F445032

General Info

Members Datasets Scaffolds Average Seq Length
443 264 886 137

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100355127|Ga0070713_1003551274
Length 158
Sequence MRSWPSSVASNPAAIRPATLIDSCVLLDVITGDQQWADWSAAEIAAAMDTGRAVINPLIYAEVSVGYQTIEELEELLPPGDYEREPLPYLAGFAAGKAFLRYRRGGGDKRSPMPDFYIGAHAAIAGYRLLTRDVRRYRTYFPTIEIIAPPSSPDETAG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
160 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
161 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
244 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
248 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
254 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
255 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
256 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2517572101 Frankia sp. DC12 Isolate Nodule
261 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
262 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
263 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
264 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.9
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7
Nodule 1.13
Rhizoplane 3.61
Rhizosphere 81.49
Stem 0
Stem Tuber 0
Unclassified 16.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100355127 3300005436 Bacteria 1361
2 JGI25159J45721_1012472 3300002987 Bacteria 2025
3 JGI25406J46586_10002426 3300003203 Bacteria 8814
4 JGI25406J46586_10015592 3300003203 Bacteria 3199
5 rootH2_10312604 3300003320 Bacteria 1336
6 JGI25160J50197_1020124 3300003354 Bacteria 2024
7 Ga0055528_1011911 3300003790 Bacteria 3412
8 Ga0065165_1054431 3300005262 Bacteria 1121
9 Ga0070676_10184558 3300005328 Bacteria 1358
10 Ga0070690_100976851 3300005330 Unclassified 666
11 Ga0070682_100167958 3300005337 Bacteria 1522
12 Ga0070682_100334622 3300005337 Bacteria 1123
13 Ga0070689_101115607 3300005340 Bacteria 705
14 Ga0070692_10005051 3300005345 Bacteria 5580
15 Ga0070668_100652201 3300005347 Unclassified 925
16 Ga0070675_100817220 3300005354 Bacteria 852
17 Ga0070674_100003751 3300005356 Bacteria 8572
18 Ga0070674_100251160 3300005356 Bacteria 1389
19 Ga0070673_102247738 3300005364 Bacteria 518
20 Ga0070667_101969062 3300005367 Unclassified 550
21 Ga0070709_10265499 3300005434 Unclassified 1242
22 Ga0070709_10420979 3300005434 Bacteria 1001
23 Ga0070709_10424030 3300005434 Bacteria 997
24 Ga0070714_100023538 3300005435 Bacteria 5063
25 Ga0070714_100055754 3300005435 Bacteria 3379
26 Ga0070714_100109861 3300005435 Unclassified 2440
27 Ga0070714_100116014 3300005435 Bacteria 2377
28 Ga0070714_100638358 3300005435 Unclassified 1024
29 Ga0070714_100750323 3300005435 Bacteria 943
30 Ga0070713_100066871 3300005436 Unclassified 3024
31 Ga0070713_100326729 3300005436 Bacteria 1418
32 Ga0070713_100604108 3300005436 Bacteria 1042
33 Ga0070710_10088496 3300005437 Bacteria 1822
34 Ga0070710_10105820 3300005437 Bacteria 1683
35 Ga0070711_100125632 3300005439 Bacteria 1904
36 Ga0070711_100289651 3300005439 Unclassified 1298
37 Ga0070711_100877482 3300005439 Bacteria 764
38 Ga0070708_100019926 3300005445 Bacteria 5646
39 Ga0070708_100096273 3300005445 Bacteria 2703
40 Ga0070663_100264525 3300005455 Bacteria 1365
41 Ga0070663_100341743 3300005455 Bacteria 1210
42 Ga0070663_100444241 3300005455 Unclassified 1068
43 Ga0070678_100035036 3300005456 Bacteria 3501
44 Ga0070678_101461279 3300005456 Unclassified 639
45 Ga0070662_100478675 3300005457 Bacteria 1036
46 Ga0070681_11252792 3300005458 Bacteria 664
47 Ga0070706_100092898 3300005467 Bacteria 2799
48 Ga0070706_100470451 3300005467 Bacteria 1169
49 Ga0070706_100498760 3300005467 Bacteria 1133
50 Ga0070707_100041488 3300005468 Bacteria 4405
51 Ga0070707_100050770 3300005468 Bacteria 3976
52 Ga0070707_100059833 3300005468 Bacteria 3653
53 Ga0070707_100106690 3300005468 Bacteria 2717
54 Ga0070707_100416089 3300005468 Bacteria 1304
55 Ga0070698_100000159 3300005471 Bacteria 61650
56 Ga0070698_100106383 3300005471 Bacteria 2774
57 Ga0070698_100157368 3300005471 Bacteria 2217
58 Ga0070698_100552521 3300005471 Bacteria 1091
59 Ga0070698_101003956 3300005471 Unclassified 782
60 Ga0070699_100009482 3300005518 Bacteria 8432
61 Ga0070699_100010042 3300005518 Bacteria 8194
62 Ga0070699_100668274 3300005518 Bacteria 948
63 Ga0070679_100014554 3300005530 Bacteria 7558
64 Ga0070679_100272088 3300005530 Bacteria 1648
65 Ga0070684_100065683 3300005535 Bacteria 3185
66 Ga0070697_100270679 3300005536 Bacteria 1456
67 Ga0068853_100041279 3300005539 Bacteria 3940
68 Ga0068853_101952825 3300005539 Bacteria 569
69 Ga0070693_100061872 3300005547 Unclassified 2177
70 Ga0070665_100030856 3300005548 Bacteria 5394
71 Ga0070665_100248638 3300005548 Bacteria 1779
72 Ga0070704_100393970 3300005549 Bacteria 1180
73 Ga0068855_100623322 3300005563 Bacteria 1161
74 Ga0068855_100804215 3300005563 Bacteria 999
75 Ga0068856_100013553 3300005614 Bacteria 7892
76 Ga0068856_100262955 3300005614 Bacteria 1741
77 Ga0068856_100738472 3300005614 Bacteria 1004
78 Ga0068856_100746008 3300005614 Unclassified 999
79 Ga0068859_100702262 3300005617 Bacteria 1102
80 Ga0068864_100420057 3300005618 Bacteria 1274
81 Ga0068861_101907716 3300005719 Unclassified 591
82 Ga0068863_100304919 3300005841 Bacteria 1545
83 Ga0068862_101493887 3300005844 Bacteria 681
84 Ga0081455_10002249 3300005937 Bacteria 22983
85 Ga0081539_10002846 3300005985 Bacteria 23053
86 Ga0070717_10037010 3300006028 Bacteria 3960
87 Ga0070717_10194807 3300006028 Bacteria 1772
88 Ga0070717_10214955 3300006028 Bacteria 1688
89 Ga0070717_10482398 3300006028 Bacteria 1119
90 Ga0075365_10755475 3300006038 Unclassified 687
91 Ga0075363_100309394 3300006048 Bacteria 918
92 Ga0070716_100193632 3300006173 Bacteria 1345
93 Ga0070716_100256680 3300006173 Bacteria 1194
94 Ga0070712_100164043 3300006175 Bacteria 1718
95 Ga0075370_10634524 3300006353 Bacteria 648
96 Ga0068871_100502144 3300006358 Bacteria 1093
97 Ga0075430_100019454 3300006846 Bacteria 5775
98 Ga0075431_100056566 3300006847 Bacteria 4045
99 Ga0075429_100002223 3300006880 Bacteria 16246
100 Ga0075436_100291631 3300006914 Bacteria 1168
101 Ga0097620_100358870 3300006931 Bacteria 1552
102 Ga0097620_100702300 3300006931 Bacteria 1102
103 Ga0099795_10012436 3300007788 Bacteria 2582
104 Ga0099795_10090480 3300007788 Bacteria 1186
105 Ga0105240_10089519 3300009093 Unclassified 3764
106 Ga0105240_10769100 3300009093 Bacteria 1046
107 Ga0105240_11209915 3300009093 Bacteria 800
108 Ga0114129_11309219 3300009147 Unclassified 898
109 Ga0105243_11028719 3300009148 Unclassified 828
110 Ga0105241_10570292 3300009174 Unclassified 1019
111 Ga0105242_10033166 3300009176 Bacteria 4134
112 Ga0105242_10825626 3300009176 Bacteria 920
113 Ga0105242_11079674 3300009176 Bacteria 815
114 Ga0105248_10072987 3300009177 Bacteria 3857
115 Ga0105248_10946983 3300009177 Bacteria 972
116 Ga0105237_10242631 3300009545 Bacteria 1803
117 Ga0105238_10109667 3300009551 Bacteria 2741
118 Ga0099796_10015919 3300010159 Bacteria 2210
119 Ga0105239_10108172 3300010375 Bacteria 3081
120 Ga0105239_10409366 3300010375 Bacteria 1535
121 Ga0157370_11089912 3300013104 Unclassified 722
122 Ga0157369_10045694 3300013105 Bacteria 4761
123 Ga0157369_10098973 3300013105 Bacteria 3109
124 Ga0157374_10141730 3300013296 Bacteria 2334
125 Ga0157378_11900943 3300013297 Unclassified 644
126 Ga0157372_10447832 3300013307 Plasmid 1505
127 Ga0157375_10620468 3300013308 Unclassified 1239
128 Ga0157375_11003684 3300013308 Bacteria 974
129 Ga0157380_10361919 3300014326 Bacteria 1361
130 Ga0182008_10393035 3300014497 Bacteria 743
131 Ga0157376_11118808 3300014969 Unclassified 814
132 Ga0163161_10475529 3300017792 Bacteria 1014
133 Ga0197907_11512887 3300020069 Unclassified 819
134 Ga0206349_1275810 3300020075 Bacteria 888
135 Ga0206350_10214382 3300020080 Bacteria 1027
136 Ga0213874_10062647 3300021377 Bacteria 1169
137 Ga0213874_10309167 3300021377 Unclassified 597
138 Ga0213875_10000955 3300021388 Bacteria 20648
139 Ga0213875_10009261 3300021388 Bacteria 4996
140 Ga0213875_10062707 3300021388 Bacteria 1738
141 Ga0224712_10279566 3300022467 Bacteria 777
142 Ga0209130_1000793 3300025284 Bacteria 27090
143 Ga0209025_1038403 3300025294 Bacteria 2106
144 Ga0207426_1000179 3300025302 Bacteria 158635
145 Ga0207692_10038842 3300025898 Bacteria 2337
146 Ga0207699_10225256 3300025906 Unclassified 1282
147 Ga0207684_10066448 3300025910 Bacteria 3062
148 Ga0207684_10076779 3300025910 Bacteria 2839
149 Ga0207684_10430306 3300025910 Bacteria 1134
150 Ga0207684_10474653 3300025910 Unclassified 1073
151 Ga0207684_10476987 3300025910 Bacteria 1070
152 Ga0207654_10746246 3300025911 Unclassified 705
153 Ga0207707_10034607 3300025912 Bacteria 4419
154 Ga0207695_10186305 3300025913 Bacteria 1994
155 Ga0207671_10238815 3300025914 Bacteria 1427
156 Ga0207693_10035833 3300025915 Bacteria 3910
157 Ga0207693_10183648 3300025915 Bacteria 1646
158 Ga0207663_10145839 3300025916 Bacteria 1654
159 Ga0207649_10518942 3300025920 Bacteria 908
160 Ga0207652_10001733 3300025921 Bacteria 19037
161 Ga0207646_10042429 3300025922 Bacteria 4086
162 Ga0207646_10169085 3300025922 Bacteria 1974
163 Ga0207646_10213929 3300025922 Bacteria 1741
164 Ga0207646_10350447 3300025922 Bacteria 1334
165 Ga0207681_11410958 3300025923 Bacteria 584
166 Ga0207694_10221792 3300025924 Bacteria 1542
167 Ga0207687_10000460 3300025927 Bacteria 27723
168 Ga0207700_10063303 3300025928 Unclassified 2813
169 Ga0207700_10243113 3300025928 Bacteria 1535
170 Ga0207700_10362406 3300025928 Bacteria 1264
171 Ga0207664_10000888 3300025929 Bacteria 20143
172 Ga0207664_10022933 3300025929 Bacteria 4670
173 Ga0207664_10036013 3300025929 Bacteria 3823
174 Ga0207664_10329018 3300025929 Bacteria 1349
175 Ga0207664_10515050 3300025929 Unclassified 1072
176 Ga0207706_10382411 3300025933 Bacteria 1221
177 Ga0207686_10006882 3300025934 Bacteria 6123
178 Ga0207689_10296898 3300025942 Bacteria 1339
179 Ga0207661_10004460 3300025944 Bacteria 9836
180 Ga0207679_11077415 3300025945 Bacteria 737
181 Ga0207668_10147551 3300025972 Bacteria 1817
182 Ga0207640_10902589 3300025981 Bacteria 772
183 Ga0207639_10005999 3300026041 Bacteria 8242
184 Ga0207678_10688664 3300026067 Bacteria 899
185 Ga0207702_10014646 3300026078 Bacteria 6508
186 Ga0207702_10462184 3300026078 Bacteria 1233
187 Ga0207702_10492790 3300026078 Bacteria 1194
188 Ga0207702_11145346 3300026078 Unclassified 772
189 Ga0207702_12177295 3300026078 Unclassified 543
190 Ga0207674_11359190 3300026116 Bacteria 680
191 Ga0207675_101797456 3300026118 Unclassified 632
192 Ga0207683_10150214 3300026121 Bacteria 2102
193 Ga0209179_1013668 3300027512 Bacteria 1478
194 Ga0268266_10011981 3300028379 Bacteria 7507
195 Ga0265338_10006479 3300028800 Bacteria 14906
196 Ga0265338_10009317 3300028800 Bacteria 11732
197 Ga0265338_10131954 3300028800 Bacteria 1971
198 Ga0265338_10242429 3300028800 Bacteria 1334
199 Ga0307511_10177120 3300030521 Bacteria 1157
200 Ga0265332_10260182 3300031238 Unclassified 718
201 Ga0265320_10356172 3300031240 Bacteria 646
202 Ga0265325_10053464 3300031241 Bacteria 2070
203 Ga0265325_10118795 3300031241 Bacteria 1277
204 Ga0265325_10201804 3300031241 Unclassified 917
205 Ga0265340_10098492 3300031247 Bacteria 1361
206 Ga0265339_10013897 3300031249 Bacteria 4871
207 Ga0265339_10016810 3300031249 Bacteria 4351
208 Ga0265331_10133772 3300031250 Bacteria 1130
209 Ga0265331_10144343 3300031250 Bacteria 1081
210 Ga0265327_10062220 3300031251 Unclassified 1901
211 Ga0265316_10584032 3300031344 Bacteria 793
212 Ga0307513_10280159 3300031456 Bacteria 1445
213 Ga0307513_10559608 3300031456 Bacteria 855
214 Ga0307509_10298542 3300031507 Bacteria 1360
215 Ga0307408_100518305 3300031548 Bacteria 1047
216 Ga0265313_10000079 3300031595 Bacteria 95515
217 Ga0265313_10007550 3300031595 Bacteria 7394
218 Ga0307508_10163589 3300031616 Bacteria 1828
219 Ga0307508_10361256 3300031616 Bacteria 1043
220 Ga0265314_10014243 3300031711 Bacteria 6375
221 Ga0265314_10163383 3300031711 Bacteria 1352
222 Ga0265314_10413368 3300031711 Bacteria 726
223 Ga0265342_10030080 3300031712 Bacteria 3369
224 Ga0265342_10085225 3300031712 Bacteria 1819
225 Ga0307516_10000244 3300031730 Bacteria 70125
226 Ga0307516_10614916 3300031730 Bacteria 741
227 Ga0307507_10067813 3300033179 Bacteria 3260
228 Ga0307510_10205831 3300033180 Bacteria 1496
229 Ga0373945_0518934 3300035116 Unclassified 532
230 Ga0373953_0170315 3300035117 Unclassified 937
231 Ga0373954_0103821 3300035118 Bacteria 1372
232 Ga0373956_0073343 3300035119 Bacteria 1564
233 Ga0373943_0874400 3300035170 Unclassified 536
234 Ga0373955_0519833 3300035172 Unclassified 727
235 Ga0373935_0817200 3300035692 Unclassified 688
236 Ga0373927_0233528 3300035695 Bacteria 1208
237 Ga0373933_0004810 3300035724 Bacteria 7384
238 Ga0373933_0257304 3300035724 Bacteria 1125
239 Ga0373947_0568829 3300035725 Bacteria 772
240 Ga0373947_0639418 3300035725 Unclassified 725
241 Ga0373937_0060998 3300036401 Bacteria 3466
242 Ga0373925_0084414 3300037068 Bacteria 2420
243 Ga0373925_0086097 3300037068 Unclassified 2397
244 Ga0395899_0000356 3300037312 Bacteria 56002
245 Ga0395900_0000016 3300037418 Bacteria 382407
246 Ga0395900_1371902 3300037418 Bacteria 620
247 Ga0395898_0007018 3300037466 Bacteria 11967
248 Ga0395898_1127106 3300037466 Bacteria 717
249 Ga0395905_0001846 3300037471 Bacteria 24436
250 Ga0395905_0008339 3300037471 Bacteria 10221
251 Ga0436364_0451820 3300037853 Bacteria 12064
252 Ga0436364_1114741 3300037853 Bacteria 3988
253 Ga0436364_1151778 3300037853 Plasmid 4472
254 Ga0395901_0000022 3300038443 Bacteria 296356
255 Ga0400488_24119 3300038741 Bacteria 4240
256 Ga0400486_24201 3300038742 Bacteria 1192
257 Ga0400483_111354 3300039062 Unclassified 2110
258 Ga0436361_1071402 3300039447 Unclassified 722
259 Ga0436363_0614229 3300039450 Bacteria 1069
260 Ga0436363_1167372 3300039450 Unclassified 1196
261 Ga0436362_1301255 3300039453 Unclassified 776
262 Ga0451791_1128699 3300041451 Bacteria 670
263 Ga0451807_0456072 3300041486 Bacteria 660
264 Ga0451841_0111470 3300041498 Bacteria 690
265 Ga0451853_2040062 3300041512 Bacteria 559
266 Ga0451576_0743694 3300045051 Bacteria 1030
267 Ga0466958_0394784 3300045836 Bacteria 893
268 Ga0466967_2521095 3300045976 Unclassified 509
269 Ga0495638_0265436 3300046460 Bacteria 939
270 Ga0495641_0316258 3300046461 Unclassified 704
271 Ga0495651_0707471 3300046462 Unclassified 627
272 Ga0495596_0237806 3300046500 Unclassified 707
273 Ga0495608_0008815 3300046511 Bacteria 7058
274 Ga0495630_1344410 3300046517 Bacteria 538
275 Ga0495632_0416194 3300046519 Unclassified 586
276 Ga0495586_0046684 3300046535 Bacteria 2335
277 Ga0495587_0227907 3300046536 Unclassified 1050
278 Ga0495622_0078619 3300046557 Bacteria 1519
279 Ga0495667_0094532 3300046559 Bacteria 1935
280 Ga0495635_0757221 3300046663 Unclassified 627
281 Ga0495647_0400773 3300046681 Unclassified 630
282 Ga0495658_0533573 3300046683 Unclassified 751
283 Ga0495670_0006058 3300046691 Bacteria 5927
284 Ga0495589_0275248 3300046794 Bacteria 783
285 Ga0495676_0134048 3300047321 Bacteria 1784
286 Ga0495680_0001430 3300047322 Bacteria 25733
287 Ga0495675_0053913 3300047444 Bacteria 2552
288 Ga0495679_005301 3300047446 Bacteria 5741
289 Ga0495686_0190409 3300047472 Bacteria 1183
290 Ga0495602_0375714 3300048088 Unclassified 1019
291 Ga0496100_0100643 3300048903 Unclassified 1991
292 Ga0496101_0153604 3300048904 Bacteria 1762
293 Ga0496104_0035523 3300048907 Unclassified 4653
294 Ga0496104_0261024 3300048907 Bacteria 1645
295 Ga0496106_0004512 3300048909 Bacteria 10312
296 Ga0496107_0034561 3300048910 Bacteria 3621
297 Ga0496109_0003817 3300048912 Bacteria 12582
298 Ga0496109_0303108 3300048912 Bacteria 1507
299 Ga0496110_0025624 3300048913 Bacteria 5042
300 Ga0496111_0063312 3300048914 Unclassified 2682
301 Ga0496112_1057021 3300048915 Unclassified 731
302 Ga0496112_1143220 3300048915 Bacteria 696
303 Ga0496113_0597373 3300048916 Bacteria 884
304 Ga0496114_0005535 3300048917 Bacteria 9895
305 Ga0496118_0090461 3300048921 Bacteria 2109
306 Ga0496121_0655320 3300048924 Unclassified 639
307 Ga0496126_0007968 3300048929 Bacteria 11509
308 Ga0496126_0444342 3300048929 Unclassified 1045
309 Ga0501031_1000054 3300049568 Bacteria 534
310 Ga0501032_0031661 3300049569 Bacteria 3626
311 Ga0501032_0054520 3300049569 Bacteria 2691
312 Ga0501032_0479544 3300049569 Bacteria 796
313 Ga0501032_0656670 3300049569 Unclassified 666
314 Ga0501032_0767955 3300049569 Unclassified 609
315 Ga0501033_0007287 3300049570 Bacteria 8628
316 Ga0501033_0018654 3300049570 Bacteria 5243
317 Ga0501033_0021217 3300049570 Bacteria 4900
318 Ga0501033_0257825 3300049570 Bacteria 1235
319 Ga0501033_0501994 3300049570 Bacteria 839
320 Ga0501034_0001448 3300049571 Bacteria 31444
321 Ga0501034_0333697 3300049571 Bacteria 1447
322 Ga0501036_0153889 3300049572 Bacteria 1940
323 Ga0501037_0000271 3300049573 Bacteria 44641
324 Ga0501037_0118935 3300049573 Bacteria 1901
325 Ga0501037_0777801 3300049573 Unclassified 633
326 Ga0501038_0332481 3300049574 Bacteria 1186
327 Ga0501038_0901046 3300049574 Bacteria 653
328 Ga0501039_0442682 3300049575 Bacteria 1020
329 Ga0501039_0786144 3300049575 Bacteria 743
330 Ga0501042_0250112 3300049578 Bacteria 1279
331 Ga0501043_0000096 3300049579 Bacteria 79864
332 Ga0501043_0037264 3300049579 Bacteria 3824
333 Ga0501043_0082500 3300049579 Bacteria 2527
334 Ga0501043_0128517 3300049579 Bacteria 1986
335 Ga0501043_0160006 3300049579 Bacteria 1760
336 Ga0501043_0320100 3300049579 Bacteria 1183
337 Ga0501043_0321306 3300049579 Bacteria 1180
338 Ga0501047_0024606 3300049581 Bacteria 5780
339 Ga0501047_0262456 3300049581 Bacteria 1575
340 Ga0501047_0292973 3300049581 Bacteria 1471
341 Ga0501047_0353951 3300049581 Bacteria 1305
342 Ga0501047_0383258 3300049581 Unclassified 1240
343 Ga0501047_0765255 3300049581 Bacteria 781
344 Ga0501047_1175934 3300049581 Bacteria 580
345 Ga0501048_0099976 3300049582 Bacteria 2046
346 Ga0501048_0346236 3300049582 Bacteria 1060
347 Ga0501068_0032975 3300049584 Bacteria 3082
348 Ga0501068_0113837 3300049584 Bacteria 1684
349 Ga0501069_0000012 3300049585 Bacteria 148453
350 Ga0501069_0046868 3300049585 Bacteria 2398
351 Ga0501069_0095962 3300049585 Bacteria 1680
352 Ga0501069_0221294 3300049585 Bacteria 1100
353 Ga0501069_0245788 3300049585 Bacteria 1043
354 Ga0501070_0000329 3300049586 Bacteria 43062
355 Ga0501070_0000655 3300049586 Bacteria 31899
356 Ga0501070_0002286 3300049586 Bacteria 16840
357 Ga0501070_0043367 3300049586 Bacteria 3744
358 Ga0501070_0063031 3300049586 Bacteria 3071
359 Ga0501070_0087397 3300049586 Bacteria 2580
360 Ga0501070_0245087 3300049586 Bacteria 1466
361 Ga0501070_0384917 3300049586 Bacteria 1136
362 Ga0501070_0543593 3300049586 Bacteria 930
363 Ga0501070_0775681 3300049586 Bacteria 754
364 Ga0501071_0005903 3300049587 Bacteria 7920
365 Ga0501071_0129491 3300049587 Bacteria 1874
366 Ga0501071_0363830 3300049587 Bacteria 1102
367 Ga0501072_0531387 3300049588 Bacteria 929
368 Ga0501073_0040779 3300049589 Bacteria 3284
369 Ga0501073_0078417 3300049589 Bacteria 2298
370 Ga0501073_0107797 3300049589 Bacteria 1933
371 Ga0501074_0000018 3300049590 Bacteria 76326
372 Ga0501074_0001388 3300049590 Bacteria 16079
373 Ga0501074_0200331 3300049590 Bacteria 1423
374 Ga0501074_0919865 3300049590 Bacteria 615
375 Ga0501075_0199180 3300049591 Bacteria 1527
376 Ga0501076_0046649 3300049592 Bacteria 3424
377 Ga0501076_0564802 3300049592 Bacteria 938
378 Ga0501079_0399577 3300049741 Bacteria 1078
379 Ga0501079_1430457 3300049741 Bacteria 544
380 Ga0501080_0000558 3300049742 Bacteria 29460
381 Ga0501080_0004527 3300049742 Bacteria 12392
382 Ga0501080_0076186 3300049742 Bacteria 3120
383 Ga0501080_0364021 3300049742 Bacteria 1304
384 Ga0501080_0377645 3300049742 Bacteria 1277
385 Ga0501080_0422900 3300049742 Bacteria 1197
386 Ga0501081_0564824 3300049743 Bacteria 850
387 Ga0501083_0001735 3300049744 Bacteria 14857
388 Ga0501083_0166597 3300049744 Bacteria 1440
389 Ga0501035_0000039 3300049822 Bacteria 156824
390 Ga0501035_0001538 3300049822 Bacteria 23474
391 Ga0501035_0005458 3300049822 Bacteria 12026
392 Ga0501035_0036028 3300049822 Bacteria 4487
393 Ga0501035_0160469 3300049822 Bacteria 1946
394 Ga0501035_0464228 3300049822 Unclassified 1046
395 Ga0501035_0706987 3300049822 Bacteria 812
396 Ga0501035_1369073 3300049822 Unclassified 543
397 Ga0501035_1569545 3300049822 Unclassified 500
398 Ga0501044_0000047 3300049823 Bacteria 146449
399 Ga0501044_0016976 3300049823 Bacteria 7809
400 Ga0501044_0027020 3300049823 Bacteria 6072
401 Ga0501044_0111970 3300049823 Bacteria 2736
402 Ga0501044_0309508 3300049823 Bacteria 1506
403 Ga0501044_0320199 3300049823 Bacteria 1475
404 Ga0501044_0391550 3300049823 Bacteria 1303
405 Ga0501044_0949951 3300049823 Bacteria 733
406 Ga0501045_0293730 3300049824 Bacteria 1209
407 Ga0501045_0347604 3300049824 Bacteria 1104
408 nmdc:mga07m45_578298_c1 3300050496 Bacteria 649
409 nmdc:mga05p37_195544_c1 3300050507 Bacteria 2452
410 nmdc:mga09592_1503_c1 3300050508 Bacteria 18776
411 nmdc:mga0qj67_32949_c1 3300050509 Bacteria 4042
412 nmdc:mga06r32_31481_c1 3300050510 Bacteria 4983
413 nmdc:mga06r32_453876_c1 3300050510 Bacteria 1261
414 Ga0500635_0121438 3300053080 Unclassified 978
415 Ga0500646_0101040 3300053090 Bacteria 905
416 Ga0500647_0206325 3300053091 Unclassified 888
417 Ga0500572_236113 3300053111 Bacteria 597
418 Ga0500658_0184709 3300053134 Bacteria 950
419 Ga0500573_0245750 3300053140 Bacteria 925
420 Ga0500590_151002 3300053148 Bacteria 1048
421 Ga0500604_0054459 3300053151 Bacteria 1242
422 Ga0500616_0106293 3300053153 Bacteria 1363
423 Ga0500627_0089214 3300053158 Bacteria 1379
424 Ga0500639_177118 3300053163 Unclassified 948
425 Ga0500636_0003999 3300053177 Bacteria 8311
426 Ga0500636_0034801 3300053177 Bacteria 2981
427 Ga0500636_0192514 3300053177 Bacteria 1085
428 Ga0500637_0063418 3300053178 Unclassified 2119
429 Ga0500637_0177914 3300053178 Bacteria 1220
430 Ga0500637_0292511 3300053178 Bacteria 891
431 Ga0500570_104290 3300053724 Bacteria 1178
432 Ga0500657_126445 3300053728 Bacteria 1001
433 Ga0500552_011538 3300053733 Bacteria 1112
434 Ga0501084_0000366 3300054114 Bacteria 34534
435 Ga0501084_0162522 3300054114 Bacteria 1884
436 Ga0501082_0059465 3300060353 Bacteria 3293
437 Ga0501082_0148041 3300060353 Bacteria 2039
438 Ga0530510_0173431 3300061734 Bacteria 1598
439 2517760446 2517572101 Bacteria 6884336
440 2838024427 2838022645 Bacteria 6494267
441 2841912233 2841911363 Bacteria 6173697
442 2841919998 2841917233 Bacteria 6173500
443 2842199970 2842198810 Bacteria 6608673
444 Ga0070713_100355127
445 JGI25159J45721_1012472
446 JGI25406J46586_10002426
447 JGI25406J46586_10015592
448 rootH2_10312604
449 JGI25160J50197_1020124
450 Ga0055528_1011911
451 Ga0065165_1054431
452 Ga0070676_10184558
453 Ga0070690_100976851
454 Ga0070682_100167958
455 Ga0070682_100334622
456 Ga0070689_101115607
457 Ga0070692_10005051
458 Ga0070668_100652201
459 Ga0070675_100817220
460 Ga0070674_100003751
461 Ga0070674_100251160
462 Ga0070673_102247738
463 Ga0070667_101969062
464 Ga0070709_10265499
465 Ga0070709_10420979
466 Ga0070709_10424030
467 Ga0070714_100023538
468 Ga0070714_100055754
469 Ga0070714_100109861
470 Ga0070714_100116014
471 Ga0070714_100638358
472 Ga0070714_100750323
473 Ga0070713_100066871
474 Ga0070713_100326729
475 Ga0070713_100604108
476 Ga0070710_10088496
477 Ga0070710_10105820
478 Ga0070711_100125632
479 Ga0070711_100289651
480 Ga0070711_100877482
481 Ga0070708_100019926
482 Ga0070708_100096273
483 Ga0070663_100264525
484 Ga0070663_100341743
485 Ga0070663_100444241
486 Ga0070678_100035036
487 Ga0070678_101461279
488 Ga0070662_100478675
489 Ga0070681_11252792
490 Ga0070706_100092898
491 Ga0070706_100470451
492 Ga0070706_100498760
493 Ga0070707_100041488
494 Ga0070707_100050770
495 Ga0070707_100059833
496 Ga0070707_100106690
497 Ga0070707_100416089
498 Ga0070698_100000159
499 Ga0070698_100106383
500 Ga0070698_100157368
501 Ga0070698_100552521
502 Ga0070698_101003956
503 Ga0070699_100009482
504 Ga0070699_100010042
505 Ga0070699_100668274
506 Ga0070679_100014554
507 Ga0070679_100272088
508 Ga0070684_100065683
509 Ga0070697_100270679
510 Ga0068853_100041279
511 Ga0068853_101952825
512 Ga0070693_100061872
513 Ga0070665_100030856
514 Ga0070665_100248638
515 Ga0070704_100393970
516 Ga0068855_100623322
517 Ga0068855_100804215
518 Ga0068856_100013553
519 Ga0068856_100262955
520 Ga0068856_100738472
521 Ga0068856_100746008
522 Ga0068859_100702262
523 Ga0068864_100420057
524 Ga0068861_101907716
525 Ga0068863_100304919
526 Ga0068862_101493887
527 Ga0081455_10002249
528 Ga0081539_10002846
529 Ga0070717_10037010
530 Ga0070717_10194807
531 Ga0070717_10214955
532 Ga0070717_10482398
533 Ga0075365_10755475
534 Ga0075363_100309394
535 Ga0070716_100193632
536 Ga0070716_100256680
537 Ga0070712_100164043
538 Ga0075370_10634524
539 Ga0068871_100502144
540 Ga0075430_100019454
541 Ga0075431_100056566
542 Ga0075429_100002223
543 Ga0075436_100291631
544 Ga0097620_100358870
545 Ga0097620_100702300
546 Ga0099795_10012436
547 Ga0099795_10090480
548 Ga0105240_10089519
549 Ga0105240_10769100
550 Ga0105240_11209915
551 Ga0114129_11309219
552 Ga0105243_11028719
553 Ga0105241_10570292
554 Ga0105242_10033166
555 Ga0105242_10825626
556 Ga0105242_11079674
557 Ga0105248_10072987
558 Ga0105248_10946983
559 Ga0105237_10242631
560 Ga0105238_10109667
561 Ga0099796_10015919
562 Ga0105239_10108172
563 Ga0105239_10409366
564 Ga0157370_11089912
565 Ga0157369_10045694
566 Ga0157369_10098973
567 Ga0157374_10141730
568 Ga0157378_11900943
569 Ga0157372_10447832
570 Ga0157375_10620468
571 Ga0157375_11003684
572 Ga0157380_10361919
573 Ga0182008_10393035
574 Ga0157376_11118808
575 Ga0163161_10475529
576 Ga0197907_11512887
577 Ga0206349_1275810
578 Ga0206350_10214382
579 Ga0213874_10062647
580 Ga0213874_10309167
581 Ga0213875_10000955
582 Ga0213875_10009261
583 Ga0213875_10062707
584 Ga0224712_10279566
585 Ga0209130_1000793
586 Ga0209025_1038403
587 Ga0207426_1000179
588 Ga0207692_10038842
589 Ga0207699_10225256
590 Ga0207684_10066448
591 Ga0207684_10076779
592 Ga0207684_10430306
593 Ga0207684_10474653
594 Ga0207684_10476987
595 Ga0207654_10746246
596 Ga0207707_10034607
597 Ga0207695_10186305
598 Ga0207671_10238815
599 Ga0207693_10035833
600 Ga0207693_10183648
601 Ga0207663_10145839
602 Ga0207649_10518942
603 Ga0207652_10001733
604 Ga0207646_10042429
605 Ga0207646_10169085
606 Ga0207646_10213929
607 Ga0207646_10350447
608 Ga0207681_11410958
609 Ga0207694_10221792
610 Ga0207687_10000460
611 Ga0207700_10063303
612 Ga0207700_10243113
613 Ga0207700_10362406
614 Ga0207664_10000888
615 Ga0207664_10022933
616 Ga0207664_10036013
617 Ga0207664_10329018
618 Ga0207664_10515050
619 Ga0207706_10382411
620 Ga0207686_10006882
621 Ga0207689_10296898
622 Ga0207661_10004460
623 Ga0207679_11077415
624 Ga0207668_10147551
625 Ga0207640_10902589
626 Ga0207639_10005999
627 Ga0207678_10688664
628 Ga0207702_10014646
629 Ga0207702_10462184
630 Ga0207702_10492790
631 Ga0207702_11145346
632 Ga0207702_12177295
633 Ga0207674_11359190
634 Ga0207675_101797456
635 Ga0207683_10150214
636 Ga0209179_1013668
637 Ga0268266_10011981
638 Ga0265338_10006479
639 Ga0265338_10009317
640 Ga0265338_10131954
641 Ga0265338_10242429
642 Ga0307511_10177120
643 Ga0265332_10260182
644 Ga0265320_10356172
645 Ga0265325_10053464
646 Ga0265325_10118795
647 Ga0265325_10201804
648 Ga0265340_10098492
649 Ga0265339_10013897
650 Ga0265339_10016810
651 Ga0265331_10133772
652 Ga0265331_10144343
653 Ga0265327_10062220
654 Ga0265316_10584032
655 Ga0307513_10280159
656 Ga0307513_10559608
657 Ga0307509_10298542
658 Ga0307408_100518305
659 Ga0265313_10000079
660 Ga0265313_10007550
661 Ga0307508_10163589
662 Ga0307508_10361256
663 Ga0265314_10014243
664 Ga0265314_10163383
665 Ga0265314_10413368
666 Ga0265342_10030080
667 Ga0265342_10085225
668 Ga0307516_10000244
669 Ga0307516_10614916
670 Ga0307507_10067813
671 Ga0307510_10205831
672 Ga0373945_0518934
673 Ga0373953_0170315
674 Ga0373954_0103821
675 Ga0373956_0073343
676 Ga0373943_0874400
677 Ga0373955_0519833
678 Ga0373935_0817200
679 Ga0373927_0233528
680 Ga0373933_0004810
681 Ga0373933_0257304
682 Ga0373947_0568829
683 Ga0373947_0639418
684 Ga0373937_0060998
685 Ga0373925_0084414
686 Ga0373925_0086097
687 Ga0395899_0000356
688 Ga0395900_0000016
689 Ga0395900_1371902
690 Ga0395898_0007018
691 Ga0395898_1127106
692 Ga0395905_0001846
693 Ga0395905_0008339
694 Ga0436364_0451820
695 Ga0436364_1114741
696 Ga0436364_1151778
697 Ga0395901_0000022
698 Ga0400488_24119
699 Ga0400486_24201
700 Ga0400483_111354
701 Ga0436361_1071402
702 Ga0436363_0614229
703 Ga0436363_1167372
704 Ga0436362_1301255
705 Ga0451791_1128699
706 Ga0451807_0456072
707 Ga0451841_0111470
708 Ga0451853_2040062
709 Ga0451576_0743694
710 Ga0466958_0394784
711 Ga0466967_2521095
712 Ga0495638_0265436
713 Ga0495641_0316258
714 Ga0495651_0707471
715 Ga0495596_0237806
716 Ga0495608_0008815
717 Ga0495630_1344410
718 Ga0495632_0416194
719 Ga0495586_0046684
720 Ga0495587_0227907
721 Ga0495622_0078619
722 Ga0495667_0094532
723 Ga0495635_0757221
724 Ga0495647_0400773
725 Ga0495658_0533573
726 Ga0495670_0006058
727 Ga0495589_0275248
728 Ga0495676_0134048
729 Ga0495680_0001430
730 Ga0495675_0053913
731 Ga0495679_005301
732 Ga0495686_0190409
733 Ga0495602_0375714
734 Ga0496100_0100643
735 Ga0496101_0153604
736 Ga0496104_0035523
737 Ga0496104_0261024
738 Ga0496106_0004512
739 Ga0496107_0034561
740 Ga0496109_0003817
741 Ga0496109_0303108
742 Ga0496110_0025624
743 Ga0496111_0063312
744 Ga0496112_1057021
745 Ga0496112_1143220
746 Ga0496113_0597373
747 Ga0496114_0005535
748 Ga0496118_0090461
749 Ga0496121_0655320
750 Ga0496126_0007968
751 Ga0496126_0444342
752 Ga0501031_1000054
753 Ga0501032_0031661
754 Ga0501032_0054520
755 Ga0501032_0479544
756 Ga0501032_0656670
757 Ga0501032_0767955
758 Ga0501033_0007287
759 Ga0501033_0018654
760 Ga0501033_0021217
761 Ga0501033_0257825
762 Ga0501033_0501994
763 Ga0501034_0001448
764 Ga0501034_0333697
765 Ga0501036_0153889
766 Ga0501037_0000271
767 Ga0501037_0118935
768 Ga0501037_0777801
769 Ga0501038_0332481
770 Ga0501038_0901046
771 Ga0501039_0442682
772 Ga0501039_0786144
773 Ga0501042_0250112
774 Ga0501043_0000096
775 Ga0501043_0037264
776 Ga0501043_0082500
777 Ga0501043_0128517
778 Ga0501043_0160006
779 Ga0501043_0320100
780 Ga0501043_0321306
781 Ga0501047_0024606
782 Ga0501047_0262456
783 Ga0501047_0292973
784 Ga0501047_0353951
785 Ga0501047_0383258
786 Ga0501047_0765255
787 Ga0501047_1175934
788 Ga0501048_0099976
789 Ga0501048_0346236
790 Ga0501068_0032975
791 Ga0501068_0113837
792 Ga0501069_0000012
793 Ga0501069_0046868
794 Ga0501069_0095962
795 Ga0501069_0221294
796 Ga0501069_0245788
797 Ga0501070_0000329
798 Ga0501070_0000655
799 Ga0501070_0002286
800 Ga0501070_0043367
801 Ga0501070_0063031
802 Ga0501070_0087397
803 Ga0501070_0245087
804 Ga0501070_0384917
805 Ga0501070_0543593
806 Ga0501070_0775681
807 Ga0501071_0005903
808 Ga0501071_0129491
809 Ga0501071_0363830
810 Ga0501072_0531387
811 Ga0501073_0040779
812 Ga0501073_0078417
813 Ga0501073_0107797
814 Ga0501074_0000018
815 Ga0501074_0001388
816 Ga0501074_0200331
817 Ga0501074_0919865
818 Ga0501075_0199180
819 Ga0501076_0046649
820 Ga0501076_0564802
821 Ga0501079_0399577
822 Ga0501079_1430457
823 Ga0501080_0000558
824 Ga0501080_0004527
825 Ga0501080_0076186
826 Ga0501080_0364021
827 Ga0501080_0377645
828 Ga0501080_0422900
829 Ga0501081_0564824
830 Ga0501083_0001735
831 Ga0501083_0166597
832 Ga0501035_0000039
833 Ga0501035_0001538
834 Ga0501035_0005458
835 Ga0501035_0036028
836 Ga0501035_0160469
837 Ga0501035_0464228
838 Ga0501035_0706987
839 Ga0501035_1369073
840 Ga0501035_1569545
841 Ga0501044_0000047
842 Ga0501044_0016976
843 Ga0501044_0027020
844 Ga0501044_0111970
845 Ga0501044_0309508
846 Ga0501044_0320199
847 Ga0501044_0391550
848 Ga0501044_0949951
849 Ga0501045_0293730
850 Ga0501045_0347604
851 nmdc:mga07m45_578298_c1
852 nmdc:mga05p37_195544_c1
853 nmdc:mga09592_1503_c1
854 nmdc:mga0qj67_32949_c1
855 nmdc:mga06r32_31481_c1
856 nmdc:mga06r32_453876_c1
857 Ga0500635_0121438
858 Ga0500646_0101040
859 Ga0500647_0206325
860 Ga0500572_236113
861 Ga0500658_0184709
862 Ga0500573_0245750
863 Ga0500590_151002
864 Ga0500604_0054459
865 Ga0500616_0106293
866 Ga0500627_0089214
867 Ga0500639_177118
868 Ga0500636_0003999
869 Ga0500636_0034801
870 Ga0500636_0192514
871 Ga0500637_0063418
872 Ga0500637_0177914
873 Ga0500637_0292511
874 Ga0500570_104290
875 Ga0500657_126445
876 Ga0500552_011538
877 Ga0501084_0000366
878 Ga0501084_0162522
879 Ga0501082_0059465
880 Ga0501082_0148041
881 Ga0530510_0173431
882 2517760446
883 2838024427
884 2841912233
885 2841919998
886 2842199970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

19

142

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.7873 1 131
3h87-assembly1.cif.gz_B rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis 0.7751 2 133
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7728 4 133
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.7719 1 133
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7718 2 133
ID Description Score Start End Superfamily
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8191 1 133 3.40.50.1010
5sv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7874 1 131 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7867 4 131 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7767 1 133 3.40.50.1010
af_P9WFB5_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7708 41 134 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A5Q4G861-F1-model_v4 PIN domain-containing protein 0.9974 1 134 GO:0004518
GO:0046872
AF-A0A833GBT0-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9959 1 134 GO:0004518
GO:0046872
AF-A0A557YKD1-F1-model_v4 deleted 0.9928 2 134
AF-A0A7G6SRS8-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9925 2 134 GO:0004518
GO:0046872
AF-A0A2U2DW85-F1-model_v4 DNA-binding protein 0.9909 2 135 GO:0003677
GO:0004518
GO:0046872

Map