacteria 4257
45 Ga0070665_100118796 3300005548 Bacteria 2646
46 Ga0075365_10002000 3300006038 Bacteria 9662
47 Ga0075365_10011296 3300006038 Bacteria 5246
48 Ga0075368_10216864 3300006042 Bacteria 812
49 Ga0075363_100000571 3300006048 Bacteria 12089
50 Ga0075363_100014584 3300006048 Bacteria 3845
51 Ga0075363_100054165 3300006048 Bacteria 2146
52 Ga0075364_10002204 3300006051 Bacteria 10924
53 Ga0075362_10020082 3300006177 Bacteria 2788
54 Ga0075362_10283357 3300006177 Bacteria 820
55 Ga0075367_10000754 3300006178 Bacteria 12622
56 Ga0075369_10000514 3300006186 Bacteria 12124
57 Ga0075369_10008893 3300006186 Bacteria 3884
58 Ga0105251_10060193 3300009011 Bacteria 1788
59 Ga0105248_10044345 3300009177 Bacteria 4987
60 Ga0105249_10236230 3300009553 Bacteria 1805
61 Ga0123340_1036944 3300009763 Bacteria 2522
62 Ga0123341_1068026 3300009765 Bacteria 1603
63 Ga0123342_1010026 3300009766 Bacteria 11023
64 Ga0105239_10471978 3300010375 Bacteria 1425
65 Ga0171463_1003 3300013249 Bacteria 695693
66 Ga0157375_10280885 3300013308 Bacteria 1828
67 Ga0157375_11075002 3300013308 Bacteria 941
68 Ga0183365_12015 3300015684 Bacteria 732
69 Ga0183363_1039 3300015690 Bacteria 43099
70 Ga0163161_10467281 3300017792 Bacteria 1022
71 Ga0214542_1008550 3300021321 Bacteria 16739
72 Ga0214542_1011454 3300021321 Bacteria 12129
73 Ga0214543_1000016 3300021327 Bacteria 295257
74 Ga0214543_1000049 3300021327 Bacteria 149506
75 Ga0209436_100699 3300025208 Bacteria 14094
76 Ga0207425_1001234 3300025245 Bacteria 11206
77 Ga0207425_1016686 3300025245 Bacteria 1626
78 Ga0207425_1047417 3300025245 Bacteria 796
79 Ga0209759_1010928 3300025256 Bacteria 2622
80 Ga0209129_1002720 3300025258 Bacteria 8286
81 Ga0209129_1005686 3300025258 Bacteria 4302
82 Ga0209129_1014249 3300025258 Bacteria 1703
83 Ga0209233_1000455 3300025261 Bacteria 26723
84 Ga0209673_1000013 3300025273 Bacteria 571633
85 Ga0209673_1001356 3300025273 Bacteria 24356
86 Ga0209673_1003447 3300025273 Bacteria 9319
87 Ga0209673_1003671 3300025273 Bacteria 8855
88 Ga0209673_1037912 3300025273 Bacteria 1410
89 Ga0209130_1000039 3300025284 Bacteria 263493
90 Ga0209676_1001587 3300025292 Bacteria 20254
91 Ga0209025_1000301 3300025294 Bacteria 110450
92 Ga0209025_1006552 3300025294 Bacteria 8988
93 Ga0209564_1000081 3300025295 Bacteria 261592
94 Ga0209564_1000525 3300025295 Bacteria 62651
95 Ga0209564_1011475 3300025295 Bacteria 3965
96 Ga0209564_1017604 3300025295 Bacteria 2773
97 Ga0209564_1038000 3300025295 Bacteria 1347
98 Ga0209758_1000699 3300025297 Bacteria 49788
99 Ga0209758_1001356 3300025297 Bacteria 29364
100 Ga0209758_1016282 3300025297 Bacteria 3786
101 Ga0209050_1003596 3300025298 Bacteria 11252
102 Ga0209050_1005216 3300025298 Bacteria 8304
103 Ga0209050_1005767 3300025298 Bacteria 7629
104 Ga0209050_1059987 3300025298 Bacteria 904
105 Ga0209256_1000524 3300025299 Bacteria 55735
106 Ga0209256_1000769 3300025299 Bacteria 41649
107 Ga0209256_1001317 3300025299 Bacteria 26572
108 Ga0209256_1010399 3300025299 Bacteria 3905
109 Ga0207426_1000099 3300025302 Bacteria 263493
110 Ga0207426_1000656 3300025302 Bacteria 42456
111 Ga0209051_1000119 3300025303 Bacteria 148746
112 Ga0209051_1002050 3300025303 Bacteria 15303
113 Ga0209051_1003049 3300025303 Bacteria 11327
114 Ga0209051_1014447 3300025303 Bacteria 3683
115 Ga0209257_1002594 3300025304 Bacteria 17553
116 Ga0209257_1003381 3300025304 Bacteria 13774
117 Ga0209257_1003427 3300025304 Bacteria 13624
118 Ga0207695_10586129 3300025913 Bacteria 996
119 Ga0207681_10715636 3300025923 Bacteria 833
120 Ga0207644_10024887 3300025931 Bacteria 4113
121 Ga0207711_10113012 3300025941 Bacteria 2418
122 Ga0207668_10109111 3300025972 Bacteria 2073
123 Ga0209371_1003589 3300027312 Bacteria 7416
124 Ga0209371_1016362 3300027312 Bacteria 1959
125 Ga0209813_10138326 3300027866 Bacteria 862
126 Ga0268266_10091298 3300028379 Bacteria 2670
127 Ga0268256_1002532 3300030500 Bacteria 9207
128 Ga0268256_1009138 3300030500 Bacteria 3326
129 Ga0268256_1014570 3300030500 Bacteria 2326
130 Ga0307513_10076722 3300031456 Bacteria 3464
131 Ga0395900_1633733 3300037418 Bacteria 556
132 Ga0395905_0001377 3300037471 Bacteria 29471
133 Ga0395905_0071103 3300037471 Bacteria 3262
134 Ga0439466_0080686 3300041411 Bacteria 1026
135 Ga0439465_0069934 3300041413 Bacteria 1175
136 Ga0451787_139972 3300041441 Bacteria 2664
137 Ga0451789_0304040 3300041443 Bacteria 1973
138 Ga0451791_1784392 3300041451 Bacteria 997
139 Ga0451795_0996067 3300041456 Bacteria 641
140 Ga0451798_0585948 3300041458 Bacteria 1718
141 Ga0451807_0541197 3300041486 Bacteria 884
142 Ga0451833_1247346 3300041491 Bacteria 4419
143 Ga0451835_0192922 3300041492 Bacteria 4102
144 Ga0451837_0732906 3300041494 Bacteria 7284
145 Ga0451839_0815740 3300041496 Bacteria 5626
146 Ga0451839_1006201 3300041496 Bacteria 5423
147 Ga0451841_0553159 3300041498 Bacteria 6857
148 Ga0451845_0076104 3300041501 Bacteria 4215
149 Ga0451847_0929205 3300041503 Bacteria 6835
150 Ga0451849_0006899 3300041505 Bacteria 6892
151 Ga0451851_0676020 3300041507 Bacteria 7215
152 Ga0451843_1598276 3300041509 Bacteria 4662
153 Ga0451855_1500994 3300041511 Bacteria 1743
154 Ga0451853_1803116 3300041512 Bacteria 3119
155 Ga0495605_0074228 3300046474 Bacteria 1601
156 Ga0495585_0038106 3300046492 Bacteria 2706
157 Ga0495585_0065575 3300046492 Bacteria 1989
158 Ga0495607_0047873 3300046501 Bacteria 2502
159 Ga0495583_0002734 3300046506 Bacteria 14608
160 Ga0495583_0030876 3300046506 Bacteria 2604
161 Ga0495606_0011182 3300046507 Bacteria 7347
162 Ga0495606_0035248 3300046507 Bacteria 3422
163 Ga0495616_0039571 3300046513 Bacteria 2414
164 Ga0495616_0106208 3300046513 Bacteria 1310
165 Ga0495620_0010226 3300046515 Bacteria 4952
166 Ga0495620_0099535 3300046515 Bacteria 1160
167 Ga0495620_0118902 3300046515 Bacteria 1043
168 Ga0495631_0009287 3300046518 Bacteria 4917
169 Ga0495632_0005695 3300046519 Bacteria 8180
170 Ga0495632_0031483 3300046519 Bacteria 2741
171 Ga0495643_0012767 3300046522 Bacteria 5054
172 Ga0495648_0026307 3300046524 Bacteria 3919
173 Ga0495654_0121185 3300046530 Bacteria 1184
174 Ga0495609_0233830 3300046538 Bacteria 760
175 Ga0495597_0170966 3300046542 Bacteria 882
176 Ga0495622_0002674 3300046557 Bacteria 8558
177 Ga0495633_0013899 3300046558 Bacteria 4221
178 Ga0495633_0384058 3300046558 Bacteria 635
179 Ga0495656_0231760 3300046615 Bacteria 927
180 Ga0495668_0030067 3300046616 Bacteria 3068
181 Ga0495625_0006129 3300046660 Bacteria 10771
182 Ga0495625_0054591 3300046660 Bacteria 2852
183 Ga0495625_0056535 3300046660 Bacteria 2792
184 Ga0495661_0070352 3300046665 Bacteria 2048
185 Ga0495588_0059895 3300046674 Bacteria 1970
186 Ga0495670_0093718 3300046691 Bacteria 1539
187 Ga0495670_0112222 3300046691 Bacteria 1411
188 Ga0495671_0067727 3300046692 Bacteria 1756
189 Ga0495636_0044780 3300047318 Bacteria 1843
190 Ga0495636_0291617 3300047318 Bacteria 762
191 Ga0495672_0010083 3300047320 Bacteria 6763
192 Ga0495687_237722 3300047443 Bacteria 552
193 Ga0495615_0002445 3300048090 Bacteria 2982
194 Ga0496101_0093114 3300048904 Bacteria 2244
195 Ga0496101_0576632 3300048904 Bacteria 890
196 Ga0496102_0174554 3300048905 Bacteria 2023
197 Ga0496104_0009774 3300048907 Bacteria 8553
198 Ga0496105_0006868 3300048908 Bacteria 8760
199 Ga0496106_0000038 3300048909 Bacteria 111983
200 Ga0496106_0035047 3300048909 Bacteria 3751
201 Ga0496107_0056309 3300048910 Bacteria 2841
202 Ga0496108_0270692 3300048911 Bacteria 1478
203 Ga0496109_0084363 3300048912 Bacteria 2931
204 Ga0496110_0009481 3300048913 Bacteria 7881
205 Ga0496111_0005778 3300048914 Bacteria 7982
206 Ga0496111_0032838 3300048914 Bacteria 3701
207 Ga0496113_0010434 3300048916 Bacteria 6143
208 Ga0496116_0047990 3300048919 Bacteria 2869
209 Ga0496117_0000033 3300048920 Bacteria 345605
210 Ga0496117_0162535 3300048920 Bacteria 1306
211 Ga0496118_0000748 3300048921 Bacteria 52574
212 Ga0496118_0084962 3300048921 Bacteria 2206
213 Ga0496118_0316582 3300048921 Bacteria 849
214 Ga0496119_0001142 3300048922 Bacteria 33317
215 Ga0496119_0001309 3300048922 Bacteria 30695
216 Ga0496119_0008896 3300048922 Bacteria 8731
217 Ga0496119_0279792 3300048922 Bacteria 830
218 Ga0496120_0000509 3300048923 Bacteria 60589
219 Ga0496120_0005689 3300048923 Bacteria 9841
220 Ga0496121_0065720 3300048924 Bacteria 2949
221 Ga0496122_0000365 3300048925 Bacteria 97184
222 Ga0496122_0051411 3300048925 Bacteria 3131
223 Ga0496122_0092193 3300048925 Bacteria 2060
224 Ga0496122_0093766 3300048925 Bacteria 2035
225 Ga0496123_0000298 3300048926 Bacteria 97184
226 Ga0496123_0018193 3300048926 Bacteria 5604
227 Ga0496123_0036515 3300048926 Bacteria 3484
228 Ga0496123_0040851 3300048926 Bacteria 3224
229 Ga0496124_0001649 3300048927 Bacteria 31949
230 Ga0496124_0126730 3300048927 Bacteria 2032
231 Ga0496124_0258779 3300048927 Bacteria 1282
232 Ga0496125_0001442 3300048928 Bacteria 34575
233 Ga0496125_0019496 3300048928 Bacteria 6394
234 Ga0496125_0088096 3300048928 Bacteria 2341
235 Ga0496126_0008742 3300048929 Bacteria 10874
236 Ga0496126_0121589 3300048929 Bacteria 2263
237 Ga0501034_0706998 3300049571 Bacteria 906
238 Ga0501037_0118888 3300049573 Bacteria 1901
239 Ga0501043_0104290 3300049579 Bacteria 2228
240 Ga0501073_0039922 3300049589 Bacteria 3324
241 Ga0501073_0291010 3300049589 Bacteria 1127
242 Ga0501035_0315408 3300049822 Bacteria 1315
243 Ga0501044_0082687 3300049823 Bacteria 3248
244 Ga0501044_0447916 3300049823 Bacteria 1198
245 nmdc:mga03683_17055_c1 3300050489 Bacteria 2742
246 nmdc:mga03n38_195_c1 3300050490 Bacteria 13831
247 nmdc:mga03n38_348721_c1 3300050490 Bacteria 805
248 nmdc:mga00v17_24_c1 3300050491 Bacteria 102283
249 nmdc:mga0yw44_137052_c1 3300050492 Bacteria 1588
250 nmdc:mga0yw44_672_c1 3300050492 Bacteria 12477
251 nmdc:mga06z11_567672_c1 3300050494 Bacteria 689
252 nmdc:mga0sz30_118039_c1 3300050516 Bacteria 1165
253 nmdc:mga0sz30_188916_c1 3300050516 Bacteria 914
254 nmdc:mga0sz30_278_c1 3300050516 Bacteria 19605
255 Ga0500578_0052986 3300053086 Bacteria 2598
256 Ga0500651_0024635 3300053093 Bacteria 3774
257 Ga0500557_000357 3300053105 Bacteria 5962
258 Ga0500569_002667 3300053109 Bacteria 3554
259 Ga0500658_0000143 3300053134 Bacteria 34030
260 Ga0500658_0038169 3300053134 Bacteria 1913
261 Ga0500561_0000215 3300053137 Bacteria 10503
262 Ga0500568_0000280 3300053139 Bacteria 42298
263 Ga0500568_0000410 3300053139 Bacteria 32805
264 Ga0500604_0049061 3300053151 Bacteria 1297
265 Ga0500616_0001884 3300053153 Bacteria 18878
266 Ga0500616_0005678 3300053153 Bacteria 8409
267 Ga0500624_000129 3300053157 Bacteria 33362
268 Ga0500627_0204996 3300053158 Bacteria 883
269 Ga0500633_0000432 3300053160 Bacteria 6576
270 Ga0500638_000485 3300053162 Bacteria 9739
271 2509375499 2509276019 Bacteria 6802256
272 2509392441 2509276021 Bacteria 7634384
273 2510133539 2510065019 Bacteria 6903379
274 2510894920 2510461076 Bacteria 8618824
275 2511185356 2510917028 Bacteria 6185411
276 2513573377 2513237084 Bacteria 7231967
277 2513577492 2513237085 Bacteria 7695351
278 2513629860 2513237093 Bacteria 7545552
279 2513708494 2513237103 Bacteria 7647401
280 2513865399 2513237138 Bacteria 7368160
281 2514022044 2513237162 Bacteria 7468464
282 2515112520 2515075009 Bacteria 7288508
283 2515632859 2515154113 Bacteria 7807172
284 2515640004 2515154114 Bacteria 7848616
285 2515655800 2515154116 Bacteria 7552979
286 2515740250 2515154134 Bacteria 7220242
287 2517036245 2516653077 Bacteria 7555578
288 2517076608 2516653085 Bacteria 7346596
289 2517095382 2517093000 Bacteria 7412387
290 2517406982 2517287029 Bacteria 6905599
291 2520378593 2519899620 Bacteria 6499161
292 2585203248 2582581294 Bacteria 6626667
293 2585226618 2582581298 Bacteria 7315509
294 2585228336 2582581299 Bacteria 6518058
295 2585282733 2582581308 Bacteria 7413247
296 2585325160 2582581315 Bacteria 7318924
297 2585399062 2582581867 Bacteria 7184437
298 2585527001 2585427526 Bacteria 7258840
299 2585549692 2585427529 Bacteria 7395659
300 2585818817 2585427590 Bacteria 6824633
301 2585835679 2585427593 Bacteria 7141551
302 2599723356 2599185236 Bacteria 6875203
303 2616292276 2615840624 Bacteria 6557588
304 2616556510 2615840698 Bacteria 7319877
305 2643803937 2643221557 Bacteria 7184309
306 2644067152 2643221610 Bacteria 7480339
307 2644132339 2643221623 Bacteria 5239945
308 2644377035 2643221668 Bacteria 7306521
309 2644418244 2643221675 Bacteria 7473456
310 2644451666 2643221680 Bacteria 7473610
311 2644672972 2643221723 Bacteria 7095460
312 2644687115 2643221726 Bacteria 7455827
313 2719181454 2718217882 Bacteria 6556348
314 2719732118 2718218009 Bacteria 6478651
315 2721147480 2718218363 Bacteria 6524337
316 2721158995 2718218365 Bacteria 6274507
317 2721164381 2718218366 Bacteria 6425255
318 2722840551 2721755514 Bacteria 6424414
319 2724044874 2721755810 Bacteria 6479005
320 2725950481 2724679232 Bacteria 7646494
321 2730164623 2728369365 Bacteria 6555560
322 2730298627 2728369397 Bacteria 6274511
323 2739032386 2738541333 Bacteria 7106503
324 2766066916 2765235942 Bacteria 7445910
325 2792619274 2791355091 Bacteria 6135441
326 2792627047 2791355092 Bacteria 6248105
327 2793294873 2791355256 Bacteria 6798008
328 2793322977 2791355260 Bacteria 6598818
329 2793331852 2791355261 Bacteria 6661293
330 2793335861 2791355262 Bacteria 6774204
331 2793341713 2791355263 Bacteria 6872478
332 2793349935 2791355264 Bacteria 6429314
333 2793360741 2791355266 Bacteria 7116587
334 2793366807 2791355267 Bacteria 7222458
335 2806043361 2802429633 Bacteria 7341974
336 2806050705 2802429634 Bacteria 7083200
337 2806057522 2802429635 Bacteria 7650140
338 2806064904 2802429636 Bacteria 7597525
339 2806072170 2802429637 Bacteria 7067217
340 2819613683 2818991448 Bacteria 6772224
341 2838044446 2838042994 Bacteria 6046894
342 2838080779 2838074704 Bacteria 6785777
343 2838682024 2838680041 Bacteria 6545511
344 2838691994 2838686498 Bacteria 7807632
345 2838696596 2838694306 Bacteria 6853137
346 2838706946 2838701080 Bacteria 6669771
347 2838710165 2838707686 Bacteria 6619912
348 2838732860 2838729681 Bacteria 7400765
349 2838737667 2838736955 Bacteria 5760694
350 2838745738 2838742623 Bacteria 7396178
351 2841841964 2841840854 Bacteria 5761912
352 2841855804 2841851746 Bacteria 7532261
353 2842078338 2842077413 Bacteria 6508645
354 2842114186 2842110456 Bacteria 7656360
355 2842119153 2842118031 Bacteria 7033875
356 2842141743 2842140634 Bacteria 5759631
357 2842151474 2842146304 Bacteria 5957337
358 2842157204 2842156927 Bacteria 6894975
359 2842167864 2842163707 Bacteria 6916235
360 2842181212 2842180545 Bacteria 6888678
361 2842194327 2842192696 Bacteria 6147454
362 2842205842 2842205361 Bacteria 6340321
363 2842217476 2842217011 Bacteria 7497767
364 2842230737 2842229732 Bacteria 7475766
365 2842239577 2842237096 Bacteria 6620661
366 2842245163 2842243621 Bacteria 7421798
367 2842256612 2842250916 Bacteria 6579627
368 2842258976 2842257432 Bacteria 7401195
369 2842276354 2842271015 Bacteria 7807131
370 2842279299 2842278818 Bacteria 6340002
371 2842285950 2842285085 Bacteria 6011953
372 2842292000 2842291075 Bacteria 7076806
373 2842304504 2842304105 Bacteria 7023636
374 2842317730 2842317721 Bacteria 6793725
375 2842372591 2842370503 Bacteria 7038661
376 2842378396 2842377471 Bacteria 7140707
377 2842385663 2842384541 Bacteria 7057858
378 2842398871 2842395702 Bacteria 6780583
379 2842403309 2842402390 Bacteria 6681310
380 2842409318 2842409023 Bacteria 6687331
381 2842415971 2842415677 Bacteria 6596907
382 2842490212 2842489311 Bacteria 6620893
383 2844458951 2844454524 Bacteria 7952546
384 2850079434 2850079185 Bacteria 6848280
385 2854900904 2854896431 Bacteria 5869725
386 2854918929 2854916844 Bacteria 5725939
387 2856318630 2856314179 Bacteria 6477897
388 2857519923 2857516855 Bacteria 7787325
389 2878037967 2878035449 Bacteria 6555736
390 2878764192 2878760144 Bacteria 6823465
391 2878771250 2878767105 Bacteria 6898628
392 2881153427 2881147464 Bacteria 7779814
393 2885311402 2885305155 Bacteria 7348390
394 2885333042 2885326080 Bacteria 7134805
395 2885334468 2885334103 Bacteria 7216818
396 2899846081 2899845264 Bacteria 5672268
397 2903544875 2903540706 Bacteria 7062119
398 2904659996 2904659560 Bacteria 6685615
399 2906418668 2906414383 Bacteria 6580790
400 2919106121 2919100787 Bacteria 7710546
401 2919172530 2919171160 Bacteria 6499771
402 2920825002 2920822456 Bacteria 6897201
403 2920827267 2920822456 Bacteria 6897201
404 2926765377 2926760298 Bacteria 5505990
405 2933571777 2933570622 Bacteria 7023390
406 2933590282 2933586486 Bacteria 7667493
407 2935897549 2935894831 Bacteria 6620579
408 2935905474 2935901341 Bacteria 7341747
409 2936376518 2936375103 Bacteria 6652732
410 2936387293 2936381700 Bacteria 7006523
411 2937998719 2937994558 Bacteria 7036190
412 2958169195 2958165035 Bacteria 6906348
413 2961115320 2961114664 Bacteria 6680456
414 2961167656 2961163497 Bacteria 6901077
415 2965022476 2965018300 Bacteria 6883036
416 2968111052 2968110612 Bacteria 6814636
417 2968176060 2968171901 Bacteria 6894245
418 2970559037 2970554993 Bacteria 6814252
419 2977868892 2977864932 Bacteria 7534097
420 2987663664 2987659509 Bacteria 6966464
421 2996310827 2996310559 Bacteria 6357320
422 2996898462 2996893221 Bacteria 5823108
423 3003933259 3003930520 Bacteria 5667563
424 3004192723 3004188549 Bacteria 6952365
425 3005447811 3005445848 Bacteria 6906074
426 8005312376 8005307578 Bacteria 7395396
427 8005379432 8005376324 Bacteria 6590079
428 8005463193 8005460587 Bacteria 7157962
429 8005557486 8005556819 Bacteria 6908598
430 8005568663 8005563573 Bacteria 7153261
431 8005574442 8005570704 Bacteria 6957481
432 8005646139 8005645114 Bacteria 6950293
433 8005694768 8005688590 Bacteria 6610080
434 8005699819 8005695170 Bacteria 6912330
435 8018130104 8018127388 Bacteria 7351159
436 8018166573 8018163183 Bacteria 7277977
437 8023685174 8023680758 Bacteria 7729763
438 8024483319 8024479707 Bacteria 6954785
439 8024501454 8024501048 Bacteria 6427847
440 8056375427 8056375014 Bacteria 7006639
441 8056388031 8056382006 Bacteria 6408074
442 8057874825 8057874678 Bacteria 7494653
443 Ga0495632_0279360
444 JGI25158J39367_1000149
445 JGI25158J39367_1004670
446 JGI25150J39212_1002376
447 JGI25159J45721_1000013
448 JGI25159J45721_1000183
449 JGI25151J46595_10007410
450 JGI25153J46596_10028758
451 rootH1_10023105
452 rootH2_10023790
453 rootH2_10101047
454 rootL2_10003492
455 rootL2_10244177
456 rootH1_10030430
457 JGI25160J50197_1000013
458 JGI25160J50197_1004330
459 JGI25160J50197_1032985
460 JGI25161J50226_1000295
461 JGI25161J50226_1000579
462 Ga0055526_1002352
463 Ga0055526_1033430
464 Ga0055524_1000470
465 Ga0055524_1018489
466 Ga0055524_1031485
467 Ga0055524_1032628
468 Ga0055536_1000412
469 Ga0055528_1000240
470 Ga0055528_1023402
471 Ga0055528_1029836
472 Ga0055530_10005269
473 Ga0055530_10041106
474 Ga0055530_10050477
475 Ga0055540_1000281
476 Ga0055540_1015447
477 Ga0055531_10022973
478 Ga0055531_10025740
479 Ga0055531_10053064
480 Ga0055543_1000066
481 Ga0055543_1000606
482 Ga0065165_1000021
483 Ga0065165_1008827
484 Ga0070668_100313297
485 Ga0070669_100975276
486 Ga0070671_100033364
487 Ga0070665_100118796
488 Ga0075365_10002000
489 Ga0075365_10011296
490 Ga0075368_10216864
491 Ga0075363_100000571
492 Ga0075363_100014584
493 Ga0075363_100054165
494 Ga0075364_10002204
495 Ga0075362_10020082
496 Ga0075362_10283357
497 Ga0075367_10000754
498 Ga0075369_10000514
499 Ga0075369_10008893
500 Ga0105251_10060193
501 Ga0105248_10044345
502 Ga0105249_10236230
503 Ga0123340_1036944
504 Ga0123341_1068026
505 Ga0123342_1010026
506 Ga0105239_10471978
507 Ga0171463_1003
508 Ga0157375_10280885
509 Ga0157375_11075002
510 Ga0183365_12015
511 Ga0183363_1039
512 Ga0163161_10467281
513 Ga0214542_1008550
514 Ga0214542_1011454
515 Ga0214543_1000016
516 Ga0214543_1000049
517 Ga0209436_100699
518 Ga0207425_1001234
519 Ga0207425_1016686
520 Ga0207425_1047417
521 Ga0209759_1010928
522 Ga0209129_1002720
523 Ga0209129_1005686
524 Ga0209129_1014249
525 Ga0209233_1000455
526 Ga0209673_1000013
527 Ga0209673_1001356
528 Ga0209673_1003447
529 Ga0209673_1003671
530 Ga0209673_1037912
531 Ga0209130_1000039
532 Ga0209676_1001587
533 Ga0209025_1000301
534 Ga0209025_1006552
535 Ga0209564_1000081
536 Ga0209564_1000525
537 Ga0209564_1011475
538 Ga0209564_1017604
539 Ga0209564_1038000
540 Ga0209758_1000699
541 Ga0209758_1001356
542 Ga0209758_1016282
543 Ga0209050_1003596
544 Ga0209050_1005216
545 Ga0209050_1005767
546 Ga0209050_1059987
547 Ga0209256_1000524
548 Ga0209256_1000769
549 Ga0209256_1001317
550 Ga0209256_1010399
551 Ga0207426_1000099
552 Ga0207426_1000656
553 Ga0209051_1000119
554 Ga0209051_1002050
555 Ga0209051_1003049
556 Ga0209051_1014447
557 Ga0209257_1002594
558 Ga0209257_1003381
559 Ga0209257_1003427
560 Ga0207695_10586129
561 Ga0207681_10715636
562 Ga0207644_10024887
563 Ga0207711_10113012
564 Ga0207668_10109111
565 Ga0209371_1003589
566 Ga0209371_1016362
567 Ga0209813_10138326
568 Ga0268266_10091298
569 Ga0268256_1002532
570 Ga0268256_1009138
571 Ga0268256_1014570
572 Ga0307513_10076722
573 Ga0395900_1633733
574 Ga0395905_0001377
575 Ga0395905_0071103
576 Ga0439466_0080686
577 Ga0439465_0069934
578 Ga0451787_139972
579 Ga0451789_0304040
580 Ga0451791_1784392
581 Ga0451795_0996067
582 Ga0451798_0585948
583 Ga0451807_0541197
584 Ga0451833_1247346
585 Ga0451835_0192922
586 Ga0451837_0732906
587 Ga0451839_0815740
588 Ga0451839_1006201
589 Ga0451841_0553159
590 Ga0451845_0076104
591 Ga0451847_0929205
592 Ga0451849_0006899
593 Ga0451851_0676020
594 Ga0451843_1598276
595 Ga0451855_1500994
596 Ga0451853_1803116
597 Ga0495605_0074228
598 Ga0495585_0038106
599 Ga0495585_0065575
600 Ga0495607_0047873
601 Ga0495583_0002734
602 Ga0495583_0030876
603 Ga0495606_0011182
604 Ga0495606_0035248
605 Ga0495616_0039571
606 Ga0495616_0106208
607 Ga0495620_0010226
608 Ga0495620_0099535
609 Ga0495620_0118902
610 Ga0495631_0009287
611 Ga0495632_0005695
612 Ga0495632_0031483
613 Ga0495643_0012767
614 Ga0495648_0026307
615 Ga0495654_0121185
616 Ga0495609_0233830
617 Ga0495597_0170966
618 Ga0495622_0002674
619 Ga0495633_0013899
620 Ga0495633_0384058
621 Ga0495656_0231760
622 Ga0495668_0030067
623 Ga0495625_0006129
624 Ga0495625_0054591
625 Ga0495625_0056535
626 Ga0495661_0070352
627 Ga0495588_0059895
628 Ga0495670_0093718
629 Ga0495670_0112222
630 Ga0495671_0067727
631 Ga0495636_0044780
632 Ga0495636_0291617
633 Ga0495672_0010083
634 Ga0495687_237722
635 Ga0495615_0002445
636 Ga0496101_0093114
637 Ga0496101_0576632
638 Ga0496102_0174554
639 Ga0496104_0009774
640 Ga0496105_0006868
641 Ga0496106_0000038
642 Ga0496106_0035047
643 Ga0496107_0056309
644 Ga0496108_0270692
645 Ga0496109_0084363
646 Ga0496110_0009481
647 Ga0496111_0005778
648 Ga0496111_0032838
649 Ga0496113_0010434
650 Ga0496116_0047990
651 Ga0496117_0000033
652 Ga0496117_0162535
653 Ga0496118_0000748
654 Ga0496118_0084962
655 Ga0496118_0316582
656 Ga0496119_0001142
657 Ga0496119_0001309
658 Ga0496119_0008896
659 Ga0496119_0279792
660 Ga0496120_0000509
661 Ga0496120_0005689
662 Ga0496121_0065720
663 Ga0496122_0000365
664 Ga0496122_0051411
665 Ga0496122_0092193
666 Ga0496122_0093766
667 Ga0496123_0000298
668 Ga0496123_0018193
669 Ga0496123_0036515
670 Ga0496123_0040851
671 Ga0496124_0001649
672 Ga0496124_0126730
673 Ga0496124_0258779
674 Ga0496125_0001442
675 Ga0496125_0019496
676 Ga0496125_0088096
677 Ga0496126_0008742
678 Ga0496126_0121589
679 Ga0501034_0706998
680 Ga0501037_0118888
681 Ga0501043_0104290
682 Ga0501073_0039922
683 Ga0501073_0291010
684 Ga0501035_0315408
685 Ga0501044_0082687
686 Ga0501044_0447916
687 nmdc:mga03683_17055_c1
688 nmdc:mga03n38_195_c1
689 nmdc:mga03n38_348721_c1
690 nmdc:mga00v17_24_c1
691 nmdc:mga0yw44_137052_c1
692 nmdc:mga0yw44_672_c1
693 nmdc:mga06z11_567672_c1
694 nmdc:mga0sz30_118039_c1
695 nmdc:mga0sz30_188916_c1
696 nmdc:mga0sz30_278_c1
697 Ga0500578_0052986
698 Ga0500651_0024635
699 Ga0500557_000357
700 Ga0500569_002667
701 Ga0500658_0000143
702 Ga0500658_0038169
703 Ga0500561_0000215
704 Ga0500568_0000280
705 Ga0500568_0000410
706 Ga0500604_0049061
707 Ga0500616_0001884
708 Ga0500616_0005678
709 Ga0500624_000129
710 Ga0500627_0204996
711 Ga0500633_0000432
712 Ga0500638_000485
713 2509375499
714 2509392441
715 2510133539
716 2510894920
717 2511185356
718 2513573377
719 2513577492
720 2513629860
721 2513708494
722 2513865399
723 2514022044
724 2515112520
725 2515632859
726 2515640004
727 2515655800
728 2515740250
729 2517036245
730 2517076608
731 2517095382
732 2517406982
733 2520378593
734 2585203248
735 2585226618
736 2585228336
737 2585282733
738 2585325160
739 2585399062
740 2585527001
741 2585549692
742 2585818817
743 2585835679
744 2599723356
745 2616292276
746 2616556510
747 2643803937
748 2644067152
749 2644132339
750 2644377035
751 2644418244
752 2644451666
753 2644672972
754 2644687115
755 2719181454
756 2719732118
757 2721147480
758 2721158995
759 2721164381
760 2722840551
761 2724044874
762 2725950481
763 2730164623
764 2730298627
765 2739032386
766 2766066916
767 2792619274
768 2792627047
769 2793294873
770 2793322977
771 2793331852
772 2793335861
773 2793341713
774 2793349935
775 2793360741
776 2793366807
777 2806043361
778 2806050705
779 2806057522
780 2806064904
781 2806072170
782 2819613683
783 2838044446
784 2838080779
785 2838682024
786 2838691994
787 2838696596
788 2838706946
789 2838710165
790 2838732860
791 2838737667
792 2838745738
793 2841841964
794 2841855804
795 2842078338
796 2842114186
797 2842119153
798 2842141743
799 2842151474
800 2842157204
801 2842167864
802 2842181212
803 2842194327
804 2842205842
805 2842217476
806 2842230737
807 2842239577
808 2842245163
809 2842256612
810 2842258976
811 2842276354
812 2842279299
813 2842285950
814 2842292000
815 2842304504
816 2842317730
817 2842372591
818 2842378396
819 2842385663
820 2842398871
821 2842403309
822 2842409318
823 2842415971
824 2842490212
825 2844458951
826 2850079434
827 2854900904
828 2854918929
829 2856318630
830 2857519923
831 2878037967
832 2878764192
833 2878771250
834 2881153427
835 2885311402
836 2885333042
837 2885334468
838 2899846081
839 2903544875
840 2904659996
841 2906418668
842 2919106121
843 2919172530
844 2920825002
845 2920827267
846 2926765377
847 2933571777
848 2933590282
849 2935897549
850 2935905474
851 2936376518
852 2936387293
853 2937998719
854 2958169195
855 2961115320
856 2961167656
857 2965022476
858 2968111052
859 2968176060
860 2970559037
861 2977868892
862 2987663664
863 2996310827
864 2996898462
865 3003933259
866 3004192723
867 3005447811
868 8005312376
869 8005379432
870 8005463193
871 8005557486
872 8005568663
873 8005574442
874 8005646139
875 8005694768
876 8005699819
877 8018130104
878 8018166573
879 8023685174
880 8024483319
881 8024501454
882 8056375427
883 8056388031
884 8057874825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20001

DUF6428

Family of unknown function (DUF6428)

70

207

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pki-assembly1.cif.gz_A zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c56s c230s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.69 48 69
6pkh-assembly1.cif.gz_A-2 zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain auto-inhibited by pro-peptide 0.6304 35 69
8ar8-assembly1.cif.gz_E bovine glutamate dehydrogenase in complex with adp at 2.4 a resolution 0.6278 46 69
1nfh-assembly1.cif.gz_B-2 structure of a sir2 substrate, alba, reveals a mechanism for deactylation-induced enhancement of dna-binding 0.6246 42 69
6dhd-assembly1.cif.gz_A bovine glutamate dehydrogenase complexed with nadh, gtp, glutamate 0.621 46 69
ID Description Score Start End Superfamily
af_Q54SQ4_460_577_3.90.132.10 Alpha Beta;Alpha-Beta Complex;Leishmanolysin; domain 2;Leishmanolysin , domain 2 0.651 48 69 3.90.132.10
1aupA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.6235 45 69 3.40.50.10860
1b26A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.5961 48 69 3.40.50.10860
af_P91110_1_150_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.5915 117 144 3.90.70.10
af_A0A0P0XKD7_7_99_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5745 48 78 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2V5LK54-F1-model_v4 Uncharacterized protein 0.8613 14 132
AF-A0A1W2G9T5-F1-model_v4 Uncharacterized protein 0.8514 14 145
AF-A0A563U1L4-F1-model_v4 Uncharacterized protein 0.8494 13 145
AF-R9A167-F1-model_v4 Uncharacterized protein 0.8442 13 147
AF-A0A2V5LK54-F1-model_v4 Uncharacterized protein 0.8423 14 132

Map