F444954

General Info

Members Datasets Scaffolds Average Seq Length
442 208 437 211

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0020533|Ga0495636_0020533_336_956
Length 206
Sequence MPVYSLPELTYDYSALEPHISGQILELHHGKHHAAYVSNANKVLDQLDEARHKMDFTRLAALERALAFNLSGHILHSILWQNMMPKGGGTPQPGQFADALQKDFGGFDLFRKQITEVASTIMGSGWAALVWEPIGKKLLITQIYDHQSNLAQGGVPLLVMDAWEHAYYLQYQNRKTEFFEASWMLWNWRDIEARYVAASGLEVKAA

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0.68
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0.23
Rhizoplane 2.94
Rhizosphere 95.93
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_11664582 3300004803 Bacteria 1134
2 Ga0065715_10501116 3300005293 Bacteria 779
3 Ga0065707_10182307 3300005295 Bacteria 1411
4 Ga0070690_100001832 3300005330 Bacteria 11268
5 Ga0070690_100081894 3300005330 Bacteria 2113
6 Ga0070670_100061432 3300005331 Bacteria 3225
7 Ga0070670_100228023 3300005331 Bacteria 1621
8 Ga0070677_10078864 3300005333 Bacteria 1404
9 Ga0070677_10136009 3300005333 Bacteria 1128
10 Ga0068869_100022302 3300005334 Bacteria 4361
11 Ga0068869_100069556 3300005334 Bacteria 2603
12 Ga0070666_10001475 3300005335 Bacteria 14276
13 Ga0070666_10124130 3300005335 Bacteria 1791
14 Ga0068868_100017191 3300005338 Bacteria 5383
15 Ga0070689_100179016 3300005340 Bacteria 1721
16 Ga0070689_100188304 3300005340 Bacteria 1679
17 Ga0070689_100195358 3300005340 Bacteria 1649
18 Ga0070691_10152159 3300005341 Bacteria 1187
19 Ga0070691_10250980 3300005341 Bacteria 949
20 Ga0070687_100171050 3300005343 Bacteria 1293
21 Ga0070692_10003555 3300005345 Bacteria 6343
22 Ga0070692_10004378 3300005345 Bacteria 5889
23 Ga0070668_100061841 3300005347 Bacteria 2901
24 Ga0070669_100148775 3300005353 Bacteria 1811
25 Ga0070669_100190819 3300005353 Bacteria 1607
26 Ga0070669_100197219 3300005353 Bacteria 1582
27 Ga0070675_100025234 3300005354 Bacteria 4765
28 Ga0070675_100076042 3300005354 Bacteria 2792
29 Ga0070675_100199904 3300005354 Bacteria 1734
30 Ga0070675_100408172 3300005354 Bacteria 1213
31 Ga0070671_100019169 3300005355 Bacteria 5565
32 Ga0070671_100096351 3300005355 Bacteria 2481
33 Ga0070671_100258479 3300005355 Bacteria 1480
34 Ga0070674_100094497 3300005356 Bacteria 2165
35 Ga0070674_100107856 3300005356 Bacteria 2040
36 Ga0070673_100041857 3300005364 Bacteria 3527
37 Ga0070673_100095083 3300005364 Bacteria 2444
38 Ga0070673_100125400 3300005364 Bacteria 2148
39 Ga0070673_100439665 3300005364 Bacteria 1172
40 Ga0070688_100319246 3300005365 Bacteria 1128
41 Ga0070688_100546984 3300005365 Unclassified 880
42 Ga0070667_100000383 3300005367 Bacteria 48188
43 Ga0070667_100088472 3300005367 Bacteria 2659
44 Ga0070667_100188150 3300005367 Bacteria 1828
45 Ga0070703_10100016 3300005406 Bacteria 1021
46 Ga0070703_10172268 3300005406 Bacteria 830
47 Ga0070713_100516810 3300005436 Bacteria 1128
48 Ga0070701_10034224 3300005438 Bacteria 2544
49 Ga0070711_100122146 3300005439 Bacteria 1928
50 Ga0070705_100034004 3300005440 Bacteria 2846
51 Ga0070705_100091444 3300005440 Bacteria 1897
52 Ga0070705_100216623 3300005440 Bacteria 1323
53 Ga0070700_100021876 3300005441 Bacteria 3722
54 Ga0070700_100163277 3300005441 Bacteria 1535
55 Ga0070700_100182666 3300005441 Bacteria 1461
56 Ga0070694_100000350 3300005444 Bacteria 24736
57 Ga0070694_100000654 3300005444 Bacteria 19174
58 Ga0070694_100210220 3300005444 Bacteria 1455
59 Ga0070694_100319214 3300005444 Unclassified 1195
60 Ga0070708_100009661 3300005445 Bacteria 7782
61 Ga0070708_100015978 3300005445 Bacteria 6216
62 Ga0070663_100146906 3300005455 Bacteria 1804
63 Ga0070663_100197715 3300005455 Bacteria 1567
64 Ga0070678_100603821 3300005456 Bacteria 980
65 Ga0070678_100831142 3300005456 Bacteria 840
66 Ga0070662_100145708 3300005457 Bacteria 1839
67 Ga0070662_100230921 3300005457 Bacteria 1480
68 Ga0070662_100537216 3300005457 Bacteria 978
69 Ga0070681_10165688 3300005458 Bacteria 2133
70 Ga0068867_100004326 3300005459 Bacteria 9997
71 Ga0068867_100083664 3300005459 Bacteria 2409
72 Ga0068867_100223367 3300005459 Bacteria 1519
73 Ga0070706_100000806 3300005467 Bacteria 34750
74 Ga0070706_100019704 3300005467 Bacteria 6221
75 Ga0070706_100072722 3300005467 Bacteria 3181
76 Ga0070706_100172739 3300005467 Bacteria 2018
77 Ga0070706_100557568 3300005467 Bacteria 1066
78 Ga0070706_100616309 3300005467 Bacteria 1008
79 Ga0070706_100791365 3300005467 Bacteria 878
80 Ga0070707_100004454 3300005468 Bacteria 13115
81 Ga0070707_100019795 3300005468 Bacteria 6344
82 Ga0070707_100167699 3300005468 Bacteria 2140
83 Ga0070707_100928247 3300005468 Bacteria 835
84 Ga0070698_100000029 3300005471 Bacteria 96110
85 Ga0070698_100030565 3300005471 Bacteria 5584
86 Ga0070698_100068736 3300005471 Bacteria 3559
87 Ga0070698_100615551 3300005471 Bacteria 1027
88 Ga0070699_100031716 3300005518 Bacteria 4562
89 Ga0070699_100131624 3300005518 Bacteria 2205
90 Ga0070699_100166664 3300005518 Bacteria 1951
91 Ga0070699_100801318 3300005518 Bacteria 862
92 Ga0070679_100770413 3300005530 Bacteria 905
93 Ga0070684_100134672 3300005535 Bacteria 2231
94 Ga0070697_100001290 3300005536 Bacteria 18875
95 Ga0070697_100043209 3300005536 Bacteria 3648
96 Ga0070697_100269264 3300005536 Bacteria 1460
97 Ga0070697_100314553 3300005536 Bacteria 1348
98 Ga0068853_101014275 3300005539 Bacteria 799
99 Ga0070672_100000609 3300005543 Bacteria 21040
100 Ga0070672_100016128 3300005543 Bacteria 5344
101 Ga0070672_100028483 3300005543 Bacteria 4179
102 Ga0070672_100310559 3300005543 Bacteria 1338
103 Ga0070672_100639895 3300005543 Bacteria 928
104 Ga0070686_100032095 3300005544 Bacteria 3217
105 Ga0070686_100056954 3300005544 Bacteria 2509
106 Ga0070695_100005536 3300005545 Bacteria 7437
107 Ga0070695_100808310 3300005545 Bacteria 752
108 Ga0070696_100138253 3300005546 Bacteria 1778
109 Ga0070693_100024660 3300005547 Bacteria 3228
110 Ga0070665_100011030 3300005548 Bacteria 9132
111 Ga0070665_100262294 3300005548 Bacteria 1729
112 Ga0070704_100000399 3300005549 Bacteria 19978
113 Ga0070704_100002191 3300005549 Bacteria 10881
114 Ga0070704_100011143 3300005549 Bacteria 5497
115 Ga0070704_100012166 3300005549 Bacteria 5310
116 Ga0070704_100783184 3300005549 Bacteria 851
117 Ga0070664_100023120 3300005564 Bacteria 5131
118 Ga0070664_100050441 3300005564 Bacteria 3522
119 Ga0068857_100982810 3300005577 Bacteria 812
120 Ga0068856_100013892 3300005614 Bacteria 7788
121 Ga0070702_100011696 3300005615 Bacteria 4373
122 Ga0070702_100366468 3300005615 Bacteria 1020
123 Ga0068859_100000032 3300005617 Bacteria 174185
124 Ga0068859_100023699 3300005617 Bacteria 6160
125 Ga0068859_100026181 3300005617 Bacteria 5850
126 Ga0068864_100039690 3300005618 Bacteria 4023
127 Ga0068864_100042568 3300005618 Bacteria 3887
128 Ga0068864_100097665 3300005618 Bacteria 2601
129 Ga0068864_100191002 3300005618 Bacteria 1877
130 Ga0068866_10022892 3300005718 Bacteria 2898
131 Ga0068851_10209358 3300005834 Bacteria 1091
132 Ga0068870_10130495 3300005840 Bacteria 1459
133 Ga0068863_100022796 3300005841 Bacteria 5981
134 Ga0068863_100043589 3300005841 Bacteria 4258
135 Ga0068863_100053239 3300005841 Bacteria 3835
136 Ga0068863_100138746 3300005841 Bacteria 2323
137 Ga0068863_100216740 3300005841 Bacteria 1843
138 Ga0068858_100031746 3300005842 Bacteria 4908
139 Ga0068858_100298420 3300005842 Bacteria 1537
140 Ga0068858_101197277 3300005842 Bacteria 747
141 Ga0068860_100077694 3300005843 Bacteria 3157
142 Ga0068860_100317171 3300005843 Bacteria 1529
143 Ga0068860_100324952 3300005843 Bacteria 1510
144 Ga0068860_100682697 3300005843 Bacteria 1036
145 Ga0068862_100003064 3300005844 Bacteria 14566
146 Ga0068862_100105660 3300005844 Bacteria 2468
147 Ga0068862_100261330 3300005844 Bacteria 1580
148 Ga0070712_100025126 3300006175 Bacteria 3956
149 Ga0075362_10229971 3300006177 Bacteria 908
150 Ga0097621_100004416 3300006237 Bacteria 9788
151 Ga0097621_100089712 3300006237 Bacteria 2571
152 Ga0068871_100027133 3300006358 Bacteria 4476
153 Ga0068871_100582301 3300006358 Bacteria 1016
154 Ga0068871_100637087 3300006358 Bacteria 972
155 Ga0068871_100925117 3300006358 Bacteria 809
156 Ga0075428_100117762 3300006844 Bacteria 2894
157 Ga0075428_100137655 3300006844 Bacteria 2655
158 Ga0075428_100172292 3300006844 Bacteria 2345
159 Ga0075428_100174794 3300006844 Bacteria 2326
160 Ga0075428_100405870 3300006844 Bacteria 1460
161 Ga0075428_100454952 3300006844 Bacteria 1371
162 Ga0075428_100669153 3300006844 Bacteria 1107
163 Ga0075430_100161973 3300006846 Bacteria 1862
164 Ga0075430_100286286 3300006846 Bacteria 1363
165 Ga0075431_100057128 3300006847 Bacteria 4025
166 Ga0075431_100068240 3300006847 Bacteria 3669
167 Ga0075431_100459367 3300006847 Bacteria 1268
168 Ga0075431_100465933 3300006847 Bacteria 1258
169 Ga0075434_100045940 3300006871 Bacteria 4334
170 Ga0075434_100109136 3300006871 Bacteria 2777
171 Ga0075434_100152405 3300006871 Bacteria 2332
172 Ga0075434_100286487 3300006871 Bacteria 1667
173 Ga0075434_100434833 3300006871 Bacteria 1333
174 Ga0075429_100007762 3300006880 Bacteria 9315
175 Ga0075429_100071836 3300006880 Bacteria 3014
176 Ga0068865_100126313 3300006881 Bacteria 1910
177 Ga0068865_100160750 3300006881 Bacteria 1713
178 Ga0068865_100185391 3300006881 Bacteria 1605
179 Ga0068865_100314577 3300006881 Bacteria 1257
180 Ga0068865_100368766 3300006881 Bacteria 1168
181 Ga0075436_100513794 3300006914 Bacteria 877
182 Ga0075436_100620086 3300006914 Bacteria 798
183 Ga0097620_100000032 3300006931 Bacteria 174185
184 Ga0097620_100023702 3300006931 Bacteria 6160
185 Ga0097620_100026181 3300006931 Bacteria 5850
186 Ga0075435_100000736 3300007076 Bacteria 20295
187 Ga0075435_100785399 3300007076 Bacteria 829
188 Ga0111539_10001988 3300009094 Bacteria 27260
189 Ga0111539_10036622 3300009094 Bacteria 5930
190 Ga0111539_11245092 3300009094 Bacteria 864
191 Ga0111539_11853319 3300009094 Bacteria 699
192 Ga0105247_10145863 3300009101 Bacteria 1555
193 Ga0114129_10001728 3300009147 Bacteria 29786
194 Ga0114129_10005327 3300009147 Bacteria 18158
195 Ga0114129_10021776 3300009147 Bacteria 9098
196 Ga0114129_10055416 3300009147 Bacteria 5556
197 Ga0114129_10056322 3300009147 Bacteria 5507
198 Ga0114129_10080326 3300009147 Bacteria 4533
199 Ga0114129_10231243 3300009147 Bacteria 2490
200 Ga0114129_10252062 3300009147 Bacteria 2369
201 Ga0105241_10049640 3300009174 Bacteria 3196
202 Ga0105248_10001906 3300009177 Bacteria 23137
203 Ga0105248_10024048 3300009177 Bacteria 6771
204 Ga0105248_10042119 3300009177 Bacteria 5121
205 Ga0105249_10031296 3300009553 Bacteria 4812
206 Ga0105249_10475965 3300009553 Unclassified 1291
207 Ga0157373_10321887 3300013100 Bacteria 1100
208 Ga0157378_10002596 3300013297 Bacteria 16085
209 Ga0157378_10352941 3300013297 Bacteria 1437
210 Ga0163162_10118807 3300013306 Bacteria 2746
211 Ga0163162_10150017 3300013306 Bacteria 2448
212 Ga0163162_10256559 3300013306 Bacteria 1880
213 Ga0157375_10002833 3300013308 Bacteria 15013
214 Ga0157375_10051493 3300013308 Bacteria 4044
215 Ga0157375_10073207 3300013308 Bacteria 3445
216 Ga0163163_10000314 3300014325 Bacteria 47556
217 Ga0163163_10010143 3300014325 Bacteria 8451
218 Ga0163163_10018387 3300014325 Bacteria 6541
219 Ga0163163_10051141 3300014325 Bacteria 4074
220 Ga0163163_10327550 3300014325 Bacteria 1586
221 Ga0163163_10403621 3300014325 Bacteria 1425
222 Ga0157380_10012953 3300014326 Bacteria 6062
223 Ga0157380_10050903 3300014326 Bacteria 3273
224 Ga0157380_10309849 3300014326 Bacteria 1458
225 Ga0157380_10735497 3300014326 Bacteria 996
226 Ga0157379_10006902 3300014968 Bacteria 9819
227 Ga0157379_10373314 3300014968 Bacteria 1308
228 Ga0157376_10000540 3300014969 Bacteria 24303
229 Ga0157376_10188897 3300014969 Unclassified 1888
230 Ga0157376_10689876 3300014969 Bacteria 1025
231 Ga0157376_11107502 3300014969 Bacteria 818
232 Ga0206352_10837814 3300020078 Bacteria 1772
233 Ga0206350_11214397 3300020080 Bacteria 823
234 Ga0207656_10172352 3300025321 Bacteria 1035
235 Ga0207653_10037225 3300025885 Bacteria 1586
236 Ga0207653_10070841 3300025885 Bacteria 1191
237 Ga0207682_10081314 3300025893 Bacteria 1389
238 Ga0207682_10139755 3300025893 Bacteria 1086
239 Ga0207642_10059373 3300025899 Bacteria 1768
240 Ga0207680_10003989 3300025903 Bacteria 6972
241 Ga0207680_10108080 3300025903 Bacteria 1799
242 Ga0207680_10231086 3300025903 Unclassified 1271
243 Ga0207645_10004240 3300025907 Bacteria 10643
244 Ga0207645_10183594 3300025907 Bacteria 1373
245 Ga0207684_10000484 3300025910 Bacteria 51244
246 Ga0207684_10668388 3300025910 Bacteria 884
247 Ga0207684_10713611 3300025910 Bacteria 851
248 Ga0207707_10380089 3300025912 Bacteria 1214
249 Ga0207693_10044185 3300025915 Bacteria 3502
250 Ga0207663_10392564 3300025916 Bacteria 1059
251 Ga0207662_10595042 3300025918 Bacteria 769
252 Ga0207652_10030524 3300025921 Bacteria 4515
253 Ga0207646_10082452 3300025922 Bacteria 2876
254 Ga0207646_10094178 3300025922 Bacteria 2682
255 Ga0207646_10311083 3300025922 Bacteria 1423
256 Ga0207646_10402543 3300025922 Bacteria 1236
257 Ga0207681_10000303 3300025923 Bacteria 36315
258 Ga0207681_10100127 3300025923 Bacteria 2088
259 Ga0207681_10263773 3300025923 Bacteria 1350
260 Ga0207650_10014359 3300025925 Bacteria 5505
261 Ga0207650_10037608 3300025925 Bacteria 3528
262 Ga0207659_10046200 3300025926 Bacteria 3073
263 Ga0207659_10259507 3300025926 Bacteria 1413
264 Ga0207659_10342556 3300025926 Bacteria 1238
265 Ga0207644_10072496 3300025931 Bacteria 2522
266 Ga0207644_10346636 3300025931 Bacteria 1205
267 Ga0207644_10351827 3300025931 Bacteria 1196
268 Ga0207706_10011630 3300025933 Bacteria 8021
269 Ga0207706_10035778 3300025933 Bacteria 4412
270 Ga0207670_10188518 3300025936 Bacteria 1559
271 Ga0207669_10007154 3300025937 Bacteria 5140
272 Ga0207669_10354806 3300025937 Bacteria 1134
273 Ga0207669_10588625 3300025937 Bacteria 903
274 Ga0207704_10001261 3300025938 Bacteria 11311
275 Ga0207704_10082951 3300025938 Bacteria 2079
276 Ga0207691_10002305 3300025940 Bacteria 18709
277 Ga0207691_10008116 3300025940 Bacteria 10079
278 Ga0207691_10015964 3300025940 Bacteria 7134
279 Ga0207691_10201637 3300025940 Bacteria 1731
280 Ga0207711_10000818 3300025941 Bacteria 30428
281 Ga0207711_10049665 3300025941 Bacteria 3591
282 Ga0207711_10188551 3300025941 Bacteria 1878
283 Ga0207689_10013024 3300025942 Bacteria 7103
284 Ga0207689_10077823 3300025942 Bacteria 2726
285 Ga0207689_10145582 3300025942 Bacteria 1952
286 Ga0207661_10893909 3300025944 Bacteria 818
287 Ga0207679_10254955 3300025945 Bacteria 1493
288 Ga0207679_10481449 3300025945 Bacteria 1105
289 Ga0207667_10020104 3300025949 Bacteria 7435
290 Ga0207651_10033510 3300025960 Bacteria 3314
291 Ga0207712_10290174 3300025961 Bacteria 1338
292 Ga0207668_10491063 3300025972 Bacteria 1054
293 Ga0207658_10004005 3300025986 Bacteria 10310
294 Ga0207658_10019750 3300025986 Bacteria 4661
295 Ga0207658_10049974 3300025986 Bacteria 3075
296 Ga0207658_10306855 3300025986 Bacteria 1369
297 Ga0207677_10055443 3300026023 Bacteria 2710
298 Ga0207703_10053482 3300026035 Bacteria 3282
299 Ga0207703_10114979 3300026035 Bacteria 2302
300 Ga0207703_10321938 3300026035 Bacteria 1416
301 Ga0207703_10367090 3300026035 Bacteria 1329
302 Ga0207703_10781419 3300026035 Bacteria 911
303 Ga0207639_10432096 3300026041 Bacteria 1192
304 Ga0207639_10933339 3300026041 Bacteria 812
305 Ga0207678_10019429 3300026067 Bacteria 5968
306 Ga0207678_10086073 3300026067 Bacteria 2686
307 Ga0207708_10043556 3300026075 Bacteria 3420
308 Ga0207708_10101450 3300026075 Bacteria 2228
309 Ga0207708_10187579 3300026075 Bacteria 1644
310 Ga0207702_10035377 3300026078 Bacteria 4176
311 Ga0207702_10307012 3300026078 Bacteria 1507
312 Ga0207702_10606314 3300026078 Bacteria 1075
313 Ga0207641_10036258 3300026088 Bacteria 4116
314 Ga0207641_10100015 3300026088 Bacteria 2553
315 Ga0207641_10122915 3300026088 Bacteria 2319
316 Ga0207641_10738623 3300026088 Bacteria 971
317 Ga0207648_10002018 3300026089 Bacteria 22157
318 Ga0207648_10006924 3300026089 Bacteria 11230
319 Ga0207648_10012053 3300026089 Bacteria 8110
320 Ga0207648_10161569 3300026089 Bacteria 1978
321 Ga0207648_10574613 3300026089 Bacteria 1037
322 Ga0207676_10047567 3300026095 Bacteria 3325
323 Ga0207676_10174493 3300026095 Bacteria 1876
324 Ga0207676_10188898 3300026095 Bacteria 1811
325 Ga0207676_10296414 3300026095 Bacteria 1475
326 Ga0207674_10087665 3300026116 Bacteria 3105
327 Ga0207674_10850513 3300026116 Bacteria 880
328 Ga0207675_100007845 3300026118 Bacteria 10072
329 Ga0207675_100147922 3300026118 Bacteria 2234
330 Ga0207675_100421697 3300026118 Bacteria 1318
331 Ga0207683_10062713 3300026121 Bacteria 3274
332 Ga0207683_10548343 3300026121 Bacteria 1069
333 Ga0207428_10015001 3300027907 Bacteria 6714
334 Ga0268266_10570607 3300028379 Bacteria 1085
335 Ga0268265_10081718 3300028380 Bacteria 2552
336 Ga0268265_10092134 3300028380 Bacteria 2425
337 Ga0268265_10194525 3300028380 Bacteria 1754
338 Ga0268265_11433915 3300028380 Bacteria 693
339 Ga0268264_10017352 3300028381 Bacteria 5897
340 Ga0268264_10502213 3300028381 Bacteria 1183
341 Ga0265318_10072966 3300028577 Bacteria 1271
342 Ga0265330_10194826 3300031235 Bacteria 857
343 Ga0265332_10019263 3300031238 Bacteria 3011
344 Ga0265328_10018230 3300031239 Bacteria 2709
345 Ga0265340_10033838 3300031247 Bacteria 2543
346 Ga0265339_10031289 3300031249 Bacteria 3008
347 Ga0265331_10022557 3300031250 Bacteria 3211
348 Ga0265331_10039179 3300031250 Bacteria 2312
349 Ga0265316_10021754 3300031344 Bacteria 5424
350 Ga0265313_10036316 3300031595 Bacteria 2474
351 Ga0265342_10222433 3300031712 Bacteria 1016
352 Ga0265342_10223486 3300031712 Bacteria 1014
353 Ga0373957_0036607 3300035120 Unclassified 1829
354 Ga0373943_0138590 3300035170 Bacteria 1309
355 Ga0316574_0051512 3300035398 Bacteria 2566
356 Ga0373935_0091438 3300035692 Bacteria 1993
357 Ga0373933_0378720 3300035724 Bacteria 921
358 Ga0373933_0404068 3300035724 Bacteria 891
359 Ga0373937_0273106 3300036401 Bacteria 1596
360 Ga0373937_0533237 3300036401 Bacteria 1115
361 Ga0373925_0437131 3300037068 Bacteria 1070
362 Ga0436360_0509739 3300039438 Bacteria 1097
363 Ga0436363_0097870 3300039450 Bacteria 1392
364 Ga0451576_0091922 3300045051 Bacteria 3156
365 Ga0495629_0180679 3300046459 Bacteria 1462
366 Ga0495629_0476949 3300046459 Bacteria 843
367 Ga0495580_0000003 3300046472 Bacteria 113939
368 Ga0495580_0062897 3300046472 Bacteria 2603
369 Ga0495580_0092849 3300046472 Bacteria 2101
370 Ga0495582_0320151 3300046473 Bacteria 892
371 Ga0495662_0045106 3300046476 Bacteria 2128
372 Ga0495594_0311489 3300046499 Bacteria 897
373 Ga0495608_0116885 3300046511 Bacteria 1711
374 Ga0495618_0098133 3300046514 Bacteria 1874
375 Ga0495666_0164928 3300046526 Bacteria 1026
376 Ga0495665_0064080 3300046531 Bacteria 1940
377 Ga0495665_0112065 3300046531 Bacteria 1431
378 Ga0495586_0233441 3300046535 Bacteria 1047
379 Ga0495667_0001247 3300046559 Bacteria 16684
380 Ga0495634_0278938 3300046642 Bacteria 1015
381 Ga0495657_0008499 3300046675 Bacteria 7849
382 Ga0495647_0022147 3300046681 Bacteria 2294
383 Ga0495647_0058957 3300046681 Bacteria 1510
384 Ga0495658_0420988 3300046683 Bacteria 852
385 Ga0495613_0132243 3300046689 Bacteria 1786
386 Ga0495613_0184852 3300046689 Bacteria 1475
387 Ga0495600_0219023 3300046809 Bacteria 1218
388 Ga0495636_0020533 3300047318 Archaea 2662
389 Ga0495674_0003956 3300047319 Bacteria 14370
390 Ga0495684_0022118 3300047471 Bacteria 4896
391 Ga0495684_0069986 3300047471 Bacteria 2667
392 Ga0496100_0020374 3300048903 Bacteria 3975
393 Ga0496101_0021658 3300048904 Bacteria 4417
394 Ga0496102_0019052 3300048905 Bacteria 6040
395 Ga0496103_0155536 3300048906 Bacteria 1465
396 Ga0496104_0487770 3300048907 Bacteria 1144
397 Ga0496105_0208632 3300048908 Bacteria 1593
398 Ga0496106_0000694 3300048909 Bacteria 24173
399 Ga0496107_0001688 3300048910 Bacteria 13828
400 Ga0496107_0121443 3300048910 Bacteria 1925
401 Ga0496108_0101477 3300048911 Bacteria 2455
402 Ga0496109_0034606 3300048912 Bacteria 4552
403 Ga0496110_0037743 3300048913 Bacteria 4200
404 Ga0496113_0025468 3300048916 Bacteria 4217
405 Ga0501039_0226622 3300049575 Bacteria 1469
406 Ga0501072_0342648 3300049588 Bacteria 1187
407 Ga0501081_0547440 3300049743 Bacteria 864
408 nmdc:mga05p37_1245_c1 3300050507 Bacteria 29568
409 nmdc:mga05p37_153899_c1 3300050507 Bacteria 2811
410 nmdc:mga05p37_31244_c1 3300050507 Bacteria 6505
411 nmdc:mga05p37_35881_c1 3300050507 Bacteria 6083
412 nmdc:mga05p37_411476_c1 3300050507 Bacteria 1576
413 nmdc:mga05p37_436993_c1 3300050507 Bacteria 1519
414 nmdc:mga05p37_459482_c1 3300050507 Bacteria 1472
415 nmdc:mga05p37_86225_c1 3300050507 Bacteria 3870
416 nmdc:mga09592_1617_c1 3300050508 Bacteria 18127
417 nmdc:mga09592_28841_c1 3300050508 Bacteria 4614
418 nmdc:mga09592_34713_c1 3300050508 Bacteria 4217
419 nmdc:mga0qj67_307321_c1 3300050509 Bacteria 1284
420 nmdc:mga0qj67_320719_c1 3300050509 Bacteria 1254
421 nmdc:mga0qj67_592357_c1 3300050509 Bacteria 887
422 nmdc:mga06r32_1276329_c1 3300050510 Bacteria 679
423 nmdc:mga06r32_228009_c1 3300050510 Bacteria 1851
424 nmdc:mga06r32_596034_c1 3300050510 Bacteria 1076
425 nmdc:mga06r32_63558_c1 3300050510 Bacteria 3558
426 nmdc:mga06r32_7190_c2 3300050510 Bacteria 4898
427 nmdc:mga08y16_380122_c1 3300050511 Bacteria 1448
428 nmdc:mga0n895_266585_c1 3300050512 Unclassified 1737
429 nmdc:mga0n895_275734_c1 3300050512 Bacteria 1705
430 nmdc:mga0n895_281784_c1 3300050512 Bacteria 1685
431 nmdc:mga0n895_338710_c1 3300050512 Bacteria 1524
432 nmdc:mga0rr50_546289_c1 3300050513 Bacteria 986
433 nmdc:mga0rr50_87998_c1 3300050513 Bacteria 2412
434 nmdc:mga0a205_487004_c1 3300050515 Bacteria 1091
435 Ga0495619_0059702 3300053085 Bacteria 2534
436 Ga0495619_0528789 3300053085 Bacteria 810
437 Ga0501082_0372509 3300060353 Bacteria 1246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100022796 Ga0068863_1000227963 199
2 3300006358 Ga0068871_100925117 Ga0068871_1009251172 199
3 3300014969 Ga0157376_10689876 Ga0157376_106898762 199
4 3300009177 Ga0105248_10042119 Ga0105248_100421194 200
5 3300020078 Ga0206352_10837814 Ga0206352_108378144 200
6 3300025945 Ga0207679_10481449 Ga0207679_104814491 200
7 3300035398 Ga0316574_0051512 Ga0316574_0051512_867_1475 202
8 iso_pu_bacteria 2902792274 2902796207 202
9 3300005842 Ga0068858_101197277 Ga0068858_1011972771 203
10 iso_pu_bacteria 2547132424 2548692348 203
11 iso_pu_bacteria 2744054611 2744958325 203
12 iso_pu_bacteria 2842134933 2842136139 203
13 iso_pu_bacteria 2919713450 2919714851 203
14 3300006880 Ga0075429_100071836 Ga0075429_1000718362 204
15 3300050508 nmdc:mga09592_28841_c1 nmdc:mga09592_28841_c1_2975_3676 204
16 3300005458 Ga0070681_10165688 Ga0070681_101656883 205
17 3300005530 Ga0070679_100770413 Ga0070679_1007704131 205
18 3300005536 Ga0070697_100043209 Ga0070697_1000432093 205
19 3300005536 Ga0070697_100314553 Ga0070697_1003145531 205
20 3300006914 Ga0075436_100620086 Ga0075436_1006200861 205
21 3300025912 Ga0207707_10380089 Ga0207707_103800891 205
22 3300047318 Ga0495636_0020533 Ga0495636_0020533_336_956 205
23 3300005355 Ga0070671_100096351 Ga0070671_1000963512 207
24 3300005843 Ga0068860_100682697 Ga0068860_1006826971 207
25 3300006881 Ga0068865_100314577 Ga0068865_1003145772 207
26 3300014326 Ga0157380_10309849 Ga0157380_103098492 207
27 3300025931 Ga0207644_10072496 Ga0207644_100724962 207
28 3300004803 Ga0058862_11664582 Ga0058862_116645822 208
29 3300005293 Ga0065715_10501116 Ga0065715_105011161 208
30 3300005295 Ga0065707_10182307 Ga0065707_101823071 208
31 3300005330 Ga0070690_100001832 Ga0070690_10000183214 208
32 3300005330 Ga0070690_100081894 Ga0070690_1000818943 208
33 3300005331 Ga0070670_100061432 Ga0070670_1000614324 208
34 3300005331 Ga0070670_100228023 Ga0070670_1002280231 208
35 3300005333 Ga0070677_10078864 Ga0070677_100788642 208
36 3300005333 Ga0070677_10136009 Ga0070677_101360092 208
37 3300005334 Ga0068869_100022302 Ga0068869_1000223023 208
38 3300005334 Ga0068869_100069556 Ga0068869_1000695562 208
39 3300005335 Ga0070666_10001475 Ga0070666_100014759 208
40 3300005335 Ga0070666_10124130 Ga0070666_101241301 208
41 3300005338 Ga0068868_100017191 Ga0068868_1000171916 208
42 3300005340 Ga0070689_100179016 Ga0070689_1001790162 208
43 3300005340 Ga0070689_100188304 Ga0070689_1001883042 208
44 3300005340 Ga0070689_100195358 Ga0070689_1001953582 208
45 3300005341 Ga0070691_10152159 Ga0070691_101521591 208
46 3300005341 Ga0070691_10250980 Ga0070691_102509801 208
47 3300005343 Ga0070687_100171050 Ga0070687_1001710502 208
48 3300005345 Ga0070692_10003555 Ga0070692_100035553 208
49 3300005345 Ga0070692_10004378 Ga0070692_100043785 208
50 3300005347 Ga0070668_100061841 Ga0070668_1000618412 208
51 3300005353 Ga0070669_100148775 Ga0070669_1001487753 208
52 3300005353 Ga0070669_100190819 Ga0070669_1001908192 208
53 3300005353 Ga0070669_100197219 Ga0070669_1001972193 208
54 3300005354 Ga0070675_100025234 Ga0070675_1000252344 208
55 3300005354 Ga0070675_100076042 Ga0070675_1000760424 208
56 3300005354 Ga0070675_100199904 Ga0070675_1001999042 208
57 3300005354 Ga0070675_100408172 Ga0070675_1004081722 208
58 3300005355 Ga0070671_100019169 Ga0070671_1000191696 208
59 3300005355 Ga0070671_100258479 Ga0070671_1002584792 208
60 3300005356 Ga0070674_100094497 Ga0070674_1000944972 208
61 3300005356 Ga0070674_100107856 Ga0070674_1001078564 208
62 3300005364 Ga0070673_100041857 Ga0070673_1000418571 208
63 3300005364 Ga0070673_100095083 Ga0070673_1000950833 208
64 3300005364 Ga0070673_100125400 Ga0070673_1001254003 208
65 3300005364 Ga0070673_100439665 Ga0070673_1004396652 208
66 3300005365 Ga0070688_100319246 Ga0070688_1003192461 208
67 3300005365 Ga0070688_100546984 Ga0070688_1005469841 208
68 3300005367 Ga0070667_100000383 Ga0070667_10000038327 208
69 3300005367 Ga0070667_100088472 Ga0070667_1000884723 208
70 3300005367 Ga0070667_100188150 Ga0070667_1001881502 208
71 3300005406 Ga0070703_10100016 Ga0070703_101000161 208
72 3300005406 Ga0070703_10172268 Ga0070703_101722681 208
73 3300005436 Ga0070713_100516810 Ga0070713_1005168101 208
74 3300005438 Ga0070701_10034224 Ga0070701_100342243 208
75 3300005439 Ga0070711_100122146 Ga0070711_1001221462 208
76 3300005440 Ga0070705_100034004 Ga0070705_1000340044 208
77 3300005440 Ga0070705_100091444 Ga0070705_1000914442 208
78 3300005440 Ga0070705_100216623 Ga0070705_1002166231 208
79 3300005441 Ga0070700_100021876 Ga0070700_1000218764 208
80 3300005441 Ga0070700_100163277 Ga0070700_1001632772 208
81 3300005441 Ga0070700_100182666 Ga0070700_1001826662 208
82 3300005444 Ga0070694_100000350 Ga0070694_1000003503 208
83 3300005444 Ga0070694_100000654 Ga0070694_1000006543 208
84 3300005444 Ga0070694_100210220 Ga0070694_1002102201 208
85 3300005444 Ga0070694_100319214 Ga0070694_1003192141 208
86 3300005445 Ga0070708_100009661 Ga0070708_10000966111 208
87 3300005445 Ga0070708_100015978 Ga0070708_1000159782 208
88 3300005455 Ga0070663_100146906 Ga0070663_1001469064 208
89 3300005455 Ga0070663_100197715 Ga0070663_1001977152 208
90 3300005456 Ga0070678_100603821 Ga0070678_1006038211 208
91 3300005456 Ga0070678_100831142 Ga0070678_1008311421 208
92 3300005457 Ga0070662_100145708 Ga0070662_1001457083 208
93 3300005457 Ga0070662_100230921 Ga0070662_1002309212 208
94 3300005457 Ga0070662_100537216 Ga0070662_1005372161 208
95 3300005459 Ga0068867_100004326 Ga0068867_1000043269 208
96 3300005459 Ga0068867_100083664 Ga0068867_1000836642 208
97 3300005459 Ga0068867_100223367 Ga0068867_1002233672 208
98 3300005467 Ga0070706_100000806 Ga0070706_10000080622 208
99 3300005467 Ga0070706_100019704 Ga0070706_1000197043 208
100 3300005467 Ga0070706_100072722 Ga0070706_1000727223 208
101 3300005467 Ga0070706_100172739 Ga0070706_1001727393 208
102 3300005467 Ga0070706_100557568 Ga0070706_1005575681 208
103 3300005467 Ga0070706_100616309 Ga0070706_1006163091 208
104 3300005467 Ga0070706_100791365 Ga0070706_1007913651 208
105 3300005468 Ga0070707_100004454 Ga0070707_1000044545 208
106 3300005468 Ga0070707_100019795 Ga0070707_1000197958 208
107 3300005468 Ga0070707_100167699 Ga0070707_1001676993 208
108 3300005468 Ga0070707_100928247 Ga0070707_1009282471 208
109 3300005471 Ga0070698_100000029 Ga0070698_10000002970 208
110 3300005471 Ga0070698_100030565 Ga0070698_1000305652 208
111 3300005471 Ga0070698_100068736 Ga0070698_1000687365 208
112 3300005471 Ga0070698_100615551 Ga0070698_1006155511 208
113 3300005518 Ga0070699_100031716 Ga0070699_1000317164 208
114 3300005518 Ga0070699_100131624 Ga0070699_1001316242 208
115 3300005518 Ga0070699_100166664 Ga0070699_1001666644 208
116 3300005518 Ga0070699_100801318 Ga0070699_1008013181 208
117 3300005535 Ga0070684_100134672 Ga0070684_1001346723 208
118 3300005536 Ga0070697_100001290 Ga0070697_1000012907 208
119 3300005536 Ga0070697_100269264 Ga0070697_1002692642 208
120 3300005539 Ga0068853_101014275 Ga0068853_1010142751 208
121 3300005543 Ga0070672_100000609 Ga0070672_1000006097 208
122 3300005543 Ga0070672_100016128 Ga0070672_1000161284 208
123 3300005543 Ga0070672_100028483 Ga0070672_1000284836 208
124 3300005543 Ga0070672_100310559 Ga0070672_1003105592 208
125 3300005543 Ga0070672_100639895 Ga0070672_1006398951 208
126 3300005544 Ga0070686_100032095 Ga0070686_1000320955 208
127 3300005544 Ga0070686_100056954 Ga0070686_1000569543 208
128 3300005545 Ga0070695_100005536 Ga0070695_1000055369 208
129 3300005545 Ga0070695_100808310 Ga0070695_1008083101 208
130 3300005546 Ga0070696_100138253 Ga0070696_1001382532 208
131 3300005547 Ga0070693_100024660 Ga0070693_1000246601 208
132 3300005548 Ga0070665_100011030 Ga0070665_1000110303 208
133 3300005548 Ga0070665_100262294 Ga0070665_1002622942 208
134 3300005549 Ga0070704_100000399 Ga0070704_10000039913 208
135 3300005549 Ga0070704_100002191 Ga0070704_1000021915 208
136 3300005549 Ga0070704_100011143 Ga0070704_1000111433 208
137 3300005549 Ga0070704_100012166 Ga0070704_1000121665 208
138 3300005549 Ga0070704_100783184 Ga0070704_1007831841 208
139 3300005564 Ga0070664_100023120 Ga0070664_1000231204 208
140 3300005564 Ga0070664_100050441 Ga0070664_1000504417 208
141 3300005577 Ga0068857_100982810 Ga0068857_1009828102 208
142 3300005614 Ga0068856_100013892 Ga0068856_10001389211 208
143 3300005615 Ga0070702_100011696 Ga0070702_1000116967 208
144 3300005615 Ga0070702_100366468 Ga0070702_1003664682 208
145 3300005617 Ga0068859_100000032 Ga0068859_10000003273 208
146 3300005617 Ga0068859_100023699 Ga0068859_10002369914 208
147 3300005617 Ga0068859_100026181 Ga0068859_1000261815 208
148 3300005618 Ga0068864_100039690 Ga0068864_1000396905 208
149 3300005618 Ga0068864_100042568 Ga0068864_1000425682 208
150 3300005618 Ga0068864_100097665 Ga0068864_1000976652 208
151 3300005618 Ga0068864_100191002 Ga0068864_1001910023 208
152 3300005718 Ga0068866_10022892 Ga0068866_100228924 208
153 3300005834 Ga0068851_10209358 Ga0068851_102093582 208
154 3300005840 Ga0068870_10130495 Ga0068870_101304952 208
155 3300005841 Ga0068863_100043589 Ga0068863_1000435896 208
156 3300005841 Ga0068863_100053239 Ga0068863_1000532394 208
157 3300005841 Ga0068863_100138746 Ga0068863_1001387462 208
158 3300005841 Ga0068863_100216740 Ga0068863_1002167403 208
159 3300005842 Ga0068858_100031746 Ga0068858_1000317465 208
160 3300005842 Ga0068858_100298420 Ga0068858_1002984202 208
161 3300005843 Ga0068860_100077694 Ga0068860_1000776945 208
162 3300005843 Ga0068860_100317171 Ga0068860_1003171712 208
163 3300005843 Ga0068860_100324952 Ga0068860_1003249522 208
164 3300005844 Ga0068862_100003064 Ga0068862_10000306418 208
165 3300005844 Ga0068862_100105660 Ga0068862_1001056602 208
166 3300005844 Ga0068862_100261330 Ga0068862_1002613302 208
167 3300006175 Ga0070712_100025126 Ga0070712_1000251263 208
168 3300006177 Ga0075362_10229971 Ga0075362_102299711 208
169 3300006237 Ga0097621_100004416 Ga0097621_1000044165 208
170 3300006237 Ga0097621_100089712 Ga0097621_1000897122 208
171 3300006358 Ga0068871_100027133 Ga0068871_1000271335 208
172 3300006358 Ga0068871_100582301 Ga0068871_1005823012 208
173 3300006358 Ga0068871_100637087 Ga0068871_1006370872 208
174 3300006844 Ga0075428_100117762 Ga0075428_1001177623 208
175 3300006844 Ga0075428_100137655 Ga0075428_1001376554 208
176 3300006844 Ga0075428_100172292 Ga0075428_1001722923 208
177 3300006844 Ga0075428_100174794 Ga0075428_1001747942 208
178 3300006844 Ga0075428_100405870 Ga0075428_1004058702 208
179 3300006844 Ga0075428_100454952 Ga0075428_1004549523 208
180 3300006844 Ga0075428_100669153 Ga0075428_1006691531 208
181 3300006846 Ga0075430_100161973 Ga0075430_1001619732 208
182 3300006846 Ga0075430_100286286 Ga0075430_1002862862 208
183 3300006847 Ga0075431_100057128 Ga0075431_1000571284 208
184 3300006847 Ga0075431_100068240 Ga0075431_1000682402 208
185 3300006847 Ga0075431_100459367 Ga0075431_1004593672 208
186 3300006847 Ga0075431_100465933 Ga0075431_1004659332 208
187 3300006871 Ga0075434_100045940 Ga0075434_1000459404 208
188 3300006871 Ga0075434_100109136 Ga0075434_1001091362 208
189 3300006871 Ga0075434_100152405 Ga0075434_1001524053 208
190 3300006871 Ga0075434_100286487 Ga0075434_1002864871 208
191 3300006871 Ga0075434_100434833 Ga0075434_1004348331 208
192 3300006880 Ga0075429_100007762 Ga0075429_1000077627 208
193 3300006881 Ga0068865_100126313 Ga0068865_1001263134 208
194 3300006881 Ga0068865_100160750 Ga0068865_1001607502 208
195 3300006881 Ga0068865_100185391 Ga0068865_1001853912 208
196 3300006881 Ga0068865_100368766 Ga0068865_1003687662 208
197 3300006914 Ga0075436_100513794 Ga0075436_1005137941 208
198 3300006931 Ga0097620_100000032 Ga0097620_10000003273 208
199 3300006931 Ga0097620_100023702 Ga0097620_10002370214 208
200 3300006931 Ga0097620_100026181 Ga0097620_1000261815 208
201 3300007076 Ga0075435_100000736 Ga0075435_10000073610 208
202 3300007076 Ga0075435_100785399 Ga0075435_1007853992 208
203 3300009094 Ga0111539_10001988 Ga0111539_1000198828 208
204 3300009094 Ga0111539_10036622 Ga0111539_100366225 208
205 3300009094 Ga0111539_11245092 Ga0111539_112450921 208
206 3300009094 Ga0111539_11853319 Ga0111539_118533191 208
207 3300009101 Ga0105247_10145863 Ga0105247_101458632 208
208 3300009147 Ga0114129_10001728 Ga0114129_1000172811 208
209 3300009147 Ga0114129_10005327 Ga0114129_1000532718 208
210 3300009147 Ga0114129_10021776 Ga0114129_1002177610 208
211 3300009147 Ga0114129_10055416 Ga0114129_100554164 208
212 3300009147 Ga0114129_10056322 Ga0114129_100563225 208
213 3300009147 Ga0114129_10080326 Ga0114129_100803262 208
214 3300009147 Ga0114129_10231243 Ga0114129_102312432 208
215 3300009147 Ga0114129_10252062 Ga0114129_102520623 208
216 3300009174 Ga0105241_10049640 Ga0105241_100496403 208
217 3300009177 Ga0105248_10001906 Ga0105248_1000190616 208
218 3300009177 Ga0105248_10024048 Ga0105248_100240484 208
219 3300009553 Ga0105249_10031296 Ga0105249_100312969 208
220 3300009553 Ga0105249_10475965 Ga0105249_104759651 208
221 3300013100 Ga0157373_10321887 Ga0157373_103218872 208
222 3300013297 Ga0157378_10002596 Ga0157378_1000259615 208
223 3300013297 Ga0157378_10352941 Ga0157378_103529412 208
224 3300013306 Ga0163162_10118807 Ga0163162_101188073 208
225 3300013306 Ga0163162_10150017 Ga0163162_101500172 208
226 3300013306 Ga0163162_10256559 Ga0163162_102565592 208
227 3300013308 Ga0157375_10002833 Ga0157375_1000283314 208
228 3300013308 Ga0157375_10051493 Ga0157375_100514934 208
229 3300013308 Ga0157375_10073207 Ga0157375_100732071 208
230 3300014325 Ga0163163_10000314 Ga0163163_1000031428 208
231 3300014325 Ga0163163_10010143 Ga0163163_100101439 208
232 3300014325 Ga0163163_10018387 Ga0163163_100183877 208
233 3300014325 Ga0163163_10051141 Ga0163163_100511413 208
234 3300014325 Ga0163163_10327550 Ga0163163_103275501 208
235 3300014325 Ga0163163_10403621 Ga0163163_104036213 208
236 3300014326 Ga0157380_10012953 Ga0157380_100129535 208
237 3300014326 Ga0157380_10050903 Ga0157380_100509034 208
238 3300014326 Ga0157380_10735497 Ga0157380_107354971 208
239 3300014968 Ga0157379_10006902 Ga0157379_100069025 208
240 3300014968 Ga0157379_10373314 Ga0157379_103733142 208
241 3300014969 Ga0157376_10000540 Ga0157376_1000054023 208
242 3300014969 Ga0157376_10188897 Ga0157376_101888973 208
243 3300014969 Ga0157376_11107502 Ga0157376_111075022 208
244 3300020080 Ga0206350_11214397 Ga0206350_112143971 208
245 3300025321 Ga0207656_10172352 Ga0207656_101723522 208
246 3300025885 Ga0207653_10037225 Ga0207653_100372253 208
247 3300025885 Ga0207653_10070841 Ga0207653_100708412 208
248 3300025893 Ga0207682_10081314 Ga0207682_100813142 208
249 3300025893 Ga0207682_10139755 Ga0207682_101397552 208
250 3300025899 Ga0207642_10059373 Ga0207642_100593732 208
251 3300025903 Ga0207680_10003989 Ga0207680_1000398911 208
252 3300025903 Ga0207680_10108080 Ga0207680_101080803 208
253 3300025903 Ga0207680_10231086 Ga0207680_102310862 208
254 3300025907 Ga0207645_10004240 Ga0207645_100042408 208
255 3300025907 Ga0207645_10183594 Ga0207645_101835941 208
256 3300025910 Ga0207684_10000484 Ga0207684_1000048418 208
257 3300025910 Ga0207684_10668388 Ga0207684_106683882 208
258 3300025910 Ga0207684_10713611 Ga0207684_107136111 208
259 3300025915 Ga0207693_10044185 Ga0207693_100441856 208
260 3300025916 Ga0207663_10392564 Ga0207663_103925642 208
261 3300025918 Ga0207662_10595042 Ga0207662_105950422 208
262 3300025921 Ga0207652_10030524 Ga0207652_100305242 208
263 3300025922 Ga0207646_10082452 Ga0207646_100824523 208
264 3300025922 Ga0207646_10094178 Ga0207646_100941781 208
265 3300025922 Ga0207646_10311083 Ga0207646_103110832 208
266 3300025922 Ga0207646_10402543 Ga0207646_104025431 208
267 3300025923 Ga0207681_10000303 Ga0207681_1000030333 208
268 3300025923 Ga0207681_10100127 Ga0207681_101001271 208
269 3300025923 Ga0207681_10263773 Ga0207681_102637731 208
270 3300025925 Ga0207650_10014359 Ga0207650_100143593 208
271 3300025925 Ga0207650_10037608 Ga0207650_100376083 208
272 3300025926 Ga0207659_10046200 Ga0207659_100462006 208
273 3300025926 Ga0207659_10259507 Ga0207659_102595072 208
274 3300025926 Ga0207659_10342556 Ga0207659_103425562 208
275 3300025931 Ga0207644_10346636 Ga0207644_103466362 208
276 3300025931 Ga0207644_10351827 Ga0207644_103518272 208
277 3300025933 Ga0207706_10011630 Ga0207706_100116304 208
278 3300025933 Ga0207706_10035778 Ga0207706_100357782 208
279 3300025936 Ga0207670_10188518 Ga0207670_101885182 208
280 3300025937 Ga0207669_10007154 Ga0207669_100071545 208
281 3300025937 Ga0207669_10354806 Ga0207669_103548062 208
282 3300025937 Ga0207669_10588625 Ga0207669_105886251 208
283 3300025938 Ga0207704_10001261 Ga0207704_1000126112 208
284 3300025938 Ga0207704_10082951 Ga0207704_100829513 208
285 3300025940 Ga0207691_10002305 Ga0207691_100023059 208
286 3300025940 Ga0207691_10008116 Ga0207691_100081169 208
287 3300025940 Ga0207691_10015964 Ga0207691_100159646 208
288 3300025940 Ga0207691_10201637 Ga0207691_102016373 208
289 3300025941 Ga0207711_10000818 Ga0207711_1000081827 208
290 3300025941 Ga0207711_10049665 Ga0207711_100496654 208
291 3300025941 Ga0207711_10188551 Ga0207711_101885513 208
292 3300025942 Ga0207689_10013024 Ga0207689_100130246 208
293 3300025942 Ga0207689_10077823 Ga0207689_100778232 208
294 3300025942 Ga0207689_10145582 Ga0207689_101455822 208
295 3300025944 Ga0207661_10893909 Ga0207661_108939092 208
296 3300025945 Ga0207679_10254955 Ga0207679_102549552 208
297 3300025949 Ga0207667_10020104 Ga0207667_100201046 208
298 3300025960 Ga0207651_10033510 Ga0207651_100335105 208
299 3300025961 Ga0207712_10290174 Ga0207712_102901742 208
300 3300025972 Ga0207668_10491063 Ga0207668_104910631 208
301 3300025986 Ga0207658_10004005 Ga0207658_100040059 208
302 3300025986 Ga0207658_10019750 Ga0207658_100197506 208
303 3300025986 Ga0207658_10049974 Ga0207658_100499743 208
304 3300025986 Ga0207658_10306855 Ga0207658_103068552 208
305 3300026023 Ga0207677_10055443 Ga0207677_100554433 208
306 3300026035 Ga0207703_10053482 Ga0207703_100534825 208
307 3300026035 Ga0207703_10114979 Ga0207703_101149792 208
308 3300026035 Ga0207703_10321938 Ga0207703_103219381 208
309 3300026035 Ga0207703_10367090 Ga0207703_103670901 208
310 3300026035 Ga0207703_10781419 Ga0207703_107814191 208
311 3300026041 Ga0207639_10432096 Ga0207639_104320962 208
312 3300026041 Ga0207639_10933339 Ga0207639_109333391 208
313 3300026067 Ga0207678_10019429 Ga0207678_100194297 208
314 3300026067 Ga0207678_10086073 Ga0207678_100860731 208
315 3300026075 Ga0207708_10043556 Ga0207708_100435563 208
316 3300026075 Ga0207708_10101450 Ga0207708_101014502 208
317 3300026075 Ga0207708_10187579 Ga0207708_101875792 208
318 3300026078 Ga0207702_10035377 Ga0207702_100353773 208
319 3300026078 Ga0207702_10307012 Ga0207702_103070122 208
320 3300026078 Ga0207702_10606314 Ga0207702_106063142 208
321 3300026088 Ga0207641_10036258 Ga0207641_100362583 208
322 3300026088 Ga0207641_10100015 Ga0207641_101000152 208
323 3300026088 Ga0207641_10122915 Ga0207641_101229153 208
324 3300026088 Ga0207641_10738623 Ga0207641_107386232 208
325 3300026089 Ga0207648_10002018 Ga0207648_1000201811 208
326 3300026089 Ga0207648_10006924 Ga0207648_100069244 208
327 3300026089 Ga0207648_10012053 Ga0207648_100120537 208
328 3300026089 Ga0207648_10161569 Ga0207648_101615691 208
329 3300026089 Ga0207648_10574613 Ga0207648_105746132 208
330 3300026095 Ga0207676_10047567 Ga0207676_100475673 208
331 3300026095 Ga0207676_10174493 Ga0207676_101744933 208
332 3300026095 Ga0207676_10188898 Ga0207676_101888983 208
333 3300026095 Ga0207676_10296414 Ga0207676_102964142 208
334 3300026116 Ga0207674_10087665 Ga0207674_100876653 208
335 3300026116 Ga0207674_10850513 Ga0207674_108505131 208
336 3300026118 Ga0207675_100007845 Ga0207675_10000784510 208
337 3300026118 Ga0207675_100147922 Ga0207675_1001479222 208
338 3300026118 Ga0207675_100421697 Ga0207675_1004216972 208
339 3300026121 Ga0207683_10062713 Ga0207683_100627133 208
340 3300026121 Ga0207683_10548343 Ga0207683_105483432 208
341 3300027907 Ga0207428_10015001 Ga0207428_100150017 208
342 3300028379 Ga0268266_10570607 Ga0268266_105706072 208
343 3300028380 Ga0268265_10081718 Ga0268265_100817182 208
344 3300028380 Ga0268265_10092134 Ga0268265_100921342 208
345 3300028380 Ga0268265_10194525 Ga0268265_101945251 208
346 3300028380 Ga0268265_11433915 Ga0268265_114339151 208
347 3300028381 Ga0268264_10017352 Ga0268264_100173525 208
348 3300028381 Ga0268264_10502213 Ga0268264_105022132 208
349 3300028577 Ga0265318_10072966 Ga0265318_100729662 208
350 3300031235 Ga0265330_10194826 Ga0265330_101948261 208
351 3300031238 Ga0265332_10019263 Ga0265332_100192635 208
352 3300031239 Ga0265328_10018230 Ga0265328_100182303 208
353 3300031247 Ga0265340_10033838 Ga0265340_100338383 208
354 3300031249 Ga0265339_10031289 Ga0265339_100312896 208
355 3300031250 Ga0265331_10022557 Ga0265331_100225574 208
356 3300031250 Ga0265331_10039179 Ga0265331_100391792 208
357 3300031344 Ga0265316_10021754 Ga0265316_100217543 208
358 3300031595 Ga0265313_10036316 Ga0265313_100363162 208
359 3300031712 Ga0265342_10222433 Ga0265342_102224332 208
360 3300031712 Ga0265342_10223486 Ga0265342_102234861 208
361 3300035120 Ga0373957_0036607 Ga0373957_0036607_881_1507 208
362 3300035170 Ga0373943_0138590 Ga0373943_0138590_553_1182 208
363 3300035692 Ga0373935_0091438 Ga0373935_0091438_67_696 208
364 3300035724 Ga0373933_0378720 Ga0373933_0378720_267_893 208
365 3300035724 Ga0373933_0404068 Ga0373933_0404068_26_658 208
366 3300036401 Ga0373937_0273106 Ga0373937_0273106_719_1345 208
367 3300036401 Ga0373937_0533237 Ga0373937_0533237_198_824 208
368 3300037068 Ga0373925_0437131 Ga0373925_0437131_316_945 208
369 3300039438 Ga0436360_0509739 Ga0436360_0509739_352_978 208
370 3300039450 Ga0436363_0097870 Ga0436363_0097870_426_1058 208
371 3300045051 Ga0451576_0091922 Ga0451576_0091922_1638_2267 208
372 3300046459 Ga0495629_0180679 Ga0495629_0180679_294_920 208
373 3300046459 Ga0495629_0476949 Ga0495629_0476949_156_788 208
374 3300046472 Ga0495580_0000003 Ga0495580_0000003_51055_51684 208
375 3300046472 Ga0495580_0062897 Ga0495580_0062897_448_1077 208
376 3300046472 Ga0495580_0092849 Ga0495580_0092849_312_941 208
377 3300046473 Ga0495582_0320151 Ga0495582_0320151_98_730 208
378 3300046476 Ga0495662_0045106 Ga0495662_0045106_141_770 208
379 3300046499 Ga0495594_0311489 Ga0495594_0311489_76_705 208
380 3300046511 Ga0495608_0116885 Ga0495608_0116885_661_1287 208
381 3300046514 Ga0495618_0098133 Ga0495618_0098133_534_1160 208
382 3300046526 Ga0495666_0164928 Ga0495666_0164928_144_884 208
383 3300046531 Ga0495665_0064080 Ga0495665_0064080_1209_1841 208
384 3300046531 Ga0495665_0112065 Ga0495665_0112065_757_1389 208
385 3300046535 Ga0495586_0233441 Ga0495586_0233441_141_767 208
386 3300046559 Ga0495667_0001247 Ga0495667_0001247_4015_4641 208
387 3300046642 Ga0495634_0278938 Ga0495634_0278938_55_681 208
388 3300046675 Ga0495657_0008499 Ga0495657_0008499_956_1582 208
389 3300046681 Ga0495647_0022147 Ga0495647_0022147_919_1548 208
390 3300046681 Ga0495647_0058957 Ga0495647_0058957_144_884 208
391 3300046683 Ga0495658_0420988 Ga0495658_0420988_197_829 208
392 3300046689 Ga0495613_0132243 Ga0495613_0132243_1061_1687 208
393 3300046689 Ga0495613_0184852 Ga0495613_0184852_215_856 208
394 3300046809 Ga0495600_0219023 Ga0495600_0219023_308_937 208
395 3300047319 Ga0495674_0003956 Ga0495674_0003956_123_749 208
396 3300047471 Ga0495684_0022118 Ga0495684_0022118_230_862 208
397 3300047471 Ga0495684_0069986 Ga0495684_0069986_2019_2648 208
398 3300048903 Ga0496100_0020374 Ga0496100_0020374_1921_2583 208
399 3300048904 Ga0496101_0021658 Ga0496101_0021658_1765_2427 208
400 3300048905 Ga0496102_0019052 Ga0496102_0019052_5079_5741 208
401 3300048906 Ga0496103_0155536 Ga0496103_0155536_152_814 208
402 3300048907 Ga0496104_0487770 Ga0496104_0487770_325_987 208
403 3300048908 Ga0496105_0208632 Ga0496105_0208632_888_1550 208
404 3300048909 Ga0496106_0000694 Ga0496106_0000694_5573_6235 208
405 3300048910 Ga0496107_0001688 Ga0496107_0001688_5721_6383 208
406 3300048910 Ga0496107_0121443 Ga0496107_0121443_987_1613 208
407 3300048911 Ga0496108_0101477 Ga0496108_0101477_1092_1754 208
408 3300048912 Ga0496109_0034606 Ga0496109_0034606_2159_2821 208
409 3300048913 Ga0496110_0037743 Ga0496110_0037743_2889_3551 208
410 3300048916 Ga0496113_0025468 Ga0496113_0025468_2687_3349 208
411 3300049575 Ga0501039_0226622 Ga0501039_0226622_780_1409 208
412 3300049588 Ga0501072_0342648 Ga0501072_0342648_97_726 208
413 3300049743 Ga0501081_0547440 Ga0501081_0547440_62_694 208
414 3300050507 nmdc:mga05p37_1245_c1 nmdc:mga05p37_1245_c1_3440_4072 208
415 3300050507 nmdc:mga05p37_153899_c1 nmdc:mga05p37_153899_c1_496_1161 208
416 3300050507 nmdc:mga05p37_31244_c1 nmdc:mga05p37_31244_c1_3905_4561 208
417 3300050507 nmdc:mga05p37_35881_c1 nmdc:mga05p37_35881_c1_3834_4463 208
418 3300050507 nmdc:mga05p37_411476_c1 nmdc:mga05p37_411476_c1_831_1481 208
419 3300050507 nmdc:mga05p37_436993_c1 nmdc:mga05p37_436993_c1_181_825 208
420 3300050507 nmdc:mga05p37_459482_c1 nmdc:mga05p37_459482_c1_442_1074 208
421 3300050507 nmdc:mga05p37_86225_c1 nmdc:mga05p37_86225_c1_694_1323 208
422 3300050508 nmdc:mga09592_1617_c1 nmdc:mga09592_1617_c1_6959_7591 208
423 3300050508 nmdc:mga09592_34713_c1 nmdc:mga09592_34713_c1_3564_4190 208
424 3300050509 nmdc:mga0qj67_307321_c1 nmdc:mga0qj67_307321_c1_76_708 208
425 3300050509 nmdc:mga0qj67_320719_c1 nmdc:mga0qj67_320719_c1_551_1180 208
426 3300050509 nmdc:mga0qj67_592357_c1 nmdc:mga0qj67_592357_c1_32_661 208
427 3300050510 nmdc:mga06r32_1276329_c1 nmdc:mga06r32_1276329_c1_28_654 208
428 3300050510 nmdc:mga06r32_228009_c1 nmdc:mga06r32_228009_c1_469_1095 208
429 3300050510 nmdc:mga06r32_596034_c1 nmdc:mga06r32_596034_c1_115_747 208
430 3300050510 nmdc:mga06r32_63558_c1 nmdc:mga06r32_63558_c1_1262_1894 208
431 3300050510 nmdc:mga06r32_7190_c2 nmdc:mga06r32_7190_c2_1661_2290 208
432 3300050511 nmdc:mga08y16_380122_c1 nmdc:mga08y16_380122_c1_257_907 208
433 3300050512 nmdc:mga0n895_266585_c1 nmdc:mga0n895_266585_c1_1101_1727 208
434 3300050512 nmdc:mga0n895_275734_c1 nmdc:mga0n895_275734_c1_82_720 208
435 3300050512 nmdc:mga0n895_281784_c1 nmdc:mga0n895_281784_c1_670_1314 208
436 3300050512 nmdc:mga0n895_338710_c1 nmdc:mga0n895_338710_c1_491_1120 208
437 3300050513 nmdc:mga0rr50_546289_c1 nmdc:mga0rr50_546289_c1_56_682 208
438 3300050513 nmdc:mga0rr50_87998_c1 nmdc:mga0rr50_87998_c1_1489_2118 208
439 3300050515 nmdc:mga0a205_487004_c1 nmdc:mga0a205_487004_c1_260_886 208
440 3300053085 Ga0495619_0059702 Ga0495619_0059702_1717_2343 208
441 3300053085 Ga0495619_0528789 Ga0495619_0528789_57_686 208
442 3300060353 Ga0501082_0372509 Ga0501082_0372509_248_937 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

3

84

0.99

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

92

194

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gn4-assembly1.cif.gz_D h145e mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9567 2 197
1ids-assembly1.cif.gz_C x-ray structure analysis of the iron-dependent superoxide dismutase from mycobacterium tuberculosis at 2.0 angstroms resolutions reveals novel dimer-dimer interactions 0.9563 2 197
1gn6-assembly1.cif.gz_A g152a mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9554 2 197
1gn2-assembly1.cif.gz_A s123c mutant of the iron-superoxide dismutase from mycobacterium tuberculosis. 0.9551 2 197
1gn3-assembly1.cif.gz_A h145q mutant of mycobacterium tuberculosis iron-superoxide dismutase. 0.9517 2 197
ID Description Score Start End Superfamily
1ar4A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9759 21 84 1.10.287.990
1ar5B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9757 21 84 1.10.287.990
1ar4B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9754 21 84 1.10.287.990
1avmB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9749 21 84 1.10.287.990
1idsB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9744 21 84 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A2V6SUL7-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9811 1 141 GO:0004784
GO:0046872
AF-A0A6N7ZP99-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9789 7 123 GO:0004784
GO:0046872
AF-A0A1I7SXX9-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9787 1 122 GO:0004784
GO:0046872
AF-A0A2V6SUL7-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9743 1 141 GO:0004784
GO:0046872
AF-A0A7I7YA92-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9727 1 120 GO:0004784
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.77 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map