F445036

General Info

Members Datasets Scaffolds Average Seq Length
443 323 404 115

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100000270|Ga0070708_10000027033
Length 109
Sequence VIAVIFEAVPYPDKKHAYLDAAAMLRPQLEQIDGFISIERFESLASPGKILSLSYWRDDEAVRRHRRIQAEGRTSIFADYRLRVAQVLRDYGLNDRAQAPEDSRHVHGG

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2547132374 Acidovorax radicis N35 Isolate Unclassified
6 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
7 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
8 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
9 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
10 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
11 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
12 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
13 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
14 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
15 2643221638 Duganella sp. Root336D2 Isolate Unclassified
16 2643221645 Massilia sp. Root351 Isolate Unclassified
17 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2643221719 Rhizobium sp. Root274 Isolate Unclassified
20 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
21 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
22 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
23 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
24 2885266251 Ralstonia sp. SET104 Isolate Nodule
25 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
26 2906610324
27 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
28 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
29 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
30 2922425934
31 2928058823 Ralstonia sp. 1138 Isolate Unclassified
32 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
33 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
34 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
35 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
36 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
37 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
42 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
51 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
52 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
53 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
209 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
234 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
235 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
236 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
240 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
310 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
322 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
323 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 0.23
Isolates 8.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.83
Nodule 3.16
Rhizoplane 3.16
Rhizosphere 64.33
Stem 0
Stem Tuber 0
Unclassified 11.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000077 3300001979 Bacteria 33090
2 JGI25156J39149_1024990 3300002705 Bacteria 968
3 JGI25154J39366_1001752 3300002738 Bacteria 6974
4 JGI25158J39367_1005523 3300002739 Bacteria 1853
5 JGI25157J39369_1031449 3300002741 Bacteria 604
6 JGI25157J39369_1040306 3300002741 Bacteria 515
7 JGI25152J39213_1000342 3300002773 Bacteria 29633
8 JGI25152J39213_1014848 3300002773 Bacteria 1560
9 JGI25150J39212_1000839 3300002774 Bacteria 10277
10 JGI25150J39212_1000987 3300002774 Bacteria 8919
11 JGI25159J45721_1003570 3300002987 Bacteria 5452
12 JGI25159J45721_1007785 3300002987 Bacteria 3022
13 JGI25153J46596_10020081 3300003215 Bacteria 2536
14 rootL2_10006290 3300003322 Bacteria 5824
15 rootL2_10267707 3300003322 Bacteria 1037
16 rootH1_10046375 3300003323 Bacteria 1139
17 rootH1_10226935 3300003323 Bacteria 1506
18 JGI25407J50210_10165600 3300003373 Bacteria 545
19 JGI25161J50226_1000275 3300003374 Bacteria 29880
20 JGI25161J50226_1000808 3300003374 Bacteria 11786
21 Ga0006562J51391_1092436 3300003578 Bacteria 2850
22 Ga0055539_1012469 3300003752 Bacteria 1044
23 Ga0055533_1001698 3300003756 Bacteria 5614
24 Ga0055542_1000929 3300003762 Bacteria 19409
25 Ga0055526_1003349 3300003771 Bacteria 10232
26 Ga0055526_1041187 3300003771 Bacteria 1154
27 Ga0055537_1003179 3300003773 Bacteria 5134
28 Ga0055537_1004797 3300003773 Bacteria 3781
29 Ga0055537_1007991 3300003773 Bacteria 2485
30 Ga0055537_1029530 3300003773 Bacteria 718
31 Ga0055524_1000628 3300003775 Bacteria 25272
32 Ga0055524_1001322 3300003775 Bacteria 14462
33 Ga0055524_1001988 3300003775 Bacteria 10940
34 Ga0055534_1000658 3300003784 Bacteria 17449
35 Ga0055534_1007008 3300003784 Bacteria 2752
36 Ga0055530_10002828 3300003791 Bacteria 10636
37 Ga0055530_10005473 3300003791 Bacteria 6017
38 Ga0055530_10007525 3300003791 Bacteria 4563
39 Ga0055531_10004846 3300003794 Bacteria 8028
40 Ga0055541_1000403 3300003841 Bacteria 12971
41 Ga0055543_1001930 3300004625 Bacteria 7430
42 Ga0065165_1001152 3300005262 Bacteria 30903
43 Ga0065165_1060548 3300005262 Bacteria 1039
44 Ga0065165_1131927 3300005262 Unclassified 597
45 Ga0065712_10274297 3300005290 Bacteria 909
46 Ga0070683_100413688 3300005329 Unclassified 1286
47 Ga0070670_100099859 3300005331 Bacteria 2498
48 Ga0070680_100070560 3300005336 Bacteria 2869
49 Ga0070682_100252854 3300005337 Unclassified 1271
50 Ga0070660_101510752 3300005339 Bacteria 571
51 Ga0070689_100014900 3300005340 Bacteria 5658
52 Ga0070661_100168719 3300005344 Unclassified 1661
53 Ga0070661_100860308 3300005344 Bacteria 747
54 Ga0070692_10562785 3300005345 Bacteria 749
55 Ga0070673_102412820 3300005364 Bacteria 500
56 Ga0070688_100179144 3300005365 Bacteria 1469
57 Ga0070659_100001564 3300005366 Bacteria 16495
58 Ga0070659_101103594 3300005366 Bacteria 699
59 Ga0070714_100610912 3300005435 Bacteria 1048
60 Ga0070701_10002701 3300005438 Bacteria 6875
61 Ga0070701_10935841 3300005438 Unclassified 600
62 Ga0070705_100858647 3300005440 Bacteria 727
63 Ga0070700_100018001 3300005441 Bacteria 4053
64 Ga0070708_100000270 3300005445 Bacteria 38550
65 Ga0070681_10000351 3300005458 Bacteria 37169
66 Ga0068867_100023673 3300005459 Bacteria 4397
67 Ga0070706_100026831 3300005467 Bacteria 5299
68 Ga0070707_100006830 3300005468 Bacteria 10569
69 Ga0070698_100010194 3300005471 Bacteria 10041
70 Ga0070699_100379030 3300005518 Bacteria 1277
71 Ga0070679_100000931 3300005530 Bacteria 25414
72 Ga0070679_100202925 3300005530 Bacteria 1948
73 Ga0070679_100265629 3300005530 Bacteria 1671
74 Ga0070679_100586312 3300005530 Bacteria 1058
75 Ga0070679_101048383 3300005530 Bacteria 760
76 Ga0068853_101280950 3300005539 Bacteria 708
77 Ga0068853_102356678 3300005539 Bacteria 516
78 Ga0070686_100782811 3300005544 Bacteria 767
79 Ga0070695_100024164 3300005545 Bacteria 3741
80 Ga0070696_100034673 3300005546 Bacteria 3473
81 Ga0070696_100465706 3300005546 Bacteria 1000
82 Ga0070693_100038300 3300005547 Bacteria 2679
83 Ga0070704_100025951 3300005549 Bacteria 3864
84 Ga0068855_100021251 3300005563 Bacteria 7781
85 Ga0068855_100982210 3300005563 Bacteria 888
86 Ga0070664_100141093 3300005564 Bacteria 2122
87 Ga0068854_100087367 3300005578 Bacteria 2313
88 Ga0068854_100216812 3300005578 Bacteria 1512
89 Ga0068856_101223894 3300005614 Bacteria 767
90 Ga0070702_100005020 3300005615 Bacteria 6113
91 Ga0068852_100032253 3300005616 Bacteria 4335
92 Ga0068852_101004496 3300005616 Bacteria 853
93 Ga0068852_102865632 3300005616 Bacteria 500
94 Ga0068859_101398785 3300005617 Bacteria 772
95 Ga0068866_10004982 3300005718 Bacteria 5467
96 Ga0068861_100010399 3300005719 Bacteria 6456
97 Ga0068851_10976093 3300005834 Bacteria 533
98 Ga0068870_10591681 3300005840 Bacteria 753
99 Ga0068863_101592132 3300005841 Bacteria 662
100 Ga0068858_100005372 3300005842 Bacteria 12559
101 Ga0068860_100016669 3300005843 Bacteria 7165
102 Ga0068862_100011795 3300005844 Bacteria 7216
103 Ga0081538_10025955 3300005981 Bacteria 4114
104 Ga0081540_1279893 3300005983 Bacteria 576
105 Ga0081539_10075160 3300005985 Bacteria 1796
106 Ga0097621_100017698 3300006237 Bacteria 5420
107 Ga0075370_10507121 3300006353 Bacteria 728
108 Ga0068871_100009817 3300006358 Bacteria 6948
109 Ga0075431_101328471 3300006847 Bacteria 680
110 Ga0068865_101287964 3300006881 Bacteria 649
111 Ga0097620_101398797 3300006931 Bacteria 772
112 Ga0099795_10010068 3300007788 Bacteria 2769
113 Ga0105244_10000086 3300009036 Bacteria 102288
114 Ga0105244_10497764 3300009036 Bacteria 561
115 Ga0105240_10149146 3300009093 Bacteria 2787
116 Ga0111539_10469451 3300009094 Bacteria 1465
117 Ga0105245_10010950 3300009098 Bacteria 7891
118 Ga0105247_10012684 3300009101 Bacteria 5056
119 Ga0105243_10003679 3300009148 Bacteria 12325
120 Ga0105241_11073299 3300009174 Unclassified 757
121 Ga0105242_10014148 3300009176 Bacteria 6178
122 Ga0105248_11427881 3300009177 Bacteria 783
123 Ga0105237_11106878 3300009545 Unclassified 799
124 Ga0105238_10579061 3300009551 Bacteria 1129
125 Ga0105238_11576123 3300009551 Bacteria 686
126 Ga0105249_10018354 3300009553 Bacteria 6220
127 Ga0099796_10198586 3300010159 Bacteria 813
128 Ga0105239_10371060 3300010375 Bacteria 1617
129 Ga0157371_10000001 3300013102 Bacteria 1162285
130 Ga0157370_10003780 3300013104 Bacteria 17669
131 Ga0157370_10005370 3300013104 Bacteria 14388
132 Ga0157370_10008074 3300013104 Bacteria 11392
133 Ga0157378_10018884 3300013297 Bacteria 6060
134 Ga0163162_10056187 3300013306 Bacteria 3965
135 Ga0157372_10054060 3300013307 Bacteria 4477
136 Ga0157372_10736230 3300013307 Bacteria 1147
137 Ga0163163_10135855 3300014325 Bacteria 2500
138 Ga0157380_10166167 3300014326 Bacteria 1923
139 Ga0157380_11865580 3300014326 Bacteria 661
140 Ga0182008_10021161 3300014497 Bacteria 3343
141 Ga0182008_10619033 3300014497 Bacteria 610
142 Ga0157379_10027623 3300014968 Bacteria 5052
143 Ga0157376_10159089 3300014969 Bacteria 2045
144 Ga0182006_1017545 3300015261 Bacteria 3039
145 Ga0182006_1019528 3300015261 Bacteria 2852
146 Ga0182007_10055299 3300015262 Bacteria 1305
147 Ga0182007_10102548 3300015262 Bacteria 948
148 Ga0182005_1000107 3300015265 Bacteria 60831
149 Ga0163161_11001143 3300017792 Bacteria 713
150 Ga0213872_10000476 3300021361 Bacteria 32395
151 Ga0209436_100114 3300025208 Bacteria 39835
152 Ga0209436_100129 3300025208 Bacteria 37378
153 Ga0209784_100339 3300025224 Bacteria 23132
154 Ga0209566_100620 3300025225 Bacteria 21926
155 Ga0209674_100224 3300025226 Bacteria 52381
156 Ga0209563_105556 3300025230 Bacteria 2267
157 Ga0209563_112563 3300025230 Bacteria 1153
158 Ga0207425_1000013 3300025245 Bacteria 497384
159 Ga0207425_1000145 3300025245 Bacteria 60718
160 Ga0207425_1068994 3300025245 Bacteria 609
161 Ga0209646_1000016 3300025246 Bacteria 501688
162 Ga0209026_1005612 3300025250 Bacteria 3317
163 Ga0209026_1007920 3300025250 Bacteria 2297
164 Ga0209677_104336 3300025253 Bacteria 4138
165 Ga0209148_1000051 3300025254 Bacteria 401000
166 Ga0209759_1011668 3300025256 Bacteria 2480
167 Ga0209759_1054864 3300025256 Bacteria 592
168 Ga0209129_1000102 3300025258 Bacteria 161712
169 Ga0209129_1003102 3300025258 Bacteria 7478
170 Ga0209565_1000205 3300025263 Bacteria 69314
171 Ga0209565_1003041 3300025263 Bacteria 5652
172 Ga0209565_1007218 3300025263 Bacteria 3021
173 Ga0209565_1007717 3300025263 Bacteria 2874
174 Ga0209565_1008611 3300025263 Bacteria 2648
175 Ga0209673_1024819 3300025273 Bacteria 2005
176 Ga0209130_1000554 3300025284 Bacteria 37233
177 Ga0209130_1001832 3300025284 Bacteria 12260
178 Ga0209675_1001036 3300025291 Bacteria 17351
179 Ga0209675_1004746 3300025291 Bacteria 5920
180 Ga0209564_1000088 3300025295 Bacteria 250268
181 Ga0209564_1001549 3300025295 Bacteria 22711
182 Ga0209564_1016325 3300025295 Bacteria 2963
183 Ga0209758_1000031 3300025297 Bacteria 497252
184 Ga0209050_1000078 3300025298 Bacteria 278409
185 Ga0209050_1000899 3300025298 Bacteria 39427
186 Ga0209050_1001496 3300025298 Bacteria 24775
187 Ga0209256_1000035 3300025299 Bacteria 386754
188 Ga0209256_1000712 3300025299 Bacteria 44167
189 Ga0209256_1000798 3300025299 Bacteria 40339
190 Ga0209256_1001186 3300025299 Bacteria 29235
191 Ga0207426_1001995 3300025302 Bacteria 14432
192 Ga0207426_1040608 3300025302 Bacteria 1448
193 Ga0209051_1019929 3300025303 Bacteria 2910
194 Ga0209257_1000097 3300025304 Bacteria 259243
195 Ga0209257_1004311 3300025304 Bacteria 11180
196 Ga0207655_1000322 3300025728 Bacteria 70535
197 Ga0207642_10004999 3300025899 Bacteria 4303
198 Ga0207710_10014571 3300025900 Bacteria 3318
199 Ga0207707_10024296 3300025912 Bacteria 5304
200 Ga0207695_10019207 3300025913 Bacteria 7872
201 Ga0207695_10176320 3300025913 Bacteria 2060
202 Ga0207660_10021162 3300025917 Bacteria 4372
203 Ga0207660_10203463 3300025917 Bacteria 1547
204 Ga0207657_10826197 3300025919 Unclassified 716
205 Ga0207652_10004148 3300025921 Bacteria 11825
206 Ga0207652_10275863 3300025921 Bacteria 1517
207 Ga0207652_10504379 3300025921 Unclassified 1089
208 Ga0207646_10013686 3300025922 Bacteria 7748
209 Ga0207650_10174680 3300025925 Bacteria 1709
210 Ga0207687_10010116 3300025927 Bacteria 6167
211 Ga0207690_10000985 3300025932 Bacteria 18246
212 Ga0207686_10004055 3300025934 Bacteria 7863
213 Ga0207709_10061639 3300025935 Bacteria 2345
214 Ga0207689_10010105 3300025942 Bacteria 8137
215 Ga0207661_10452139 3300025944 Unclassified 1170
216 Ga0207679_10139708 3300025945 Bacteria 1956
217 Ga0207679_10232208 3300025945 Bacteria 1558
218 Ga0207667_10055259 3300025949 Bacteria 4174
219 Ga0207667_10563719 3300025949 Bacteria 1151
220 Ga0207640_10472602 3300025981 Bacteria 1038
221 Ga0207640_11058384 3300025981 Unclassified 716
222 Ga0207639_10674657 3300026041 Bacteria 957
223 Ga0207678_10676839 3300026067 Bacteria 907
224 Ga0207708_10001674 3300026075 Bacteria 16451
225 Ga0207702_10185660 3300026078 Unclassified 1917
226 Ga0207641_11964450 3300026088 Bacteria 586
227 Ga0207648_10010955 3300026089 Bacteria 8566
228 Ga0207676_12068184 3300026095 Bacteria 568
229 Ga0207675_100004136 3300026118 Bacteria 14047
230 Ga0207683_10033238 3300026121 Bacteria 4480
231 Ga0207698_10649955 3300026142 Bacteria 1044
232 Ga0207698_11055522 3300026142 Bacteria 824
233 Ga0207698_12622449 3300026142 Bacteria 513
234 Ga0209179_1003857 3300027512 Bacteria 2207
235 Ga0207428_10427179 3300027907 Bacteria 968
236 Ga0268266_12133974 3300028379 Bacteria 533
237 Ga0268265_10102542 3300028380 Bacteria 2315
238 Ga0307515_10238975 3300028794 Bacteria 1592
239 Ga0307408_100000136 3300031548 Bacteria 81550
240 Ga0307408_100001264 3300031548 Bacteria 18976
241 Ga0307408_100002943 3300031548 Bacteria 11798
242 Ga0307408_100007763 3300031548 Bacteria 7092
243 Ga0307408_100098646 3300031548 Bacteria 2221
244 Ga0307406_10008672 3300031901 Bacteria 5681
245 Ga0307406_10703100 3300031901 Bacteria 844
246 Ga0307416_100343372 3300032002 Bacteria 1507
247 Ga0307416_103512207 3300032002 Unclassified 524
248 Ga0316583_10007949 3300032133 Bacteria 3824
249 Ga0315911_1000009 3300033442 Bacteria 379354
250 Ga0373926_0349489 3300035083 Bacteria 580
251 Ga0373934_0233417 3300035086 Bacteria 759
252 Ga0373923_0327759 3300035111 Bacteria 728
253 Ga0373945_0190812 3300035116 Bacteria 847
254 Ga0373953_0009518 3300035117 Bacteria 3349
255 Ga0373956_0037424 3300035119 Bacteria 2145
256 Ga0373957_0108698 3300035120 Bacteria 1115
257 Ga0373946_0042413 3300035171 Bacteria 1870
258 Ga0373955_0234462 3300035172 Bacteria 1098
259 Ga0373933_0261631 3300035724 Bacteria 1115
260 Ga0373947_0050051 3300035725 Bacteria 2511
261 Ga0373947_0253406 3300035725 Unclassified 1164
262 Ga0373937_0026630 3300036401 Bacteria 5224
263 Ga0373925_0077079 3300037068 Bacteria 2529
264 Ga0373925_0164514 3300037068 Bacteria 1749
265 Ga0395899_0157236 3300037312 Bacteria 1608
266 Ga0395900_0015727 3300037418 Bacteria 7715
267 Ga0395905_0035826 3300037471 Bacteria 4660
268 Ga0395901_0382761 3300038443 Bacteria 1448
269 Ga0400483_008570 3300039062 Bacteria 14753
270 Ga0400483_036611 3300039062 Bacteria 1070
271 Ga0400483_037416 3300039062 Bacteria 2148
272 Ga0400483_212408 3300039062 Bacteria 1194
273 Ga0400483_232074 3300039062 Bacteria 2782
274 Ga0400483_244789 3300039062 Bacteria 7374
275 Ga0436361_0141479 3300039447 Bacteria 768
276 Ga0436361_0206192 3300039447 Bacteria 1247
277 Ga0436361_0543848 3300039447 Bacteria 100906
278 Ga0436362_1060925 3300039453 Bacteria 692
279 Ga0451807_0661789 3300041486 Bacteria 716
280 Ga0451853_0937781 3300041512 Bacteria 591
281 Ga0451853_3216985 3300041512 Bacteria 511
282 Ga0439448_0323086 3300042005 Bacteria 549
283 Ga0450923_066779 3300042125 Bacteria 792
284 Ga0450891_011426 3300042129 Bacteria 822
285 Ga0450893_0028475 3300042532 Bacteria 988
286 Ga0466986_0129293 3300044650 Bacteria 1722
287 Ga0466969_0010208 3300044656 Bacteria 4978
288 Ga0466969_0021124 3300044656 Bacteria 3368
289 Ga0466969_0045648 3300044656 Bacteria 2174
290 Ga0466972_0000818 3300044658 Bacteria 14877
291 Ga0466972_0176155 3300044658 Bacteria 1003
292 Ga0466978_0002487 3300044671 Bacteria 7974
293 Ga0466982_0006703 3300044672 Bacteria 5600
294 Ga0466965_0077856 3300044683 Bacteria 1674
295 Ga0466965_0081970 3300044683 Bacteria 1631
296 Ga0466965_0110432 3300044683 Bacteria 1412
297 Ga0466966_0037298 3300044684 Bacteria 3135
298 Ga0466966_0061629 3300044684 Bacteria 2365
299 Ga0466966_0385227 3300044684 Bacteria 842
300 Ga0466961_0000035 3300044693 Bacteria 82931
301 Ga0466961_0003428 3300044693 Bacteria 9891
302 Ga0466961_0006965 3300044693 Bacteria 7190
303 Ga0466963_0049687 3300044694 Bacteria 2774
304 Ga0466963_0243176 3300044694 Bacteria 1262
305 Ga0466964_0005799 3300044706 Bacteria 4597
306 Ga0466964_0012112 3300044706 Bacteria 3262
307 Ga0453684_0045758 3300044712 Bacteria 5831
308 Ga0466970_0000594 3300044765 Bacteria 17767
309 Ga0466970_0017428 3300044765 Bacteria 3711
310 Ga0466970_0030213 3300044765 Bacteria 2857
311 Ga0466957_0176305 3300044842 Bacteria 1394
312 Ga0466957_0303921 3300044842 Bacteria 1072
313 Ga0466960_0016041 3300044901 Bacteria 3241
314 Ga0466960_0157019 3300044901 Bacteria 1219
315 Ga0466959_0000054 3300045049 Bacteria 79861
316 Ga0466959_0005546 3300045049 Bacteria 8659
317 Ga0466959_0006183 3300045049 Bacteria 8273
318 Ga0466959_0263008 3300045049 Bacteria 1187
319 Ga0466959_0461921 3300045049 Bacteria 860
320 Ga0451576_2525774 3300045051 Bacteria 524
321 Ga0466958_0098138 3300045836 Bacteria 1818
322 Ga0466958_0386394 3300045836 Bacteria 903
323 Ga0466967_0012606 3300045976 Bacteria 6478
324 Ga0466967_0129161 3300045976 Bacteria 2344
325 Ga0466967_0434486 3300045976 Bacteria 1281
326 Ga0495603_0036999 3300046455 Bacteria 2929
327 Ga0495590_0046645 3300046457 Bacteria 1512
328 Ga0495638_0188774 3300046460 Bacteria 1170
329 Ga0495651_0059752 3300046462 Bacteria 2922
330 Ga0495653_0047687 3300046463 Bacteria 3313
331 Ga0495584_0022915 3300046491 Bacteria 3168
332 Ga0495585_0001411 3300046492 Bacteria 18902
333 Ga0495596_0005469 3300046500 Bacteria 5996
334 Ga0495607_0008913 3300046501 Bacteria 6831
335 Ga0495583_0019589 3300046506 Bacteria 3527
336 Ga0495608_0288986 3300046511 Bacteria 1016
337 Ga0495616_0014775 3300046513 Bacteria 4359
338 Ga0495652_0633497 3300046529 Bacteria 726
339 Ga0495587_0031496 3300046536 Bacteria 3211
340 Ga0495609_0000637 3300046538 Bacteria 27304
341 Ga0495633_0363363 3300046558 Bacteria 655
342 Ga0495667_0089033 3300046559 Bacteria 2001
343 Ga0495625_0002253 3300046660 Bacteria 21209
344 Ga0495625_0005445 3300046660 Bacteria 11604
345 Ga0495625_0150256 3300046660 Bacteria 1566
346 Ga0495588_0062060 3300046674 Bacteria 1937
347 Ga0495657_0195521 3300046675 Bacteria 1234
348 Ga0495669_0000434 3300046684 Bacteria 19893
349 Ga0495613_0186478 3300046689 Bacteria 1468
350 Ga0495671_0205904 3300046692 Unclassified 954
351 Ga0495649_0132731 3300046694 Bacteria 1313
352 Ga0495600_0387612 3300046809 Bacteria 871
353 Ga0495660_0162307 3300046810 Bacteria 1095
354 Ga0495636_0005092 3300047318 Bacteria 5163
355 Ga0495636_0015927 3300047318 Bacteria 2998
356 Ga0495674_0764231 3300047319 Bacteria 754
357 Ga0495680_0137817 3300047322 Bacteria 1788
358 Ga0495677_0063234 3300047445 Bacteria 1374
359 Ga0495685_000659 3300047447 Bacteria 10538
360 Ga0495681_0001428 3300047470 Bacteria 17955
361 Ga0495684_0957706 3300047471 Bacteria 547
362 Ga0495686_0001460 3300047472 Bacteria 25736
363 Ga0495602_0330278 3300048088 Bacteria 1106
364 Ga0495602_0494302 3300048088 Bacteria 856
365 Ga0496107_0237333 3300048910 Bacteria 1357
366 Ga0496108_0168447 3300048911 Bacteria 1894
367 Ga0496109_0072475 3300048912 Bacteria 3164
368 Ga0496111_0015728 3300048914 Bacteria 5202
369 Ga0496112_0233288 3300048915 Bacteria 1794
370 Ga0496112_0366988 3300048915 Bacteria 1381
371 Ga0496113_0018655 3300048916 Bacteria 4835
372 Ga0496116_0000046 3300048919 Bacteria 323643
373 Ga0496116_0080538 3300048919 Bacteria 2022
374 Ga0496117_0105965 3300048920 Bacteria 1765
375 Ga0496118_0110002 3300048921 Bacteria 1832
376 Ga0496118_0443113 3300048921 Bacteria 661
377 Ga0496121_0081930 3300048924 Bacteria 2553
378 Ga0496121_0089214 3300048924 Bacteria 2415
379 Ga0496122_0003121 3300048925 Bacteria 22193
380 Ga0496123_0000303 3300048926 Bacteria 95638
381 Ga0496125_0737821 3300048928 Bacteria 518
382 Ga0501034_0842650 3300049571 Bacteria 807
383 Ga0501036_1449181 3300049572 Unclassified 556
384 Ga0501046_0740989 3300049580 Bacteria 691
385 Ga0501047_0192595 3300049581 Bacteria 1902
386 Ga0501048_1253837 3300049582 Bacteria 533
387 Ga0501075_0455907 3300049591 Bacteria 975
388 Ga0501076_0108714 3300049592 Bacteria 2240
389 Ga0501223_012613 3300049663 Bacteria 1688
390 Ga0501279_000770 3300049775 Bacteria 4188
391 Ga0501035_0656588 3300049822 Bacteria 850
392 Ga0501226_023433 3300049853 Bacteria 687
393 nmdc:mga07m45_225520_c1 3300050496 Unclassified 1090
394 nmdc:mga06r32_1070667_c1 3300050510 Bacteria 756
395 nmdc:mga08y16_678711_c1 3300050511 Bacteria 1032
396 Ga0495601_0106843 3300053077 Bacteria 1810
397 Ga0495595_0002379 3300053084 Bacteria 7334
398 Ga0500619_000018 3300053154 Bacteria 52926
399 Ga0500622_0003492 3300053156 Bacteria 10432
400 Ga0500622_0299996 3300053156 Bacteria 685
401 Ga0500622_0315549 3300053156 Bacteria 660
402 Ga0466962_0107880 3300061719 Bacteria 1339
403 Ga0466962_0321421 3300061719 Bacteria 768
404 Ga0530510_0030175 3300061734 Bacteria 3893

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0045758 Ga0453684_0045758_653_988 106
2 3300005445 Ga0070708_100000270 Ga0070708_10000027033 108
3 3300039062 Ga0400483_036611 Ga0400483_036611_531_869 108
4 3300039062 Ga0400483_212408 Ga0400483_212408_592_930 108
5 3300005841 Ga0068863_101592132 Ga0068863_1015921322 110
6 3300026088 Ga0207641_11964450 Ga0207641_119644502 110
7 iso_pu_bacteria 2513237096 2513661912 110
8 iso_pu_bacteria 2513237137 2513857465 110
9 iso_pu_bacteria 2513237145 2513923507 110
10 iso_pu_bacteria 2517572143 2517893423 110
11 iso_pu_bacteria 2547132374 2548500767 110
12 iso_pu_bacteria 2554235341 2555669521 110
13 iso_pu_bacteria 2596583598 2597031000 110
14 iso_pu_bacteria 2599185161 2599363878 110
15 iso_pu_bacteria 2599185162 2599370198 110
16 iso_pu_bacteria 2599185163 2599372505 110
17 iso_pu_bacteria 2599185166 2599391364 110
18 iso_pu_bacteria 2599185168 2599407610 110
19 iso_pu_bacteria 2599185178 2599445920 110
20 iso_pu_bacteria 2643221554 2643789823 110
21 iso_pu_bacteria 2643221638 2644214455 110
22 iso_pu_bacteria 2643221645 2644249814 110
23 iso_pu_bacteria 2643221653 2644297274 110
24 iso_pu_bacteria 2643221717 2644646681 110
25 iso_pu_bacteria 2643221719 2644655527 110
26 iso_pu_bacteria 2818991442 2819576898 110
27 iso_pu_bacteria 2818991464 2819705698 110
28 iso_pu_bacteria 2842718218 2842719750 110
29 iso_pu_bacteria 2852103415 2852103961 110
30 iso_pu_bacteria 2885266251 2885268260 110
31 iso_pu_bacteria 2903748898 2903755585 110
32 iso_pu_bacteria 2906610324 2906617375 110
33 iso_pu_bacteria 2906635258 2906640641 110
34 iso_pu_bacteria 2906660503 2906665860 110
35 iso_pu_bacteria 2917070673 2917073334 110
36 iso_pu_bacteria 2922425934 2922429047 110
37 iso_pu_bacteria 2928058823 2928059070 110
38 iso_pu_bacteria 2935630451 2935634396 110
39 iso_pu_bacteria 2941507105 2941511286 110
40 iso_pu_bacteria 2941515067 2941518670 110
41 iso_pu_bacteria 2941523033 2941530406 110
42 iso_pu_bacteria 2990710928 2990714862 110
43 iso_pu_bacteria 3005474847 3005479201 110
44 iso_pu_bacteria 8019555841 8019557879 110
45 iso_pu_bacteria 8019565922 8019567411 110
46 3300046660 Ga0495625_0150256 Ga0495625_0150256_622_957 111
47 3300047319 Ga0495674_0764231 Ga0495674_0764231_43_399 111
48 3300048088 Ga0495602_0494302 Ga0495602_0494302_378_734 111
49 3300005458 Ga0070681_10000351 Ga0070681_1000035127 112
50 3300005530 Ga0070679_100000931 Ga0070679_10000093123 112
51 3300005578 Ga0068854_100216812 Ga0068854_1002168122 112
52 3300007788 Ga0099795_10010068 Ga0099795_100100684 112
53 3300009093 Ga0105240_10149146 Ga0105240_101491463 112
54 3300010159 Ga0099796_10198586 Ga0099796_101985862 112
55 3300013104 Ga0157370_10003780 Ga0157370_1000378015 112
56 3300013307 Ga0157372_10054060 Ga0157372_100540602 112
57 3300025912 Ga0207707_10024296 Ga0207707_100242963 112
58 3300025913 Ga0207695_10176320 Ga0207695_101763202 112
59 3300025917 Ga0207660_10021162 Ga0207660_100211623 112
60 3300025921 Ga0207652_10004148 Ga0207652_1000414811 112
61 3300025981 Ga0207640_10472602 Ga0207640_104726022 112
62 3300027512 Ga0209179_1003857 Ga0209179_10038572 112
63 3300035083 Ga0373926_0349489 Ga0373926_0349489_44_382 112
64 3300035111 Ga0373923_0327759 Ga0373923_0327759_35_373 112
65 3300035116 Ga0373945_0190812 Ga0373945_0190812_101_439 112
66 3300035171 Ga0373946_0042413 Ga0373946_0042413_38_376 112
67 3300035725 Ga0373947_0050051 Ga0373947_0050051_684_1022 112
68 3300037068 Ga0373925_0077079 Ga0373925_0077079_433_771 112
69 3300041512 Ga0451853_3216985 Ga0451853_3216985_87_434 112
70 3300049572 Ga0501036_1449181 Ga0501036_1449181_115_492 112
71 3300049580 Ga0501046_0740989 Ga0501046_0740989_25_363 112
72 3300049591 Ga0501075_0455907 Ga0501075_0455907_109_447 112
73 3300049592 Ga0501076_0108714 Ga0501076_0108714_479_817 112
74 3300061734 Ga0530510_0030175 Ga0530510_0030175_3102_3440 112
75 3300001979 JGI24740J21852_10000077 JGI24740J21852_1000007728 114
76 3300002705 JGI25156J39149_1024990 JGI25156J39149_10249902 114
77 3300002738 JGI25154J39366_1001752 JGI25154J39366_10017525 114
78 3300002739 JGI25158J39367_1005523 JGI25158J39367_10055232 114
79 3300002741 JGI25157J39369_1031449 JGI25157J39369_10314491 114
80 3300002741 JGI25157J39369_1040306 JGI25157J39369_10403061 114
81 3300002773 JGI25152J39213_1000342 JGI25152J39213_100034226 114
82 3300002773 JGI25152J39213_1014848 JGI25152J39213_10148482 114
83 3300002774 JGI25150J39212_1000839 JGI25150J39212_10008397 114
84 3300002774 JGI25150J39212_1000987 JGI25150J39212_10009873 114
85 3300002987 JGI25159J45721_1003570 JGI25159J45721_10035702 114
86 3300002987 JGI25159J45721_1007785 JGI25159J45721_10077852 114
87 3300003215 JGI25153J46596_10020081 JGI25153J46596_100200813 114
88 3300003322 rootL2_10006290 rootL2_100062903 114
89 3300003322 rootL2_10267707 rootL2_102677071 114
90 3300003323 rootH1_10046375 rootH1_100463752 114
91 3300003323 rootH1_10226935 rootH1_102269352 114
92 3300003373 JGI25407J50210_10165600 JGI25407J50210_101656001 114
93 3300003374 JGI25161J50226_1000275 JGI25161J50226_10002755 114
94 3300003374 JGI25161J50226_1000808 JGI25161J50226_10008089 114
95 3300003578 Ga0006562J51391_1092436 Ga0006562J51391_10924363 114
96 3300003752 Ga0055539_1012469 Ga0055539_10124692 114
97 3300003756 Ga0055533_1001698 Ga0055533_10016982 114
98 3300003762 Ga0055542_1000929 Ga0055542_100092916 114
99 3300003771 Ga0055526_1003349 Ga0055526_10033492 114
100 3300003771 Ga0055526_1041187 Ga0055526_10411872 114
101 3300003773 Ga0055537_1003179 Ga0055537_10031794 114
102 3300003773 Ga0055537_1004797 Ga0055537_10047973 114
103 3300003773 Ga0055537_1007991 Ga0055537_10079913 114
104 3300003773 Ga0055537_1029530 Ga0055537_10295302 114
105 3300003775 Ga0055524_1000628 Ga0055524_100062820 114
106 3300003775 Ga0055524_1001322 Ga0055524_100132211 114
107 3300003775 Ga0055524_1001988 Ga0055524_10019885 114
108 3300003784 Ga0055534_1000658 Ga0055534_10006584 114
109 3300003784 Ga0055534_1007008 Ga0055534_10070082 114
110 3300003791 Ga0055530_10002828 Ga0055530_100028289 114
111 3300003791 Ga0055530_10005473 Ga0055530_100054735 114
112 3300003791 Ga0055530_10007525 Ga0055530_100075254 114
113 3300003794 Ga0055531_10004846 Ga0055531_100048468 114
114 3300003841 Ga0055541_1000403 Ga0055541_10004037 114
115 3300004625 Ga0055543_1001930 Ga0055543_10019302 114
116 3300005262 Ga0065165_1001152 Ga0065165_10011526 114
117 3300005262 Ga0065165_1060548 Ga0065165_10605482 114
118 3300005262 Ga0065165_1131927 Ga0065165_11319271 114
119 3300005290 Ga0065712_10274297 Ga0065712_102742972 114
120 3300005329 Ga0070683_100413688 Ga0070683_1004136882 114
121 3300005331 Ga0070670_100099859 Ga0070670_1000998593 114
122 3300005336 Ga0070680_100070560 Ga0070680_1000705603 114
123 3300005337 Ga0070682_100252854 Ga0070682_1002528542 114
124 3300005339 Ga0070660_101510752 Ga0070660_1015107521 114
125 3300005340 Ga0070689_100014900 Ga0070689_1000149005 114
126 3300005344 Ga0070661_100168719 Ga0070661_1001687192 114
127 3300005344 Ga0070661_100860308 Ga0070661_1008603082 114
128 3300005345 Ga0070692_10562785 Ga0070692_105627851 114
129 3300005364 Ga0070673_102412820 Ga0070673_1024128201 114
130 3300005365 Ga0070688_100179144 Ga0070688_1001791443 114
131 3300005366 Ga0070659_100001564 Ga0070659_10000156413 114
132 3300005366 Ga0070659_101103594 Ga0070659_1011035941 114
133 3300005435 Ga0070714_100610912 Ga0070714_1006109122 114
134 3300005438 Ga0070701_10002701 Ga0070701_100027015 114
135 3300005438 Ga0070701_10935841 Ga0070701_109358411 114
136 3300005440 Ga0070705_100858647 Ga0070705_1008586471 114
137 3300005441 Ga0070700_100018001 Ga0070700_1000180011 114
138 3300005459 Ga0068867_100023673 Ga0068867_1000236734 114
139 3300005467 Ga0070706_100026831 Ga0070706_1000268315 114
140 3300005468 Ga0070707_100006830 Ga0070707_10000683010 114
141 3300005471 Ga0070698_100010194 Ga0070698_1000101941 114
142 3300005518 Ga0070699_100379030 Ga0070699_1003790302 114
143 3300005530 Ga0070679_100202925 Ga0070679_1002029251 114
144 3300005530 Ga0070679_100265629 Ga0070679_1002656292 114
145 3300005530 Ga0070679_100586312 Ga0070679_1005863122 114
146 3300005530 Ga0070679_101048383 Ga0070679_1010483831 114
147 3300005539 Ga0068853_101280950 Ga0068853_1012809502 114
148 3300005539 Ga0068853_102356678 Ga0068853_1023566781 114
149 3300005544 Ga0070686_100782811 Ga0070686_1007828112 114
150 3300005545 Ga0070695_100024164 Ga0070695_1000241646 114
151 3300005546 Ga0070696_100034673 Ga0070696_1000346734 114
152 3300005546 Ga0070696_100465706 Ga0070696_1004657062 114
153 3300005547 Ga0070693_100038300 Ga0070693_1000383003 114
154 3300005549 Ga0070704_100025951 Ga0070704_1000259515 114
155 3300005563 Ga0068855_100021251 Ga0068855_1000212518 114
156 3300005563 Ga0068855_100982210 Ga0068855_1009822102 114
157 3300005564 Ga0070664_100141093 Ga0070664_1001410932 114
158 3300005578 Ga0068854_100087367 Ga0068854_1000873675 114
159 3300005614 Ga0068856_101223894 Ga0068856_1012238942 114
160 3300005615 Ga0070702_100005020 Ga0070702_1000050204 114
161 3300005616 Ga0068852_100032253 Ga0068852_1000322537 114
162 3300005616 Ga0068852_101004496 Ga0068852_1010044962 114
163 3300005616 Ga0068852_102865632 Ga0068852_1028656322 114
164 3300005617 Ga0068859_101398785 Ga0068859_1013987853 114
165 3300005718 Ga0068866_10004982 Ga0068866_100049824 114
166 3300005719 Ga0068861_100010399 Ga0068861_1000103998 114
167 3300005834 Ga0068851_10976093 Ga0068851_109760931 114
168 3300005840 Ga0068870_10591681 Ga0068870_105916813 114
169 3300005842 Ga0068858_100005372 Ga0068858_1000053724 114
170 3300005843 Ga0068860_100016669 Ga0068860_10001666910 114
171 3300005844 Ga0068862_100011795 Ga0068862_1000117951 114
172 3300005981 Ga0081538_10025955 Ga0081538_100259553 114
173 3300005983 Ga0081540_1279893 Ga0081540_12798931 114
174 3300005985 Ga0081539_10075160 Ga0081539_100751602 114
175 3300006237 Ga0097621_100017698 Ga0097621_1000176984 114
176 3300006353 Ga0075370_10507121 Ga0075370_105071212 114
177 3300006358 Ga0068871_100009817 Ga0068871_1000098174 114
178 3300006847 Ga0075431_101328471 Ga0075431_1013284711 114
179 3300006881 Ga0068865_101287964 Ga0068865_1012879642 114
180 3300006931 Ga0097620_101398797 Ga0097620_1013987972 114
181 3300009036 Ga0105244_10000086 Ga0105244_1000008636 114
182 3300009036 Ga0105244_10497764 Ga0105244_104977642 114
183 3300009094 Ga0111539_10469451 Ga0111539_104694512 114
184 3300009098 Ga0105245_10010950 Ga0105245_100109507 114
185 3300009101 Ga0105247_10012684 Ga0105247_100126848 114
186 3300009148 Ga0105243_10003679 Ga0105243_1000367912 114
187 3300009174 Ga0105241_11073299 Ga0105241_110732992 114
188 3300009176 Ga0105242_10014148 Ga0105242_100141484 114
189 3300009177 Ga0105248_11427881 Ga0105248_114278811 114
190 3300009545 Ga0105237_11106878 Ga0105237_111068781 114
191 3300009551 Ga0105238_10579061 Ga0105238_105790611 114
192 3300009551 Ga0105238_11576123 Ga0105238_115761232 114
193 3300009553 Ga0105249_10018354 Ga0105249_100183548 114
194 3300010375 Ga0105239_10371060 Ga0105239_103710602 114
195 3300013102 Ga0157371_10000001 Ga0157371_10000001934 114
196 3300013104 Ga0157370_10005370 Ga0157370_100053707 114
197 3300013104 Ga0157370_10008074 Ga0157370_100080749 114
198 3300013297 Ga0157378_10018884 Ga0157378_100188844 114
199 3300013306 Ga0163162_10056187 Ga0163162_100561875 114
200 3300013307 Ga0157372_10736230 Ga0157372_107362301 114
201 3300014325 Ga0163163_10135855 Ga0163163_101358552 114
202 3300014326 Ga0157380_10166167 Ga0157380_101661672 114
203 3300014326 Ga0157380_11865580 Ga0157380_118655802 114
204 3300014497 Ga0182008_10021161 Ga0182008_100211613 114
205 3300014497 Ga0182008_10619033 Ga0182008_106190331 114
206 3300014968 Ga0157379_10027623 Ga0157379_100276234 114
207 3300014969 Ga0157376_10159089 Ga0157376_101590891 114
208 3300015261 Ga0182006_1017545 Ga0182006_10175454 114
209 3300015261 Ga0182006_1019528 Ga0182006_10195283 114
210 3300015262 Ga0182007_10055299 Ga0182007_100552993 114
211 3300015262 Ga0182007_10102548 Ga0182007_101025481 114
212 3300015265 Ga0182005_1000107 Ga0182005_100010710 114
213 3300017792 Ga0163161_11001143 Ga0163161_110011431 114
214 3300021361 Ga0213872_10000476 Ga0213872_1000047621 114
215 3300025208 Ga0209436_100114 Ga0209436_1001143 114
216 3300025208 Ga0209436_100129 Ga0209436_10012912 114
217 3300025224 Ga0209784_100339 Ga0209784_1003394 114
218 3300025225 Ga0209566_100620 Ga0209566_10062013 114
219 3300025226 Ga0209674_100224 Ga0209674_10022440 114
220 3300025230 Ga0209563_105556 Ga0209563_1055562 114
221 3300025230 Ga0209563_112563 Ga0209563_1125632 114
222 3300025245 Ga0207425_1000013 Ga0207425_1000013258 114
223 3300025245 Ga0207425_1000145 Ga0207425_100014552 114
224 3300025245 Ga0207425_1068994 Ga0207425_10689942 114
225 3300025246 Ga0209646_1000016 Ga0209646_100001645 114
226 3300025250 Ga0209026_1005612 Ga0209026_10056124 114
227 3300025250 Ga0209026_1007920 Ga0209026_10079204 114
228 3300025253 Ga0209677_104336 Ga0209677_1043364 114
229 3300025254 Ga0209148_1000051 Ga0209148_1000051326 114
230 3300025256 Ga0209759_1011668 Ga0209759_10116682 114
231 3300025256 Ga0209759_1054864 Ga0209759_10548641 114
232 3300025258 Ga0209129_1000102 Ga0209129_100010212 114
233 3300025258 Ga0209129_1003102 Ga0209129_10031027 114
234 3300025263 Ga0209565_1000205 Ga0209565_100020567 114
235 3300025263 Ga0209565_1003041 Ga0209565_10030413 114
236 3300025263 Ga0209565_1007218 Ga0209565_10072183 114
237 3300025263 Ga0209565_1007717 Ga0209565_10077172 114
238 3300025263 Ga0209565_1008611 Ga0209565_10086113 114
239 3300025273 Ga0209673_1024819 Ga0209673_10248192 114
240 3300025284 Ga0209130_1000554 Ga0209130_100055427 114
241 3300025284 Ga0209130_1001832 Ga0209130_100183212 114
242 3300025291 Ga0209675_1001036 Ga0209675_100103614 114
243 3300025291 Ga0209675_1004746 Ga0209675_10047462 114
244 3300025295 Ga0209564_1000088 Ga0209564_1000088171 114
245 3300025295 Ga0209564_1001549 Ga0209564_100154921 114
246 3300025295 Ga0209564_1016325 Ga0209564_10163252 114
247 3300025297 Ga0209758_1000031 Ga0209758_1000031206 114
248 3300025298 Ga0209050_1000078 Ga0209050_100007886 114
249 3300025298 Ga0209050_1000899 Ga0209050_100089912 114
250 3300025298 Ga0209050_1001496 Ga0209050_100149620 114
251 3300025299 Ga0209256_1000035 Ga0209256_1000035211 114
252 3300025299 Ga0209256_1000712 Ga0209256_100071222 114
253 3300025299 Ga0209256_1000798 Ga0209256_100079830 114
254 3300025299 Ga0209256_1001186 Ga0209256_100118630 114
255 3300025302 Ga0207426_1001995 Ga0207426_10019952 114
256 3300025302 Ga0207426_1040608 Ga0207426_10406082 114
257 3300025303 Ga0209051_1019929 Ga0209051_10199294 114
258 3300025304 Ga0209257_1000097 Ga0209257_100009764 114
259 3300025304 Ga0209257_1004311 Ga0209257_10043115 114
260 3300025728 Ga0207655_1000322 Ga0207655_100032236 114
261 3300025899 Ga0207642_10004999 Ga0207642_100049994 114
262 3300025900 Ga0207710_10014571 Ga0207710_100145714 114
263 3300025913 Ga0207695_10019207 Ga0207695_100192078 114
264 3300025917 Ga0207660_10203463 Ga0207660_102034633 114
265 3300025919 Ga0207657_10826197 Ga0207657_108261972 114
266 3300025921 Ga0207652_10275863 Ga0207652_102758632 114
267 3300025921 Ga0207652_10504379 Ga0207652_105043792 114
268 3300025922 Ga0207646_10013686 Ga0207646_100136868 114
269 3300025925 Ga0207650_10174680 Ga0207650_101746803 114
270 3300025927 Ga0207687_10010116 Ga0207687_100101164 114
271 3300025932 Ga0207690_10000985 Ga0207690_100009858 114
272 3300025934 Ga0207686_10004055 Ga0207686_100040553 114
273 3300025935 Ga0207709_10061639 Ga0207709_100616391 114
274 3300025942 Ga0207689_10010105 Ga0207689_100101054 114
275 3300025944 Ga0207661_10452139 Ga0207661_104521392 114
276 3300025945 Ga0207679_10139708 Ga0207679_101397082 114
277 3300025945 Ga0207679_10232208 Ga0207679_102322083 114
278 3300025949 Ga0207667_10055259 Ga0207667_100552592 114
279 3300025949 Ga0207667_10563719 Ga0207667_105637191 114
280 3300025981 Ga0207640_11058384 Ga0207640_110583842 114
281 3300026041 Ga0207639_10674657 Ga0207639_106746572 114
282 3300026067 Ga0207678_10676839 Ga0207678_106768392 114
283 3300026075 Ga0207708_10001674 Ga0207708_100016748 114
284 3300026078 Ga0207702_10185660 Ga0207702_101856602 114
285 3300026089 Ga0207648_10010955 Ga0207648_100109552 114
286 3300026095 Ga0207676_12068184 Ga0207676_120681841 114
287 3300026118 Ga0207675_100004136 Ga0207675_10000413610 114
288 3300026121 Ga0207683_10033238 Ga0207683_100332382 114
289 3300026142 Ga0207698_10649955 Ga0207698_106499551 114
290 3300026142 Ga0207698_11055522 Ga0207698_110555222 114
291 3300026142 Ga0207698_12622449 Ga0207698_126224492 114
292 3300027907 Ga0207428_10427179 Ga0207428_104271792 114
293 3300028379 Ga0268266_12133974 Ga0268266_121339742 114
294 3300028380 Ga0268265_10102542 Ga0268265_101025423 114
295 3300028794 Ga0307515_10238975 Ga0307515_102389751 114
296 3300031548 Ga0307408_100000136 Ga0307408_10000013667 114
297 3300031548 Ga0307408_100001264 Ga0307408_1000012642 114
298 3300031548 Ga0307408_100002943 Ga0307408_1000029439 114
299 3300031548 Ga0307408_100007763 Ga0307408_1000077635 114
300 3300031548 Ga0307408_100098646 Ga0307408_1000986464 114
301 3300031901 Ga0307406_10008672 Ga0307406_100086725 114
302 3300031901 Ga0307406_10703100 Ga0307406_107031001 114
303 3300032002 Ga0307416_100343372 Ga0307416_1003433722 114
304 3300032002 Ga0307416_103512207 Ga0307416_1035122071 114
305 3300032133 Ga0316583_10007949 Ga0316583_100079493 114
306 3300033442 Ga0315911_1000009 Ga0315911_100000937 114
307 3300035086 Ga0373934_0233417 Ga0373934_0233417_151_495 114
308 3300035117 Ga0373953_0009518 Ga0373953_0009518_1586_1930 114
309 3300035119 Ga0373956_0037424 Ga0373956_0037424_1063_1407 114
310 3300035120 Ga0373957_0108698 Ga0373957_0108698_549_893 114
311 3300035172 Ga0373955_0234462 Ga0373955_0234462_194_538 114
312 3300035724 Ga0373933_0261631 Ga0373933_0261631_574_918 114
313 3300035725 Ga0373947_0253406 Ga0373947_0253406_542_889 114
314 3300036401 Ga0373937_0026630 Ga0373937_0026630_4756_5100 114
315 3300037068 Ga0373925_0164514 Ga0373925_0164514_118_465 114
316 3300037312 Ga0395899_0157236 Ga0395899_0157236_57_401 114
317 3300037418 Ga0395900_0015727 Ga0395900_0015727_5716_6063 114
318 3300037471 Ga0395905_0035826 Ga0395905_0035826_3229_3573 114
319 3300038443 Ga0395901_0382761 Ga0395901_0382761_24_383 114
320 3300039062 Ga0400483_008570 Ga0400483_008570_14202_14546 114
321 3300039062 Ga0400483_037416 Ga0400483_037416_66_410 114
322 3300039062 Ga0400483_232074 Ga0400483_232074_2355_2699 114
323 3300039062 Ga0400483_244789 Ga0400483_244789_2791_3135 114
324 3300039447 Ga0436361_0141479 Ga0436361_0141479_367_753 114
325 3300039447 Ga0436361_0206192 Ga0436361_0206192_544_903 114
326 3300039447 Ga0436361_0543848 Ga0436361_0543848_93850_94236 114
327 3300039453 Ga0436362_1060925 Ga0436362_1060925_34_393 114
328 3300041486 Ga0451807_0661789 Ga0451807_0661789_357_701 114
329 3300041512 Ga0451853_0937781 Ga0451853_0937781_45_389 114
330 3300042005 Ga0439448_0323086 Ga0439448_0323086_26_373 114
331 3300042125 Ga0450923_066779 Ga0450923_066779_290_634 114
332 3300042129 Ga0450891_011426 Ga0450891_011426_431_775 114
333 3300042532 Ga0450893_0028475 Ga0450893_0028475_263_607 114
334 3300044650 Ga0466986_0129293 Ga0466986_0129293_1033_1377 114
335 3300044656 Ga0466969_0010208 Ga0466969_0010208_3167_3511 114
336 3300044656 Ga0466969_0021124 Ga0466969_0021124_271_684 114
337 3300044656 Ga0466969_0045648 Ga0466969_0045648_532_888 114
338 3300044658 Ga0466972_0000818 Ga0466972_0000818_8876_9220 114
339 3300044658 Ga0466972_0176155 Ga0466972_0176155_366_713 114
340 3300044671 Ga0466978_0002487 Ga0466978_0002487_862_1206 114
341 3300044672 Ga0466982_0006703 Ga0466982_0006703_2436_2780 114
342 3300044683 Ga0466965_0077856 Ga0466965_0077856_141_485 114
343 3300044683 Ga0466965_0081970 Ga0466965_0081970_30_386 114
344 3300044683 Ga0466965_0110432 Ga0466965_0110432_557_904 114
345 3300044684 Ga0466966_0037298 Ga0466966_0037298_1022_1369 114
346 3300044684 Ga0466966_0061629 Ga0466966_0061629_855_1211 114
347 3300044684 Ga0466966_0385227 Ga0466966_0385227_177_590 114
348 3300044693 Ga0466961_0000035 Ga0466961_0000035_43938_44282 114
349 3300044693 Ga0466961_0003428 Ga0466961_0003428_6691_7050 114
350 3300044693 Ga0466961_0006965 Ga0466961_0006965_2028_2384 114
351 3300044694 Ga0466963_0049687 Ga0466963_0049687_1084_1440 114
352 3300044694 Ga0466963_0243176 Ga0466963_0243176_240_584 114
353 3300044706 Ga0466964_0005799 Ga0466964_0005799_1399_1743 114
354 3300044706 Ga0466964_0012112 Ga0466964_0012112_2098_2454 114
355 3300044765 Ga0466970_0000594 Ga0466970_0000594_13026_13370 114
356 3300044765 Ga0466970_0017428 Ga0466970_0017428_1361_1717 114
357 3300044765 Ga0466970_0030213 Ga0466970_0030213_1242_1589 114
358 3300044842 Ga0466957_0176305 Ga0466957_0176305_37_381 114
359 3300044842 Ga0466957_0303921 Ga0466957_0303921_21_377 114
360 3300044901 Ga0466960_0016041 Ga0466960_0016041_146_493 114
361 3300044901 Ga0466960_0157019 Ga0466960_0157019_174_518 114
362 3300045049 Ga0466959_0000054 Ga0466959_0000054_9534_9890 114
363 3300045049 Ga0466959_0005546 Ga0466959_0005546_4449_4793 114
364 3300045049 Ga0466959_0006183 Ga0466959_0006183_6801_7160 114
365 3300045049 Ga0466959_0263008 Ga0466959_0263008_95_508 114
366 3300045049 Ga0466959_0461921 Ga0466959_0461921_132_476 114
367 3300045051 Ga0451576_2525774 Ga0451576_2525774_101_448 114
368 3300045836 Ga0466958_0098138 Ga0466958_0098138_464_820 114
369 3300045836 Ga0466958_0386394 Ga0466958_0386394_186_530 114
370 3300045976 Ga0466967_0012606 Ga0466967_0012606_4542_4886 114
371 3300045976 Ga0466967_0129161 Ga0466967_0129161_954_1298 114
372 3300045976 Ga0466967_0434486 Ga0466967_0434486_372_716 114
373 3300046455 Ga0495603_0036999 Ga0495603_0036999_137_484 114
374 3300046457 Ga0495590_0046645 Ga0495590_0046645_746_1102 114
375 3300046460 Ga0495638_0188774 Ga0495638_0188774_609_965 114
376 3300046462 Ga0495651_0059752 Ga0495651_0059752_1840_2184 114
377 3300046463 Ga0495653_0047687 Ga0495653_0047687_2875_3219 114
378 3300046491 Ga0495584_0022915 Ga0495584_0022915_2661_3017 114
379 3300046492 Ga0495585_0001411 Ga0495585_0001411_5114_5461 114
380 3300046500 Ga0495596_0005469 Ga0495596_0005469_3924_4268 114
381 3300046501 Ga0495607_0008913 Ga0495607_0008913_608_964 114
382 3300046506 Ga0495583_0019589 Ga0495583_0019589_2579_2935 114
383 3300046511 Ga0495608_0288986 Ga0495608_0288986_242_586 114
384 3300046513 Ga0495616_0014775 Ga0495616_0014775_3748_4104 114
385 3300046529 Ga0495652_0633497 Ga0495652_0633497_338_682 114
386 3300046536 Ga0495587_0031496 Ga0495587_0031496_1174_1518 114
387 3300046538 Ga0495609_0000637 Ga0495609_0000637_5819_6175 114
388 3300046558 Ga0495633_0363363 Ga0495633_0363363_179_526 114
389 3300046559 Ga0495667_0089033 Ga0495667_0089033_561_905 114
390 3300046660 Ga0495625_0002253 Ga0495625_0002253_19099_19446 114
391 3300046660 Ga0495625_0005445 Ga0495625_0005445_5382_5738 114
392 3300046674 Ga0495588_0062060 Ga0495588_0062060_425_772 114
393 3300046675 Ga0495657_0195521 Ga0495657_0195521_561_905 114
394 3300046684 Ga0495669_0000434 Ga0495669_0000434_5829_6185 114
395 3300046689 Ga0495613_0186478 Ga0495613_0186478_713_1060 114
396 3300046692 Ga0495671_0205904 Ga0495671_0205904_267_614 114
397 3300046694 Ga0495649_0132731 Ga0495649_0132731_829_1185 114
398 3300046809 Ga0495600_0387612 Ga0495600_0387612_89_433 114
399 3300046810 Ga0495660_0162307 Ga0495660_0162307_650_1006 114
400 3300047318 Ga0495636_0005092 Ga0495636_0005092_3497_3853 114
401 3300047318 Ga0495636_0015927 Ga0495636_0015927_1650_2009 114
402 3300047322 Ga0495680_0137817 Ga0495680_0137817_1247_1591 114
403 3300047445 Ga0495677_0063234 Ga0495677_0063234_743_1099 114
404 3300047447 Ga0495685_000659 Ga0495685_000659_4554_4910 114
405 3300047470 Ga0495681_0001428 Ga0495681_0001428_5731_6087 114
406 3300047471 Ga0495684_0957706 Ga0495684_0957706_135_479 114
407 3300047472 Ga0495686_0001460 Ga0495686_0001460_11472_11831 114
408 3300048088 Ga0495602_0330278 Ga0495602_0330278_532_876 114
409 3300048910 Ga0496107_0237333 Ga0496107_0237333_365_718 114
410 3300048911 Ga0496108_0168447 Ga0496108_0168447_1378_1722 114
411 3300048912 Ga0496109_0072475 Ga0496109_0072475_2307_2651 114
412 3300048914 Ga0496111_0015728 Ga0496111_0015728_1508_1852 114
413 3300048915 Ga0496112_0233288 Ga0496112_0233288_445_789 114
414 3300048915 Ga0496112_0366988 Ga0496112_0366988_1014_1367 114
415 3300048916 Ga0496113_0018655 Ga0496113_0018655_1837_2181 114
416 3300048919 Ga0496116_0000046 Ga0496116_0000046_22429_22776 114
417 3300048919 Ga0496116_0080538 Ga0496116_0080538_272_616 114
418 3300048920 Ga0496117_0105965 Ga0496117_0105965_821_1165 114
419 3300048921 Ga0496118_0110002 Ga0496118_0110002_484_828 114
420 3300048921 Ga0496118_0443113 Ga0496118_0443113_23_370 114
421 3300048924 Ga0496121_0081930 Ga0496121_0081930_1642_1995 114
422 3300048924 Ga0496121_0089214 Ga0496121_0089214_1099_1449 114
423 3300048925 Ga0496122_0003121 Ga0496122_0003121_9162_9509 114
424 3300048926 Ga0496123_0000303 Ga0496123_0000303_9429_9776 114
425 3300048928 Ga0496125_0737821 Ga0496125_0737821_65_412 114
426 3300049571 Ga0501034_0842650 Ga0501034_0842650_129_473 114
427 3300049581 Ga0501047_0192595 Ga0501047_0192595_990_1364 114
428 3300049582 Ga0501048_1253837 Ga0501048_1253837_98_472 114
429 3300049663 Ga0501223_012613 Ga0501223_012613_193_537 114
430 3300049775 Ga0501279_000770 Ga0501279_000770_1305_1649 114
431 3300049822 Ga0501035_0656588 Ga0501035_0656588_364_738 114
432 3300049853 Ga0501226_023433 Ga0501226_023433_190_534 114
433 3300050496 nmdc:mga07m45_225520_c1 nmdc:mga07m45_225520_c1_251_619 114
434 3300050510 nmdc:mga06r32_1070667_c1 nmdc:mga06r32_1070667_c1_55_399 114
435 3300050511 nmdc:mga08y16_678711_c1 nmdc:mga08y16_678711_c1_250_594 114
436 3300053077 Ga0495601_0106843 Ga0495601_0106843_75_419 114
437 3300053084 Ga0495595_0002379 Ga0495595_0002379_5098_5442 114
438 3300053154 Ga0500619_000018 Ga0500619_000018_3048_3392 114
439 3300053156 Ga0500622_0003492 Ga0500622_0003492_817_1176 114
440 3300053156 Ga0500622_0299996 Ga0500622_0299996_114_467 114
441 3300053156 Ga0500622_0315549 Ga0500622_0315549_118_465 114
442 3300061719 Ga0466962_0107880 Ga0466962_0107880_682_1038 114
443 3300061719 Ga0466962_0321421 Ga0466962_0321421_77_427 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

1

70

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.9279 2 93
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.9071 2 98
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.905 2 95
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9043 2 91
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.8906 1 94
ID Description Score Start End Superfamily
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9279 2 93 3.30.70.100
af_Q54J03_9_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.92 2 93 3.30.70.100
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9073 2 95 3.30.70.100
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9071 2 98 3.30.70.100
af_A0A1D8PRM8_52_147_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9056 2 93 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Q4XGP9-F1-model_v4 ABM domain-containing protein 0.9941 2 98 GO:0000166
GO:0016491
AF-A0A1G9CJC5-F1-model_v4 Heme-degrading monooxygenase HmoA 0.9932 1 112 GO:0004497
AF-B2UIF7-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.993 1 114 GO:0004497
AF-A0A2S2CYB5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9915 1 106 GO:0004497
AF-A0A1C3Y5V5-F1-model_v4 Heme-degrading monooxygenase HmoA 0.99 1 113 GO:0004497

Feature Viewer

pLDDT pTM Quality
95.57 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map