F445012

General Info

Members Datasets Scaffolds Average Seq Length
443 260 886 223

Family's Representative Sequence

Representative Sequence 3300003577|Ga0007416J51690_1005421|Ga0007416J51690_10054213
Length 225
Sequence MTSSLLETIQIETAPNPTVSVIWIHGLGADGFDFVPIVRELDLSGCPGIRFIFPHAPTMPVTINGGYVMRAWYDILGLDANLIKHEDEAGLRQSQAAIEALIAQEKSRGIAVDRIVLAGFSQGCAMTLQTGLRHPEKLAGLLCLSGYVPINTTLAAERHAANQNTPIFMAHGRSDPVIPIDRAEKSRDLLKALNYSVEWREYMMQHAVCPEEIDDISAWLKRVLK

Samples

Sample ID Description Type Environment
1 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
98 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
204 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
228 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
233 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
234 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
235 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
236 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
237 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
238 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
239 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
240 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
241 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
242 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
243 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
244 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
245 2842733646 Variovorax sp. R-72446 Isolate Unclassified
246 2842747753 Variovorax sp. R-72060 Isolate Unclassified
247 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
248 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
249 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
250 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
251 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
252 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
253 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
254 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
255 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
256 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
257 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
258 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
259 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
260 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.55
Metatranscriptomes 0.9
Isolates 6.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.13
Nodule 1.35
Rhizoplane 3.84
Rhizosphere 76.3
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007416J51690_1005421 3300003577 Bacteria 2370
2 JGI25155J39150_1000499 3300002704 Bacteria 9484
3 JGI25155J39150_1000613 3300002704 Bacteria 7499
4 JGI25156J39149_1000099 3300002705 Bacteria 63582
5 JGI25156J39149_1004652 3300002705 Bacteria 4126
6 JGI25154J39366_1000119 3300002738 Bacteria 63565
7 JGI25154J39366_1000400 3300002738 Bacteria 23688
8 JGI25157J39369_1000094 3300002741 Bacteria 76378
9 JGI25159J45721_1001130 3300002987 Bacteria 11398
10 JGI26129J50193_1006685 3300003349 Bacteria 829
11 Ga0032354_1024932 3300003693 Bacteria 2230
12 Ga0055538_1000002 3300003751 Bacteria 999437
13 Ga0055539_1000002 3300003752 Bacteria 999437
14 Ga0055533_1000004 3300003756 Bacteria 999437
15 Ga0055532_1000017 3300003758 Bacteria 306880
16 Ga0055525_1000002 3300003759 Bacteria 999437
17 Ga0055535_1008038 3300003761 Bacteria 1944
18 Ga0055526_1000551 3300003771 Bacteria 29633
19 Ga0055537_1000144 3300003773 Bacteria 53397
20 Ga0055524_1001058 3300003775 Bacteria 16973
21 Ga0055534_1000072 3300003784 Bacteria 78212
22 Ga0055541_1000043 3300003841 Bacteria 161703
23 JGI25405J52794_10028229 3300003911 Bacteria 1158
24 Ga0055543_1006392 3300004625 Bacteria 2854
25 Ga0065165_1000187 3300005262 Bacteria 108694
26 Ga0070689_100971273 3300005340 Unclassified 754
27 Ga0070691_10033620 3300005341 Bacteria 2413
28 Ga0070700_100579549 3300005441 Bacteria 876
29 Ga0070694_100003620 3300005444 Bacteria 9230
30 Ga0070708_100069199 3300005445 Bacteria 3174
31 Ga0070662_100074119 3300005457 Bacteria 2517
32 Ga0070706_100143706 3300005467 Bacteria 2228
33 Ga0070707_100036559 3300005468 Bacteria 4685
34 Ga0070707_100216591 3300005468 Bacteria 1866
35 Ga0070699_100312984 3300005518 Bacteria 1410
36 Ga0070695_100000850 3300005545 Bacteria 16445
37 Ga0070696_100319498 3300005546 Bacteria 1194
38 Ga0068855_100000065 3300005563 Bacteria 129307
39 Ga0068855_100120477 3300005563 Bacteria 3003
40 Ga0068855_100200455 3300005563 Bacteria 2247
41 Ga0068857_100973332 3300005577 Bacteria 816
42 Ga0068856_100036672 3300005614 Bacteria 4808
43 Ga0068852_100015967 3300005616 Bacteria 5845
44 Ga0068860_100633699 3300005843 Bacteria 1076
45 Ga0081455_10000772 3300005937 Bacteria 41282
46 Ga0070717_10163890 3300006028 Bacteria 1930
47 Ga0075432_10048015 3300006058 Bacteria 1501
48 Ga0075430_100000248 3300006846 Bacteria 37345
49 Ga0075430_100114872 3300006846 Bacteria 2243
50 Ga0075431_100001170 3300006847 Bacteria 23654
51 Ga0075433_10009036 3300006852 Bacteria 7959
52 Ga0075434_100038098 3300006871 Bacteria 4762
53 Ga0075429_100000001 3300006880 Bacteria 139031
54 Ga0075436_100030092 3300006914 Bacteria 3736
55 Ga0079104_1008855 3300006946 Bacteria 3464
56 Ga0099826_10000003 3300006948 Bacteria 1067817
57 Ga0075435_100394492 3300007076 Bacteria 1190
58 Ga0105240_10001581 3300009093 Bacteria 38647
59 Ga0105240_10020891 3300009093 Bacteria 8720
60 Ga0111539_10115138 3300009094 Bacteria 3153
61 Ga0114129_10042384 3300009147 Bacteria 6410
62 Ga0114129_10058813 3300009147 Bacteria 5376
63 Ga0105237_10001959 3300009545 Bacteria 26205
64 Ga0105238_10051101 3300009551 Bacteria 4159
65 Ga0105238_10253471 3300009551 Bacteria 1739
66 Ga0157373_10108265 3300013100 Bacteria 1954
67 Ga0157371_10000001 3300013102 Bacteria 1162285
68 Ga0157371_10094454 3300013102 Bacteria 2119
69 Ga0163162_10154394 3300013306 Bacteria 2415
70 Ga0157372_10683434 3300013307 Bacteria 1195
71 Ga0182008_10055026 3300014497 Bacteria 1968
72 Ga0182006_1020047 3300015261 Bacteria 2806
73 Ga0182006_1022364 3300015261 Bacteria 2629
74 Ga0213872_10000494 3300021361 Bacteria 31496
75 Ga0213872_10002525 3300021361 Bacteria 10669
76 Ga0209435_100015 3300025206 Bacteria 321177
77 Ga0209435_100112 3300025206 Bacteria 31239
78 Ga0209436_122600 3300025208 Bacteria 807
79 Ga0209784_100002 3300025224 Bacteria 1753105
80 Ga0209566_100003 3300025225 Bacteria 1753105
81 Ga0209674_100004 3300025226 Bacteria 1753105
82 Ga0209147_100004 3300025229 Bacteria 1371850
83 Ga0209563_100006 3300025230 Bacteria 1753105
84 Ga0209437_100045 3300025233 Bacteria 429809
85 Ga0209258_100304 3300025242 Bacteria 79331
86 Ga0209646_1000020 3300025246 Bacteria 462204
87 Ga0209646_1000040 3300025246 Bacteria 347867
88 Ga0209026_1000034 3300025250 Bacteria 306953
89 Ga0209026_1004103 3300025250 Bacteria 4481
90 Ga0209677_100003 3300025253 Bacteria 1753105
91 Ga0209759_1000049 3300025256 Bacteria 221692
92 Ga0209759_1000073 3300025256 Bacteria 178048
93 Ga0209565_1000006 3300025263 Bacteria 897294
94 Ga0209565_1003538 3300025263 Bacteria 5008
95 Ga0209455_1000350 3300025272 Bacteria 43198
96 Ga0209673_1000004 3300025273 Bacteria 896155
97 Ga0209130_1000191 3300025284 Bacteria 85239
98 Ga0209675_1000006 3300025291 Bacteria 732267
99 Ga0209564_1000085 3300025295 Bacteria 251509
100 Ga0209564_1007682 3300025295 Bacteria 5500
101 Ga0209256_1000013 3300025299 Bacteria 689442
102 Ga0209256_1000037 3300025299 Bacteria 377661
103 Ga0207699_10324463 3300025906 Bacteria 1081
104 Ga0207695_10018109 3300025913 Bacteria 8152
105 Ga0207695_10059018 3300025913 Bacteria 3981
106 Ga0207695_10482755 3300025913 Bacteria 1121
107 Ga0207671_10111343 3300025914 Bacteria 2083
108 Ga0207646_10035734 3300025922 Bacteria 4486
109 Ga0207681_10033486 3300025923 Bacteria 3369
110 Ga0207694_10031761 3300025924 Bacteria 4036
111 Ga0207694_10175030 3300025924 Bacteria 1739
112 Ga0207665_10164251 3300025939 Bacteria 1599
113 Ga0207665_10604369 3300025939 Bacteria 857
114 Ga0207667_10000025 3300025949 Bacteria 350159
115 Ga0207667_10026840 3300025949 Bacteria 6284
116 Ga0207698_10009580 3300026142 Bacteria 6185
117 Ga0209996_1000820 3300027395 Bacteria 3661
118 Ga0209995_1001611 3300027471 Bacteria 3502
119 Ga0209968_1002446 3300027526 Bacteria 2805
120 Ga0209970_1000203 3300027614 Bacteria 9442
121 Ga0209983_1000045 3300027665 Bacteria 17797
122 Ga0209282_1000002 3300027666 Bacteria 1067825
123 Ga0209971_1000557 3300027682 Bacteria 9744
124 Ga0209966_1000971 3300027695 Bacteria 5348
125 Ga0209998_10000460 3300027717 Bacteria 11281
126 Ga0268264_10398493 3300028381 Bacteria 1322
127 Ga0307513_10009051 3300031456 Bacteria 12629
128 Ga0307509_10518888 3300031507 Bacteria 873
129 Ga0307514_10000858 3300031649 Bacteria 48560
130 Ga0395900_0140268 3300037418 Bacteria 2475
131 Ga0395900_0150911 3300037418 Bacteria 2374
132 Ga0395901_0424154 3300038443 Bacteria 1363
133 Ga0436361_0062839 3300039447 Bacteria 58101
134 Ga0436361_0240489 3300039447 Bacteria 17218
135 Ga0450904_000071 3300042139 Bacteria 22967
136 Ga0439464_0003320 3300042439 Bacteria 4051
137 Ga0439460_0004749 3300042461 Bacteria 3315
138 Ga0451577_0179639 3300042876 Bacteria 1908
139 Ga0451577_0273551 3300042876 Bacteria 1530
140 Ga0466970_0007410 3300044765 Bacteria 5497
141 Ga0466957_0459443 3300044842 Bacteria 878
142 Ga0466959_0003015 3300045049 Bacteria 10879
143 Ga0451576_0489914 3300045051 Bacteria 1291
144 Ga0451576_1172676 3300045051 Bacteria 803
145 Ga0495617_000099 3300046452 Bacteria 62284
146 Ga0495617_002331 3300046452 Bacteria 7627
147 Ga0495627_012539 3300046453 Bacteria 3003
148 Ga0495629_0003492 3300046459 Bacteria 11889
149 Ga0495638_0002124 3300046460 Bacteria 16695
150 Ga0495638_0110726 3300046460 Bacteria 1631
151 Ga0495653_0032278 3300046463 Bacteria 4159
152 Ga0495582_0007532 3300046473 Bacteria 6021
153 Ga0495605_0011200 3300046474 Bacteria 5008
154 Ga0495605_0015104 3300046474 Bacteria 4210
155 Ga0495584_0000011 3300046491 Bacteria 208322
156 Ga0495584_0001797 3300046491 Bacteria 12472
157 Ga0495584_0003654 3300046491 Bacteria 8389
158 Ga0495585_0000078 3300046492 Bacteria 100168
159 Ga0495585_0000379 3300046492 Bacteria 42623
160 Ga0495585_0001869 3300046492 Bacteria 15892
161 Ga0495585_0005204 3300046492 Bacteria 8243
162 Ga0495585_0011231 3300046492 Bacteria 5305
163 Ga0495585_0022031 3300046492 Bacteria 3657
164 Ga0495585_0051564 3300046492 Bacteria 2279
165 Ga0495585_0059904 3300046492 Bacteria 2096
166 Ga0495585_0086974 3300046492 Bacteria 1687
167 Ga0495585_0113452 3300046492 Bacteria 1439
168 Ga0495585_0142666 3300046492 Bacteria 1253
169 Ga0495585_0152600 3300046492 Bacteria 1203
170 Ga0495585_0165458 3300046492 Bacteria 1145
171 Ga0495594_0254866 3300046499 Bacteria 999
172 Ga0495596_0000101 3300046500 Bacteria 60820
173 Ga0495596_0001565 3300046500 Bacteria 13035
174 Ga0495596_0024461 3300046500 Bacteria 2444
175 Ga0495607_0002672 3300046501 Bacteria 14254
176 Ga0495607_0065602 3300046501 Bacteria 2046
177 Ga0495607_0098672 3300046501 Bacteria 1568
178 Ga0495607_0113701 3300046501 Bacteria 1431
179 Ga0495607_0222125 3300046501 Bacteria 923
180 Ga0495583_0000004 3300046506 Bacteria 655287
181 Ga0495583_0000193 3300046506 Bacteria 101909
182 Ga0495583_0000430 3300046506 Bacteria 63194
183 Ga0495583_0000801 3300046506 Bacteria 38811
184 Ga0495583_0005833 3300046506 Bacteria 8222
185 Ga0495583_0127552 3300046506 Bacteria 1066
186 Ga0495583_0188901 3300046506 Bacteria 841
187 Ga0495606_0000007 3300046507 Bacteria 323713
188 Ga0495606_0002401 3300046507 Bacteria 21883
189 Ga0495606_0005464 3300046507 Bacteria 12166
190 Ga0495606_0016550 3300046507 Bacteria 5615
191 Ga0495606_0052266 3300046507 Bacteria 2658
192 Ga0495610_0030838 3300046512 Bacteria 2803
193 Ga0495616_0000103 3300046513 Bacteria 73155
194 Ga0495616_0000268 3300046513 Bacteria 42201
195 Ga0495616_0090789 3300046513 Bacteria 1446
196 Ga0495616_0152949 3300046513 Bacteria 1042
197 Ga0495620_0000960 3300046515 Bacteria 17763
198 Ga0495630_0100714 3300046517 Bacteria 2185
199 Ga0495631_0006824 3300046518 Bacteria 5859
200 Ga0495631_0019083 3300046518 Bacteria 3219
201 Ga0495631_0131267 3300046518 Bacteria 1076
202 Ga0495632_0062838 3300046519 Bacteria 1799
203 Ga0495637_0033733 3300046520 Bacteria 2246
204 Ga0495637_0039841 3300046520 Bacteria 2025
205 Ga0495643_0000192 3300046522 Bacteria 96511
206 Ga0495643_0023102 3300046522 Bacteria 3538
207 Ga0495643_0061343 3300046522 Bacteria 1994
208 Ga0495643_0095334 3300046522 Bacteria 1530
209 Ga0495643_0138781 3300046522 Bacteria 1214
210 Ga0495644_0001032 3300046523 Bacteria 11593
211 Ga0495644_0004002 3300046523 Bacteria 5796
212 Ga0495644_0031655 3300046523 Bacteria 1999
213 Ga0495644_0036492 3300046523 Bacteria 1854
214 Ga0495644_0087121 3300046523 Bacteria 1177
215 Ga0495644_0119620 3300046523 Bacteria 1001
216 Ga0495648_0000155 3300046524 Bacteria 81384
217 Ga0495648_0012027 3300046524 Bacteria 6484
218 Ga0495648_0012412 3300046524 Bacteria 6360
219 Ga0495648_0140119 3300046524 Bacteria 1274
220 Ga0495648_0161113 3300046524 Bacteria 1160
221 Ga0495663_0009236 3300046525 Bacteria 2735
222 Ga0495663_0099892 3300046525 Bacteria 954
223 Ga0495666_0112760 3300046526 Bacteria 1276
224 Ga0495642_0000799 3300046528 Bacteria 15291
225 Ga0495642_0001346 3300046528 Bacteria 11005
226 Ga0495642_0011091 3300046528 Bacteria 3456
227 Ga0495642_0074830 3300046528 Bacteria 1420
228 Ga0495642_0129942 3300046528 Bacteria 1084
229 Ga0495642_0162563 3300046528 Bacteria 968
230 Ga0495652_0069160 3300046529 Bacteria 2956
231 Ga0495654_0001375 3300046530 Bacteria 16863
232 Ga0495586_0142952 3300046535 Bacteria 1343
233 Ga0495586_0269334 3300046535 Bacteria 973
234 Ga0495609_0003205 3300046538 Bacteria 9498
235 Ga0495609_0010539 3300046538 Bacteria 4432
236 Ga0495609_0022122 3300046538 Bacteria 2930
237 Ga0495609_0065165 3300046538 Bacteria 1606
238 Ga0495609_0136568 3300046538 Bacteria 1048
239 Ga0495621_0000356 3300046539 Bacteria 11142
240 Ga0495597_0002644 3300046542 Bacteria 11109
241 Ga0495597_0022390 3300046542 Bacteria 2931
242 Ga0495597_0042478 3300046542 Bacteria 2027
243 Ga0495622_0000032 3300046557 Bacteria 125538
244 Ga0495622_0020539 3300046557 Bacteria 3075
245 Ga0495622_0093737 3300046557 Bacteria 1378
246 Ga0495622_0166392 3300046557 Bacteria 993
247 Ga0495633_0008342 3300046558 Bacteria 5849
248 Ga0495633_0019124 3300046558 Bacteria 3466
249 Ga0495633_0026409 3300046558 Bacteria 2850
250 Ga0495633_0055813 3300046558 Bacteria 1856
251 Ga0495633_0138553 3300046558 Bacteria 1125
252 Ga0495633_0168889 3300046558 Bacteria 1008
253 Ga0495633_0178202 3300046558 Bacteria 978
254 Ga0495656_0039323 3300046615 Bacteria 1964
255 Ga0495656_0055946 3300046615 Bacteria 1703
256 Ga0495668_0000008 3300046616 Bacteria 498364
257 Ga0495668_0003742 3300046616 Bacteria 11163
258 Ga0495668_0019598 3300046616 Bacteria 3897
259 Ga0495668_0239654 3300046616 Bacteria 993
260 Ga0495634_0029776 3300046642 Bacteria 3778
261 Ga0495611_0001444 3300046648 Bacteria 11809
262 Ga0495611_0008184 3300046648 Bacteria 4436
263 Ga0495611_0025758 3300046648 Bacteria 2565
264 Ga0495611_0088200 3300046648 Bacteria 1432
265 Ga0495611_0108454 3300046648 Bacteria 1291
266 Ga0495611_0149057 3300046648 Bacteria 1092
267 Ga0495625_0000473 3300046660 Bacteria 60605
268 Ga0495625_0006078 3300046660 Bacteria 10833
269 Ga0495625_0029345 3300046660 Bacteria 4115
270 Ga0495625_0052693 3300046660 Bacteria 2912
271 Ga0495625_0100811 3300046660 Bacteria 1984
272 Ga0495635_0152040 3300046663 Bacteria 1576
273 Ga0495659_0018818 3300046664 Bacteria 2305
274 Ga0495659_0055342 3300046664 Bacteria 1454
275 Ga0495661_0006974 3300046665 Bacteria 7898
276 Ga0495661_0022920 3300046665 Bacteria 4058
277 Ga0495661_0044959 3300046665 Bacteria 2703
278 Ga0495661_0069974 3300046665 Bacteria 2055
279 Ga0495661_0121326 3300046665 Bacteria 1444
280 Ga0495588_0073291 3300046674 Bacteria 1782
281 Ga0495623_0068908 3300046679 Bacteria 2205
282 Ga0495669_0000615 3300046684 Bacteria 15534
283 Ga0495624_0101626 3300046690 Bacteria 1770
284 Ga0495670_0004457 3300046691 Bacteria 6872
285 Ga0495670_0030478 3300046691 Bacteria 2679
286 Ga0495670_0037755 3300046691 Bacteria 2408
287 Ga0495670_0068891 3300046691 Bacteria 1788
288 Ga0495670_0072175 3300046691 Bacteria 1748
289 Ga0495670_0121006 3300046691 Bacteria 1359
290 Ga0495670_0280280 3300046691 Bacteria 891
291 Ga0495671_0014984 3300046692 Bacteria 4165
292 Ga0495671_0021738 3300046692 Bacteria 3366
293 Ga0495649_0090263 3300046694 Bacteria 1634
294 Ga0495649_0187397 3300046694 Bacteria 1078
295 Ga0495589_0025377 3300046794 Bacteria 3008
296 Ga0495589_0104296 3300046794 Bacteria 1370
297 Ga0495660_0020891 3300046810 Bacteria 3753
298 Ga0495581_0033960 3300047315 Bacteria 2952
299 Ga0495581_0177429 3300047315 Bacteria 1245
300 Ga0495604_0001907 3300047317 Bacteria 16899
301 Ga0495636_0023755 3300047318 Bacteria 2483
302 Ga0495636_0032120 3300047318 Bacteria 2153
303 Ga0495636_0035724 3300047318 Bacteria 2047
304 Ga0495636_0128679 3300047318 Bacteria 1125
305 Ga0495636_0142012 3300047318 Bacteria 1073
306 Ga0495674_0137955 3300047319 Bacteria 2051
307 Ga0495672_0016602 3300047320 Bacteria 4954
308 Ga0495672_0030193 3300047320 Bacteria 3404
309 Ga0495676_0027153 3300047321 Bacteria 4914
310 Ga0495676_0248695 3300047321 Bacteria 1214
311 Ga0495683_0005838 3300047323 Bacteria 6771
312 Ga0495683_0015667 3300047323 Bacteria 3939
313 Ga0495683_0033030 3300047323 Bacteria 2635
314 Ga0495683_0049217 3300047323 Bacteria 2111
315 Ga0495683_0082622 3300047323 Bacteria 1565
316 Ga0495683_0082762 3300047323 Bacteria 1563
317 Ga0495687_024827 3300047443 Bacteria 2843
318 Ga0495675_0009752 3300047444 Bacteria 5988
319 Ga0495675_0291749 3300047444 Bacteria 970
320 Ga0495677_0008212 3300047445 Bacteria 3879
321 Ga0495677_0008355 3300047445 Bacteria 3848
322 Ga0495677_0014949 3300047445 Bacteria 2822
323 Ga0495677_0029699 3300047445 Bacteria 1988
324 Ga0495677_0033460 3300047445 Bacteria 1874
325 Ga0495677_0037939 3300047445 Bacteria 1760
326 Ga0495685_000696 3300047447 Bacteria 10278
327 Ga0495685_028447 3300047447 Bacteria 1922
328 Ga0495685_086961 3300047447 Bacteria 1037
329 Ga0495673_0037369 3300047469 Bacteria 2217
330 Ga0495681_0033329 3300047470 Bacteria 2581
331 Ga0495681_0075557 3300047470 Bacteria 1516
332 Ga0495681_0076811 3300047470 Bacteria 1500
333 Ga0495686_0000740 3300047472 Bacteria 43603
334 Ga0495686_0082757 3300047472 Bacteria 1958
335 Ga0495686_0110941 3300047472 Bacteria 1645
336 Ga0495686_0159975 3300047472 Bacteria 1316
337 Ga0495686_0312868 3300047472 Bacteria 863
338 Ga0495593_0005932 3300047673 Bacteria 7196
339 Ga0495593_0035966 3300047673 Bacteria 2686
340 Ga0495615_0023219 3300048090 Bacteria 1419
341 Ga0495626_0002918 3300048091 Bacteria 11392
342 Ga0495626_0007825 3300048091 Bacteria 5920
343 Ga0495626_0009747 3300048091 Bacteria 5176
344 Ga0495626_0097153 3300048091 Bacteria 1288
345 Ga0496101_0052201 3300048904 Bacteria 2948
346 Ga0496102_0000253 3300048905 Bacteria 69634
347 Ga0496102_0080774 3300048905 Bacteria 2996
348 Ga0496103_0012952 3300048906 Bacteria 4947
349 Ga0496103_0015094 3300048906 Bacteria 4591
350 Ga0496103_0142004 3300048906 Bacteria 1536
351 Ga0496104_0346135 3300048907 Bacteria 1399
352 Ga0496104_0416781 3300048907 Bacteria 1255
353 Ga0496105_0667820 3300048908 Bacteria 800
354 Ga0496106_0342831 3300048909 Bacteria 1200
355 Ga0496108_0192738 3300048911 Bacteria 1767
356 Ga0496110_0025496 3300048913 Bacteria 5053
357 Ga0496110_0111531 3300048913 Bacteria 2458
358 Ga0496111_0017436 3300048914 Bacteria 4965
359 Ga0496114_0097566 3300048917 Bacteria 2504
360 Ga0496115_0001802 3300048918 Bacteria 15343
361 Ga0496115_0483435 3300048918 Bacteria 997
362 Ga0496116_0022030 3300048919 Bacteria 4791
363 Ga0496118_0122349 3300048921 Bacteria 1693
364 Ga0496118_0229126 3300048921 Bacteria 1074
365 Ga0496121_0017456 3300048924 Bacteria 7332
366 Ga0496122_0000449 3300048925 Bacteria 85961
367 Ga0496122_0001512 3300048925 Bacteria 37063
368 Ga0496123_0000263 3300048926 Bacteria 105886
369 Ga0496123_0001219 3300048926 Bacteria 37517
370 Ga0496123_0073114 3300048926 Bacteria 2129
371 Ga0496124_0010320 3300048927 Bacteria 9477
372 Ga0496125_0001541 3300048928 Bacteria 32972
373 Ga0496125_0030365 3300048928 Bacteria 4836
374 Ga0495678_028990 3300049459 Bacteria 2329
375 Ga0495682_0000197 3300049460 Bacteria 48575
376 Ga0495682_0000369 3300049460 Bacteria 32675
377 Ga0495682_0011252 3300049460 Bacteria 3444
378 Ga0495682_0110718 3300049460 Bacteria 984
379 Ga0495682_0136788 3300049460 Bacteria 875
380 Ga0501033_0249260 3300049570 Bacteria 1259
381 Ga0501034_0541582 3300049571 Bacteria 1074
382 Ga0501037_0033437 3300049573 Bacteria 3798
383 Ga0501042_0263612 3300049578 Bacteria 1244
384 Ga0501047_0028927 3300049581 Bacteria 5345
385 Ga0501069_0000120 3300049585 Bacteria 34758
386 Ga0501069_0009605 3300049585 Bacteria 5108
387 Ga0501073_0019407 3300049589 Bacteria 4909
388 Ga0501074_0326990 3300049590 Bacteria 1088
389 Ga0501075_0047809 3300049591 Bacteria 3215
390 Ga0501075_0301169 3300049591 Bacteria 1222
391 Ga0501238_005625 3300049671 Bacteria 1595
392 Ga0501079_0088752 3300049741 Bacteria 2394
393 Ga0501080_0395686 3300049742 Bacteria 1243
394 Ga0501035_0061211 3300049822 Bacteria 3351
395 Ga0501035_0160872 3300049822 Bacteria 1943
396 Ga0501044_0061946 3300049823 Bacteria 3826
397 nmdc:mga05p37_398728_c1 3300050507 Bacteria 1607
398 nmdc:mga05p37_6716_c1 3300050507 Bacteria 13561
399 nmdc:mga09592_10197_c1 3300050508 Bacteria 7647
400 nmdc:mga0qj67_409124_c1 3300050509 Bacteria 1094
401 nmdc:mga06r32_1957_c1 3300050510 Bacteria 18373
402 nmdc:mga0n895_189522_c1 3300050512 Bacteria 2088
403 nmdc:mga0rr50_630627_c1 3300050513 Bacteria 914
404 nmdc:mga0rr50_96904_c1 3300050513 Bacteria 2309
405 nmdc:mga08x19_135870_c1 3300050514 Bacteria 1658
406 nmdc:mga08x19_93203_c1 3300050514 Bacteria 1991
407 nmdc:mga0a205_21051_c1 3300050515 Bacteria 6166
408 Ga0500618_000376 3300053125 Bacteria 30780
409 Ga0500618_007062 3300053125 Bacteria 3236
410 Ga0500618_010325 3300053125 Bacteria 2509
411 Ga0587082_018112 3300059504 Bacteria 1117
412 Ga0587111_0022659 3300060346 Bacteria 1222
413 Ga0501082_0189319 3300060353 Bacteria 1790
414 Ga0530510_0179010 3300061734 Bacteria 1572
415 2511250128 2511231003 Bacteria 5606035
416 2511388070 2511231026 Bacteria 5225445
417 2521557811 2521172590 Bacteria 5047645
418 2550693656 2548876994 Bacteria 4904866
419 2553002931 2551306416 Bacteria 6152985
420 2739610572 2739367655 Bacteria 4051151
421 2765568924 2765235838 Bacteria 5445269
422 2808984556 2808606386 Bacteria 4471946
423 2809128113 2808606415 Bacteria 4576710
424 2809151850 2808606419 Bacteria 4576925
425 2819592108 2818991445 Bacteria 4955017
426 2819615047 2818991449 Bacteria 5518009
427 2839096194 2839094727 Bacteria 5534556
428 2842735720 2842733646 Bacteria 5716726
429 2842750881 2842747753 Bacteria 5578255
430 2852619934 2852618963 Bacteria 4577824
431 2884815105 2884811622 Bacteria 5552861
432 2884840473 2884836552 Bacteria 5219991
433 2884855730 2884852848 Bacteria 5221161
434 2896157345 2896154374 Bacteria 5221518
435 2904441428 2904439833 Bacteria 5931679
436 2904531634 2904530477 Bacteria 5876334
437 2904586726 2904584206 Bacteria 6028872
438 2904593241 2904589729 Bacteria 6113573
439 2904602915 2904601388 Bacteria 5884906
440 2919046274 2919046199 Bacteria 5567169
441 2919084064 2919079590 Bacteria 5946433
442 2923511029 2923510766 Bacteria 5926163
443 2928130981 2928130867 Bacteria 5467269
444 Ga0007416J51690_1005421
445 JGI25155J39150_1000499
446 JGI25155J39150_1000613
447 JGI25156J39149_1000099
448 JGI25156J39149_1004652
449 JGI25154J39366_1000119
450 JGI25154J39366_1000400
451 JGI25157J39369_1000094
452 JGI25159J45721_1001130
453 JGI26129J50193_1006685
454 Ga0032354_1024932
455 Ga0055538_1000002
456 Ga0055539_1000002
457 Ga0055533_1000004
458 Ga0055532_1000017
459 Ga0055525_1000002
460 Ga0055535_1008038
461 Ga0055526_1000551
462 Ga0055537_1000144
463 Ga0055524_1001058
464 Ga0055534_1000072
465 Ga0055541_1000043
466 JGI25405J52794_10028229
467 Ga0055543_1006392
468 Ga0065165_1000187
469 Ga0070689_100971273
470 Ga0070691_10033620
471 Ga0070700_100579549
472 Ga0070694_100003620
473 Ga0070708_100069199
474 Ga0070662_100074119
475 Ga0070706_100143706
476 Ga0070707_100036559
477 Ga0070707_100216591
478 Ga0070699_100312984
479 Ga0070695_100000850
480 Ga0070696_100319498
481 Ga0068855_100000065
482 Ga0068855_100120477
483 Ga0068855_100200455
484 Ga0068857_100973332
485 Ga0068856_100036672
486 Ga0068852_100015967
487 Ga0068860_100633699
488 Ga0081455_10000772
489 Ga0070717_10163890
490 Ga0075432_10048015
491 Ga0075430_100000248
492 Ga0075430_100114872
493 Ga0075431_100001170
494 Ga0075433_10009036
495 Ga0075434_100038098
496 Ga0075429_100000001
497 Ga0075436_100030092
498 Ga0079104_1008855
499 Ga0099826_10000003
500 Ga0075435_100394492
501 Ga0105240_10001581
502 Ga0105240_10020891
503 Ga0111539_10115138
504 Ga0114129_10042384
505 Ga0114129_10058813
506 Ga0105237_10001959
507 Ga0105238_10051101
508 Ga0105238_10253471
509 Ga0157373_10108265
510 Ga0157371_10000001
511 Ga0157371_10094454
512 Ga0163162_10154394
513 Ga0157372_10683434
514 Ga0182008_10055026
515 Ga0182006_1020047
516 Ga0182006_1022364
517 Ga0213872_10000494
518 Ga0213872_10002525
519 Ga0209435_100015
520 Ga0209435_100112
521 Ga0209436_122600
522 Ga0209784_100002
523 Ga0209566_100003
524 Ga0209674_100004
525 Ga0209147_100004
526 Ga0209563_100006
527 Ga0209437_100045
528 Ga0209258_100304
529 Ga0209646_1000020
530 Ga0209646_1000040
531 Ga0209026_1000034
532 Ga0209026_1004103
533 Ga0209677_100003
534 Ga0209759_1000049
535 Ga0209759_1000073
536 Ga0209565_1000006
537 Ga0209565_1003538
538 Ga0209455_1000350
539 Ga0209673_1000004
540 Ga0209130_1000191
541 Ga0209675_1000006
542 Ga0209564_1000085
543 Ga0209564_1007682
544 Ga0209256_1000013
545 Ga0209256_1000037
546 Ga0207699_10324463
547 Ga0207695_10018109
548 Ga0207695_10059018
549 Ga0207695_10482755
550 Ga0207671_10111343
551 Ga0207646_10035734
552 Ga0207681_10033486
553 Ga0207694_10031761
554 Ga0207694_10175030
555 Ga0207665_10164251
556 Ga0207665_10604369
557 Ga0207667_10000025
558 Ga0207667_10026840
559 Ga0207698_10009580
560 Ga0209996_1000820
561 Ga0209995_1001611
562 Ga0209968_1002446
563 Ga0209970_1000203
564 Ga0209983_1000045
565 Ga0209282_1000002
566 Ga0209971_1000557
567 Ga0209966_1000971
568 Ga0209998_10000460
569 Ga0268264_10398493
570 Ga0307513_10009051
571 Ga0307509_10518888
572 Ga0307514_10000858
573 Ga0395900_0140268
574 Ga0395900_0150911
575 Ga0395901_0424154
576 Ga0436361_0062839
577 Ga0436361_0240489
578 Ga0450904_000071
579 Ga0439464_0003320
580 Ga0439460_0004749
581 Ga0451577_0179639
582 Ga0451577_0273551
583 Ga0466970_0007410
584 Ga0466957_0459443
585 Ga0466959_0003015
586 Ga0451576_0489914
587 Ga0451576_1172676
588 Ga0495617_000099
589 Ga0495617_002331
590 Ga0495627_012539
591 Ga0495629_0003492
592 Ga0495638_0002124
593 Ga0495638_0110726
594 Ga0495653_0032278
595 Ga0495582_0007532
596 Ga0495605_0011200
597 Ga0495605_0015104
598 Ga0495584_0000011
599 Ga0495584_0001797
600 Ga0495584_0003654
601 Ga0495585_0000078
602 Ga0495585_0000379
603 Ga0495585_0001869
604 Ga0495585_0005204
605 Ga0495585_0011231
606 Ga0495585_0022031
607 Ga0495585_0051564
608 Ga0495585_0059904
609 Ga0495585_0086974
610 Ga0495585_0113452
611 Ga0495585_0142666
612 Ga0495585_0152600
613 Ga0495585_0165458
614 Ga0495594_0254866
615 Ga0495596_0000101
616 Ga0495596_0001565
617 Ga0495596_0024461
618 Ga0495607_0002672
619 Ga0495607_0065602
620 Ga0495607_0098672
621 Ga0495607_0113701
622 Ga0495607_0222125
623 Ga0495583_0000004
624 Ga0495583_0000193
625 Ga0495583_0000430
626 Ga0495583_0000801
627 Ga0495583_0005833
628 Ga0495583_0127552
629 Ga0495583_0188901
630 Ga0495606_0000007
631 Ga0495606_0002401
632 Ga0495606_0005464
633 Ga0495606_0016550
634 Ga0495606_0052266
635 Ga0495610_0030838
636 Ga0495616_0000103
637 Ga0495616_0000268
638 Ga0495616_0090789
639 Ga0495616_0152949
640 Ga0495620_0000960
641 Ga0495630_0100714
642 Ga0495631_0006824
643 Ga0495631_0019083
644 Ga0495631_0131267
645 Ga0495632_0062838
646 Ga0495637_0033733
647 Ga0495637_0039841
648 Ga0495643_0000192
649 Ga0495643_0023102
650 Ga0495643_0061343
651 Ga0495643_0095334
652 Ga0495643_0138781
653 Ga0495644_0001032
654 Ga0495644_0004002
655 Ga0495644_0031655
656 Ga0495644_0036492
657 Ga0495644_0087121
658 Ga0495644_0119620
659 Ga0495648_0000155
660 Ga0495648_0012027
661 Ga0495648_0012412
662 Ga0495648_0140119
663 Ga0495648_0161113
664 Ga0495663_0009236
665 Ga0495663_0099892
666 Ga0495666_0112760
667 Ga0495642_0000799
668 Ga0495642_0001346
669 Ga0495642_0011091
670 Ga0495642_0074830
671 Ga0495642_0129942
672 Ga0495642_0162563
673 Ga0495652_0069160
674 Ga0495654_0001375
675 Ga0495586_0142952
676 Ga0495586_0269334
677 Ga0495609_0003205
678 Ga0495609_0010539
679 Ga0495609_0022122
680 Ga0495609_0065165
681 Ga0495609_0136568
682 Ga0495621_0000356
683 Ga0495597_0002644
684 Ga0495597_0022390
685 Ga0495597_0042478
686 Ga0495622_0000032
687 Ga0495622_0020539
688 Ga0495622_0093737
689 Ga0495622_0166392
690 Ga0495633_0008342
691 Ga0495633_0019124
692 Ga0495633_0026409
693 Ga0495633_0055813
694 Ga0495633_0138553
695 Ga0495633_0168889
696 Ga0495633_0178202
697 Ga0495656_0039323
698 Ga0495656_0055946
699 Ga0495668_0000008
700 Ga0495668_0003742
701 Ga0495668_0019598
702 Ga0495668_0239654
703 Ga0495634_0029776
704 Ga0495611_0001444
705 Ga0495611_0008184
706 Ga0495611_0025758
707 Ga0495611_0088200
708 Ga0495611_0108454
709 Ga0495611_0149057
710 Ga0495625_0000473
711 Ga0495625_0006078
712 Ga0495625_0029345
713 Ga0495625_0052693
714 Ga0495625_0100811
715 Ga0495635_0152040
716 Ga0495659_0018818
717 Ga0495659_0055342
718 Ga0495661_0006974
719 Ga0495661_0022920
720 Ga0495661_0044959
721 Ga0495661_0069974
722 Ga0495661_0121326
723 Ga0495588_0073291
724 Ga0495623_0068908
725 Ga0495669_0000615
726 Ga0495624_0101626
727 Ga0495670_0004457
728 Ga0495670_0030478
729 Ga0495670_0037755
730 Ga0495670_0068891
731 Ga0495670_0072175
732 Ga0495670_0121006
733 Ga0495670_0280280
734 Ga0495671_0014984
735 Ga0495671_0021738
736 Ga0495649_0090263
737 Ga0495649_0187397
738 Ga0495589_0025377
739 Ga0495589_0104296
740 Ga0495660_0020891
741 Ga0495581_0033960
742 Ga0495581_0177429
743 Ga0495604_0001907
744 Ga0495636_0023755
745 Ga0495636_0032120
746 Ga0495636_0035724
747 Ga0495636_0128679
748 Ga0495636_0142012
749 Ga0495674_0137955
750 Ga0495672_0016602
751 Ga0495672_0030193
752 Ga0495676_0027153
753 Ga0495676_0248695
754 Ga0495683_0005838
755 Ga0495683_0015667
756 Ga0495683_0033030
757 Ga0495683_0049217
758 Ga0495683_0082622
759 Ga0495683_0082762
760 Ga0495687_024827
761 Ga0495675_0009752
762 Ga0495675_0291749
763 Ga0495677_0008212
764 Ga0495677_0008355
765 Ga0495677_0014949
766 Ga0495677_0029699
767 Ga0495677_0033460
768 Ga0495677_0037939
769 Ga0495685_000696
770 Ga0495685_028447
771 Ga0495685_086961
772 Ga0495673_0037369
773 Ga0495681_0033329
774 Ga0495681_0075557
775 Ga0495681_0076811
776 Ga0495686_0000740
777 Ga0495686_0082757
778 Ga0495686_0110941
779 Ga0495686_0159975
780 Ga0495686_0312868
781 Ga0495593_0005932
782 Ga0495593_0035966
783 Ga0495615_0023219
784 Ga0495626_0002918
785 Ga0495626_0007825
786 Ga0495626_0009747
787 Ga0495626_0097153
788 Ga0496101_0052201
789 Ga0496102_0000253
790 Ga0496102_0080774
791 Ga0496103_0012952
792 Ga0496103_0015094
793 Ga0496103_0142004
794 Ga0496104_0346135
795 Ga0496104_0416781
796 Ga0496105_0667820
797 Ga0496106_0342831
798 Ga0496108_0192738
799 Ga0496110_0025496
800 Ga0496110_0111531
801 Ga0496111_0017436
802 Ga0496114_0097566
803 Ga0496115_0001802
804 Ga0496115_0483435
805 Ga0496116_0022030
806 Ga0496118_0122349
807 Ga0496118_0229126
808 Ga0496121_0017456
809 Ga0496122_0000449
810 Ga0496122_0001512
811 Ga0496123_0000263
812 Ga0496123_0001219
813 Ga0496123_0073114
814 Ga0496124_0010320
815 Ga0496125_0001541
816 Ga0496125_0030365
817 Ga0495678_028990
818 Ga0495682_0000197
819 Ga0495682_0000369
820 Ga0495682_0011252
821 Ga0495682_0110718
822 Ga0495682_0136788
823 Ga0501033_0249260
824 Ga0501034_0541582
825 Ga0501037_0033437
826 Ga0501042_0263612
827 Ga0501047_0028927
828 Ga0501069_0000120
829 Ga0501069_0009605
830 Ga0501073_0019407
831 Ga0501074_0326990
832 Ga0501075_0047809
833 Ga0501075_0301169
834 Ga0501238_005625
835 Ga0501079_0088752
836 Ga0501080_0395686
837 Ga0501035_0061211
838 Ga0501035_0160872
839 Ga0501044_0061946
840 nmdc:mga05p37_398728_c1
841 nmdc:mga05p37_6716_c1
842 nmdc:mga09592_10197_c1
843 nmdc:mga0qj67_409124_c1
844 nmdc:mga06r32_1957_c1
845 nmdc:mga0n895_189522_c1
846 nmdc:mga0rr50_630627_c1
847 nmdc:mga0rr50_96904_c1
848 nmdc:mga08x19_135870_c1
849 nmdc:mga08x19_93203_c1
850 nmdc:mga0a205_21051_c1
851 Ga0500618_000376
852 Ga0500618_007062
853 Ga0500618_010325
854 Ga0587082_018112
855 Ga0587111_0022659
856 Ga0501082_0189319
857 Ga0530510_0179010
858 2511250128
859 2511388070
860 2521557811
861 2550693656
862 2553002931
863 2739610572
864 2765568924
865 2808984556
866 2809128113
867 2809151850
868 2819592108
869 2819615047
870 2839096194
871 2842735720
872 2842750881
873 2852619934
874 2884815105
875 2884840473
876 2884855730
877 2896157345
878 2904441428
879 2904531634
880 2904586726
881 2904593241
882 2904602915
883 2919046274
884 2919084064
885 2923511029
886 2928130981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

7

224

0.92

PF01738

DLH

Dienelactone hydrolase family

76

218

0.81

PF03959

FSH1

Serine hydrolase (FSH1)

21

216

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1aur-assembly1.cif.gz_B pmsf-inhibited carboxylesterase from pseudomonas fluorescens 0.9357 6 223
6bje-assembly1.cif.gz_A crystal structure of lysophospholipase a2 conjugated with phenylmethylsulfonyl fluoride 0.9349 6 224
5syn-assembly3.cif.gz_C cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349 0.9344 6 225
1aur-assembly1.cif.gz_B pmsf-inhibited carboxylesterase from pseudomonas fluorescens 0.9273 6 223
6bje-assembly2.cif.gz_B crystal structure of lysophospholipase a2 conjugated with phenylmethylsulfonyl fluoride 0.9259 6 224
ID Description Score Start End Superfamily
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9352 4 223 3.40.50.1820
af_Q55FK4_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9338 9 225 3.40.50.1820
af_Q54T49_3_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9319 9 225 3.40.50.1820
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.923 4 223 3.40.50.1820
af_Q7XR62_2_223_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9228 14 223 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A522IXL0-F1-model_v4 Carboxylesterase 0.9999 86 223 GO:0016787
AF-A0A7C7G4M2-F1-model_v4 Carboxylesterase 0.9986 118 223 GO:0016787
AF-A0A536YKE2-F1-model_v4 Carboxylesterase 0.9975 127 223 GO:0016787
AF-A0A7C4E9R3-F1-model_v4 Carboxylesterase 0.9967 100 223 GO:0016787
AF-A0A3C1N676-F1-model_v4 Carboxylesterase 0.9944 91 223 GO:0016787

Map