F445036
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 443 | 323 | 404 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100000270|Ga0070708_10000027033 |
| Length | 109 |
| Sequence | VIAVIFEAVPYPDKKHAYLDAAAMLRPQLEQIDGFISIERFESLASPGKILSLSYWRDDEAVRRHRRIQAEGRTSIFADYRLRVAQVLRDYGLNDRAQAPEDSRHVHGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 4 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 5 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 6 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 7 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 8 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 9 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 10 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 11 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 12 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 13 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 14 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 15 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 16 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 17 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 18 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 19 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 20 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 21 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 22 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 23 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 24 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 25 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 26 | 2906610324 | |||
| 27 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 28 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 29 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 30 | 2922425934 | |||
| 31 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 32 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 33 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 34 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 35 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 36 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 37 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 38 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 39 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 40 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 41 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 42 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 43 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 44 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 45 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 46 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 47 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 48 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 49 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 51 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 52 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 65 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 119 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 209 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 230 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 233 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 234 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 235 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 236 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 240 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 250 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 319 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 320 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 322 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 323 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.38 |
| Metatranscriptomes | 0.23 |
| Isolates | 8.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.83 |
| Nodule | 3.16 |
| Rhizoplane | 3.16 |
| Rhizosphere | 64.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000077 | 3300001979 | Bacteria | 33090 |
| 2 | JGI25156J39149_1024990 | 3300002705 | Bacteria | 968 |
| 3 | JGI25154J39366_1001752 | 3300002738 | Bacteria | 6974 |
| 4 | JGI25158J39367_1005523 | 3300002739 | Bacteria | 1853 |
| 5 | JGI25157J39369_1031449 | 3300002741 | Bacteria | 604 |
| 6 | JGI25157J39369_1040306 | 3300002741 | Bacteria | 515 |
| 7 | JGI25152J39213_1000342 | 3300002773 | Bacteria | 29633 |
| 8 | JGI25152J39213_1014848 | 3300002773 | Bacteria | 1560 |
| 9 | JGI25150J39212_1000839 | 3300002774 | Bacteria | 10277 |
| 10 | JGI25150J39212_1000987 | 3300002774 | Bacteria | 8919 |
| 11 | JGI25159J45721_1003570 | 3300002987 | Bacteria | 5452 |
| 12 | JGI25159J45721_1007785 | 3300002987 | Bacteria | 3022 |
| 13 | JGI25153J46596_10020081 | 3300003215 | Bacteria | 2536 |
| 14 | rootL2_10006290 | 3300003322 | Bacteria | 5824 |
| 15 | rootL2_10267707 | 3300003322 | Bacteria | 1037 |
| 16 | rootH1_10046375 | 3300003323 | Bacteria | 1139 |
| 17 | rootH1_10226935 | 3300003323 | Bacteria | 1506 |
| 18 | JGI25407J50210_10165600 | 3300003373 | Bacteria | 545 |
| 19 | JGI25161J50226_1000275 | 3300003374 | Bacteria | 29880 |
| 20 | JGI25161J50226_1000808 | 3300003374 | Bacteria | 11786 |
| 21 | Ga0006562J51391_1092436 | 3300003578 | Bacteria | 2850 |
| 22 | Ga0055539_1012469 | 3300003752 | Bacteria | 1044 |
| 23 | Ga0055533_1001698 | 3300003756 | Bacteria | 5614 |
| 24 | Ga0055542_1000929 | 3300003762 | Bacteria | 19409 |
| 25 | Ga0055526_1003349 | 3300003771 | Bacteria | 10232 |
| 26 | Ga0055526_1041187 | 3300003771 | Bacteria | 1154 |
| 27 | Ga0055537_1003179 | 3300003773 | Bacteria | 5134 |
| 28 | Ga0055537_1004797 | 3300003773 | Bacteria | 3781 |
| 29 | Ga0055537_1007991 | 3300003773 | Bacteria | 2485 |
| 30 | Ga0055537_1029530 | 3300003773 | Bacteria | 718 |
| 31 | Ga0055524_1000628 | 3300003775 | Bacteria | 25272 |
| 32 | Ga0055524_1001322 | 3300003775 | Bacteria | 14462 |
| 33 | Ga0055524_1001988 | 3300003775 | Bacteria | 10940 |
| 34 | Ga0055534_1000658 | 3300003784 | Bacteria | 17449 |
| 35 | Ga0055534_1007008 | 3300003784 | Bacteria | 2752 |
| 36 | Ga0055530_10002828 | 3300003791 | Bacteria | 10636 |
| 37 | Ga0055530_10005473 | 3300003791 | Bacteria | 6017 |
| 38 | Ga0055530_10007525 | 3300003791 | Bacteria | 4563 |
| 39 | Ga0055531_10004846 | 3300003794 | Bacteria | 8028 |
| 40 | Ga0055541_1000403 | 3300003841 | Bacteria | 12971 |
| 41 | Ga0055543_1001930 | 3300004625 | Bacteria | 7430 |
| 42 | Ga0065165_1001152 | 3300005262 | Bacteria | 30903 |
| 43 | Ga0065165_1060548 | 3300005262 | Bacteria | 1039 |
| 44 | Ga0065165_1131927 | 3300005262 | Unclassified | 597 |
| 45 | Ga0065712_10274297 | 3300005290 | Bacteria | 909 |
| 46 | Ga0070683_100413688 | 3300005329 | Unclassified | 1286 |
| 47 | Ga0070670_100099859 | 3300005331 | Bacteria | 2498 |
| 48 | Ga0070680_100070560 | 3300005336 | Bacteria | 2869 |
| 49 | Ga0070682_100252854 | 3300005337 | Unclassified | 1271 |
| 50 | Ga0070660_101510752 | 3300005339 | Bacteria | 571 |
| 51 | Ga0070689_100014900 | 3300005340 | Bacteria | 5658 |
| 52 | Ga0070661_100168719 | 3300005344 | Unclassified | 1661 |
| 53 | Ga0070661_100860308 | 3300005344 | Bacteria | 747 |
| 54 | Ga0070692_10562785 | 3300005345 | Bacteria | 749 |
| 55 | Ga0070673_102412820 | 3300005364 | Bacteria | 500 |
| 56 | Ga0070688_100179144 | 3300005365 | Bacteria | 1469 |
| 57 | Ga0070659_100001564 | 3300005366 | Bacteria | 16495 |
| 58 | Ga0070659_101103594 | 3300005366 | Bacteria | 699 |
| 59 | Ga0070714_100610912 | 3300005435 | Bacteria | 1048 |
| 60 | Ga0070701_10002701 | 3300005438 | Bacteria | 6875 |
| 61 | Ga0070701_10935841 | 3300005438 | Unclassified | 600 |
| 62 | Ga0070705_100858647 | 3300005440 | Bacteria | 727 |
| 63 | Ga0070700_100018001 | 3300005441 | Bacteria | 4053 |
| 64 | Ga0070708_100000270 | 3300005445 | Bacteria | 38550 |
| 65 | Ga0070681_10000351 | 3300005458 | Bacteria | 37169 |
| 66 | Ga0068867_100023673 | 3300005459 | Bacteria | 4397 |
| 67 | Ga0070706_100026831 | 3300005467 | Bacteria | 5299 |
| 68 | Ga0070707_100006830 | 3300005468 | Bacteria | 10569 |
| 69 | Ga0070698_100010194 | 3300005471 | Bacteria | 10041 |
| 70 | Ga0070699_100379030 | 3300005518 | Bacteria | 1277 |
| 71 | Ga0070679_100000931 | 3300005530 | Bacteria | 25414 |
| 72 | Ga0070679_100202925 | 3300005530 | Bacteria | 1948 |
| 73 | Ga0070679_100265629 | 3300005530 | Bacteria | 1671 |
| 74 | Ga0070679_100586312 | 3300005530 | Bacteria | 1058 |
| 75 | Ga0070679_101048383 | 3300005530 | Bacteria | 760 |
| 76 | Ga0068853_101280950 | 3300005539 | Bacteria | 708 |
| 77 | Ga0068853_102356678 | 3300005539 | Bacteria | 516 |
| 78 | Ga0070686_100782811 | 3300005544 | Bacteria | 767 |
| 79 | Ga0070695_100024164 | 3300005545 | Bacteria | 3741 |
| 80 | Ga0070696_100034673 | 3300005546 | Bacteria | 3473 |
| 81 | Ga0070696_100465706 | 3300005546 | Bacteria | 1000 |
| 82 | Ga0070693_100038300 | 3300005547 | Bacteria | 2679 |
| 83 | Ga0070704_100025951 | 3300005549 | Bacteria | 3864 |
| 84 | Ga0068855_100021251 | 3300005563 | Bacteria | 7781 |
| 85 | Ga0068855_100982210 | 3300005563 | Bacteria | 888 |
| 86 | Ga0070664_100141093 | 3300005564 | Bacteria | 2122 |
| 87 | Ga0068854_100087367 | 3300005578 | Bacteria | 2313 |
| 88 | Ga0068854_100216812 | 3300005578 | Bacteria | 1512 |
| 89 | Ga0068856_101223894 | 3300005614 | Bacteria | 767 |
| 90 | Ga0070702_100005020 | 3300005615 | Bacteria | 6113 |
| 91 | Ga0068852_100032253 | 3300005616 | Bacteria | 4335 |
| 92 | Ga0068852_101004496 | 3300005616 | Bacteria | 853 |
| 93 | Ga0068852_102865632 | 3300005616 | Bacteria | 500 |
| 94 | Ga0068859_101398785 | 3300005617 | Bacteria | 772 |
| 95 | Ga0068866_10004982 | 3300005718 | Bacteria | 5467 |
| 96 | Ga0068861_100010399 | 3300005719 | Bacteria | 6456 |
| 97 | Ga0068851_10976093 | 3300005834 | Bacteria | 533 |
| 98 | Ga0068870_10591681 | 3300005840 | Bacteria | 753 |
| 99 | Ga0068863_101592132 | 3300005841 | Bacteria | 662 |
| 100 | Ga0068858_100005372 | 3300005842 | Bacteria | 12559 |
| 101 | Ga0068860_100016669 | 3300005843 | Bacteria | 7165 |
| 102 | Ga0068862_100011795 | 3300005844 | Bacteria | 7216 |
| 103 | Ga0081538_10025955 | 3300005981 | Bacteria | 4114 |
| 104 | Ga0081540_1279893 | 3300005983 | Bacteria | 576 |
| 105 | Ga0081539_10075160 | 3300005985 | Bacteria | 1796 |
| 106 | Ga0097621_100017698 | 3300006237 | Bacteria | 5420 |
| 107 | Ga0075370_10507121 | 3300006353 | Bacteria | 728 |
| 108 | Ga0068871_100009817 | 3300006358 | Bacteria | 6948 |
| 109 | Ga0075431_101328471 | 3300006847 | Bacteria | 680 |
| 110 | Ga0068865_101287964 | 3300006881 | Bacteria | 649 |
| 111 | Ga0097620_101398797 | 3300006931 | Bacteria | 772 |
| 112 | Ga0099795_10010068 | 3300007788 | Bacteria | 2769 |
| 113 | Ga0105244_10000086 | 3300009036 | Bacteria | 102288 |
| 114 | Ga0105244_10497764 | 3300009036 | Bacteria | 561 |
| 115 | Ga0105240_10149146 | 3300009093 | Bacteria | 2787 |
| 116 | Ga0111539_10469451 | 3300009094 | Bacteria | 1465 |
| 117 | Ga0105245_10010950 | 3300009098 | Bacteria | 7891 |
| 118 | Ga0105247_10012684 | 3300009101 | Bacteria | 5056 |
| 119 | Ga0105243_10003679 | 3300009148 | Bacteria | 12325 |
| 120 | Ga0105241_11073299 | 3300009174 | Unclassified | 757 |
| 121 | Ga0105242_10014148 | 3300009176 | Bacteria | 6178 |
| 122 | Ga0105248_11427881 | 3300009177 | Bacteria | 783 |
| 123 | Ga0105237_11106878 | 3300009545 | Unclassified | 799 |
| 124 | Ga0105238_10579061 | 3300009551 | Bacteria | 1129 |
| 125 | Ga0105238_11576123 | 3300009551 | Bacteria | 686 |
| 126 | Ga0105249_10018354 | 3300009553 | Bacteria | 6220 |
| 127 | Ga0099796_10198586 | 3300010159 | Bacteria | 813 |
| 128 | Ga0105239_10371060 | 3300010375 | Bacteria | 1617 |
| 129 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 130 | Ga0157370_10003780 | 3300013104 | Bacteria | 17669 |
| 131 | Ga0157370_10005370 | 3300013104 | Bacteria | 14388 |
| 132 | Ga0157370_10008074 | 3300013104 | Bacteria | 11392 |
| 133 | Ga0157378_10018884 | 3300013297 | Bacteria | 6060 |
| 134 | Ga0163162_10056187 | 3300013306 | Bacteria | 3965 |
| 135 | Ga0157372_10054060 | 3300013307 | Bacteria | 4477 |
| 136 | Ga0157372_10736230 | 3300013307 | Bacteria | 1147 |
| 137 | Ga0163163_10135855 | 3300014325 | Bacteria | 2500 |
| 138 | Ga0157380_10166167 | 3300014326 | Bacteria | 1923 |
| 139 | Ga0157380_11865580 | 3300014326 | Bacteria | 661 |
| 140 | Ga0182008_10021161 | 3300014497 | Bacteria | 3343 |
| 141 | Ga0182008_10619033 | 3300014497 | Bacteria | 610 |
| 142 | Ga0157379_10027623 | 3300014968 | Bacteria | 5052 |
| 143 | Ga0157376_10159089 | 3300014969 | Bacteria | 2045 |
| 144 | Ga0182006_1017545 | 3300015261 | Bacteria | 3039 |
| 145 | Ga0182006_1019528 | 3300015261 | Bacteria | 2852 |
| 146 | Ga0182007_10055299 | 3300015262 | Bacteria | 1305 |
| 147 | Ga0182007_10102548 | 3300015262 | Bacteria | 948 |
| 148 | Ga0182005_1000107 | 3300015265 | Bacteria | 60831 |
| 149 | Ga0163161_11001143 | 3300017792 | Bacteria | 713 |
| 150 | Ga0213872_10000476 | 3300021361 | Bacteria | 32395 |
| 151 | Ga0209436_100114 | 3300025208 | Bacteria | 39835 |
| 152 | Ga0209436_100129 | 3300025208 | Bacteria | 37378 |
| 153 | Ga0209784_100339 | 3300025224 | Bacteria | 23132 |
| 154 | Ga0209566_100620 | 3300025225 | Bacteria | 21926 |
| 155 | Ga0209674_100224 | 3300025226 | Bacteria | 52381 |
| 156 | Ga0209563_105556 | 3300025230 | Bacteria | 2267 |
| 157 | Ga0209563_112563 | 3300025230 | Bacteria | 1153 |
| 158 | Ga0207425_1000013 | 3300025245 | Bacteria | 497384 |
| 159 | Ga0207425_1000145 | 3300025245 | Bacteria | 60718 |
| 160 | Ga0207425_1068994 | 3300025245 | Bacteria | 609 |
| 161 | Ga0209646_1000016 | 3300025246 | Bacteria | 501688 |
| 162 | Ga0209026_1005612 | 3300025250 | Bacteria | 3317 |
| 163 | Ga0209026_1007920 | 3300025250 | Bacteria | 2297 |
| 164 | Ga0209677_104336 | 3300025253 | Bacteria | 4138 |
| 165 | Ga0209148_1000051 | 3300025254 | Bacteria | 401000 |
| 166 | Ga0209759_1011668 | 3300025256 | Bacteria | 2480 |
| 167 | Ga0209759_1054864 | 3300025256 | Bacteria | 592 |
| 168 | Ga0209129_1000102 | 3300025258 | Bacteria | 161712 |
| 169 | Ga0209129_1003102 | 3300025258 | Bacteria | 7478 |
| 170 | Ga0209565_1000205 | 3300025263 | Bacteria | 69314 |
| 171 | Ga0209565_1003041 | 3300025263 | Bacteria | 5652 |
| 172 | Ga0209565_1007218 | 3300025263 | Bacteria | 3021 |
| 173 | Ga0209565_1007717 | 3300025263 | Bacteria | 2874 |
| 174 | Ga0209565_1008611 | 3300025263 | Bacteria | 2648 |
| 175 | Ga0209673_1024819 | 3300025273 | Bacteria | 2005 |
| 176 | Ga0209130_1000554 | 3300025284 | Bacteria | 37233 |
| 177 | Ga0209130_1001832 | 3300025284 | Bacteria | 12260 |
| 178 | Ga0209675_1001036 | 3300025291 | Bacteria | 17351 |
| 179 | Ga0209675_1004746 | 3300025291 | Bacteria | 5920 |
| 180 | Ga0209564_1000088 | 3300025295 | Bacteria | 250268 |
| 181 | Ga0209564_1001549 | 3300025295 | Bacteria | 22711 |
| 182 | Ga0209564_1016325 | 3300025295 | Bacteria | 2963 |
| 183 | Ga0209758_1000031 | 3300025297 | Bacteria | 497252 |
| 184 | Ga0209050_1000078 | 3300025298 | Bacteria | 278409 |
| 185 | Ga0209050_1000899 | 3300025298 | Bacteria | 39427 |
| 186 | Ga0209050_1001496 | 3300025298 | Bacteria | 24775 |
| 187 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 188 | Ga0209256_1000712 | 3300025299 | Bacteria | 44167 |
| 189 | Ga0209256_1000798 | 3300025299 | Bacteria | 40339 |
| 190 | Ga0209256_1001186 | 3300025299 | Bacteria | 29235 |
| 191 | Ga0207426_1001995 | 3300025302 | Bacteria | 14432 |
| 192 | Ga0207426_1040608 | 3300025302 | Bacteria | 1448 |
| 193 | Ga0209051_1019929 | 3300025303 | Bacteria | 2910 |
| 194 | Ga0209257_1000097 | 3300025304 | Bacteria | 259243 |
| 195 | Ga0209257_1004311 | 3300025304 | Bacteria | 11180 |
| 196 | Ga0207655_1000322 | 3300025728 | Bacteria | 70535 |
| 197 | Ga0207642_10004999 | 3300025899 | Bacteria | 4303 |
| 198 | Ga0207710_10014571 | 3300025900 | Bacteria | 3318 |
| 199 | Ga0207707_10024296 | 3300025912 | Bacteria | 5304 |
| 200 | Ga0207695_10019207 | 3300025913 | Bacteria | 7872 |
| 201 | Ga0207695_10176320 | 3300025913 | Bacteria | 2060 |
| 202 | Ga0207660_10021162 | 3300025917 | Bacteria | 4372 |
| 203 | Ga0207660_10203463 | 3300025917 | Bacteria | 1547 |
| 204 | Ga0207657_10826197 | 3300025919 | Unclassified | 716 |
| 205 | Ga0207652_10004148 | 3300025921 | Bacteria | 11825 |
| 206 | Ga0207652_10275863 | 3300025921 | Bacteria | 1517 |
| 207 | Ga0207652_10504379 | 3300025921 | Unclassified | 1089 |
| 208 | Ga0207646_10013686 | 3300025922 | Bacteria | 7748 |
| 209 | Ga0207650_10174680 | 3300025925 | Bacteria | 1709 |
| 210 | Ga0207687_10010116 | 3300025927 | Bacteria | 6167 |
| 211 | Ga0207690_10000985 | 3300025932 | Bacteria | 18246 |
| 212 | Ga0207686_10004055 | 3300025934 | Bacteria | 7863 |
| 213 | Ga0207709_10061639 | 3300025935 | Bacteria | 2345 |
| 214 | Ga0207689_10010105 | 3300025942 | Bacteria | 8137 |
| 215 | Ga0207661_10452139 | 3300025944 | Unclassified | 1170 |
| 216 | Ga0207679_10139708 | 3300025945 | Bacteria | 1956 |
| 217 | Ga0207679_10232208 | 3300025945 | Bacteria | 1558 |
| 218 | Ga0207667_10055259 | 3300025949 | Bacteria | 4174 |
| 219 | Ga0207667_10563719 | 3300025949 | Bacteria | 1151 |
| 220 | Ga0207640_10472602 | 3300025981 | Bacteria | 1038 |
| 221 | Ga0207640_11058384 | 3300025981 | Unclassified | 716 |
| 222 | Ga0207639_10674657 | 3300026041 | Bacteria | 957 |
| 223 | Ga0207678_10676839 | 3300026067 | Bacteria | 907 |
| 224 | Ga0207708_10001674 | 3300026075 | Bacteria | 16451 |
| 225 | Ga0207702_10185660 | 3300026078 | Unclassified | 1917 |
| 226 | Ga0207641_11964450 | 3300026088 | Bacteria | 586 |
| 227 | Ga0207648_10010955 | 3300026089 | Bacteria | 8566 |
| 228 | Ga0207676_12068184 | 3300026095 | Bacteria | 568 |
| 229 | Ga0207675_100004136 | 3300026118 | Bacteria | 14047 |
| 230 | Ga0207683_10033238 | 3300026121 | Bacteria | 4480 |
| 231 | Ga0207698_10649955 | 3300026142 | Bacteria | 1044 |
| 232 | Ga0207698_11055522 | 3300026142 | Bacteria | 824 |
| 233 | Ga0207698_12622449 | 3300026142 | Bacteria | 513 |
| 234 | Ga0209179_1003857 | 3300027512 | Bacteria | 2207 |
| 235 | Ga0207428_10427179 | 3300027907 | Bacteria | 968 |
| 236 | Ga0268266_12133974 | 3300028379 | Bacteria | 533 |
| 237 | Ga0268265_10102542 | 3300028380 | Bacteria | 2315 |
| 238 | Ga0307515_10238975 | 3300028794 | Bacteria | 1592 |
| 239 | Ga0307408_100000136 | 3300031548 | Bacteria | 81550 |
| 240 | Ga0307408_100001264 | 3300031548 | Bacteria | 18976 |
| 241 | Ga0307408_100002943 | 3300031548 | Bacteria | 11798 |
| 242 | Ga0307408_100007763 | 3300031548 | Bacteria | 7092 |
| 243 | Ga0307408_100098646 | 3300031548 | Bacteria | 2221 |
| 244 | Ga0307406_10008672 | 3300031901 | Bacteria | 5681 |
| 245 | Ga0307406_10703100 | 3300031901 | Bacteria | 844 |
| 246 | Ga0307416_100343372 | 3300032002 | Bacteria | 1507 |
| 247 | Ga0307416_103512207 | 3300032002 | Unclassified | 524 |
| 248 | Ga0316583_10007949 | 3300032133 | Bacteria | 3824 |
| 249 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 250 | Ga0373926_0349489 | 3300035083 | Bacteria | 580 |
| 251 | Ga0373934_0233417 | 3300035086 | Bacteria | 759 |
| 252 | Ga0373923_0327759 | 3300035111 | Bacteria | 728 |
| 253 | Ga0373945_0190812 | 3300035116 | Bacteria | 847 |
| 254 | Ga0373953_0009518 | 3300035117 | Bacteria | 3349 |
| 255 | Ga0373956_0037424 | 3300035119 | Bacteria | 2145 |
| 256 | Ga0373957_0108698 | 3300035120 | Bacteria | 1115 |
| 257 | Ga0373946_0042413 | 3300035171 | Bacteria | 1870 |
| 258 | Ga0373955_0234462 | 3300035172 | Bacteria | 1098 |
| 259 | Ga0373933_0261631 | 3300035724 | Bacteria | 1115 |
| 260 | Ga0373947_0050051 | 3300035725 | Bacteria | 2511 |
| 261 | Ga0373947_0253406 | 3300035725 | Unclassified | 1164 |
| 262 | Ga0373937_0026630 | 3300036401 | Bacteria | 5224 |
| 263 | Ga0373925_0077079 | 3300037068 | Bacteria | 2529 |
| 264 | Ga0373925_0164514 | 3300037068 | Bacteria | 1749 |
| 265 | Ga0395899_0157236 | 3300037312 | Bacteria | 1608 |
| 266 | Ga0395900_0015727 | 3300037418 | Bacteria | 7715 |
| 267 | Ga0395905_0035826 | 3300037471 | Bacteria | 4660 |
| 268 | Ga0395901_0382761 | 3300038443 | Bacteria | 1448 |
| 269 | Ga0400483_008570 | 3300039062 | Bacteria | 14753 |
| 270 | Ga0400483_036611 | 3300039062 | Bacteria | 1070 |
| 271 | Ga0400483_037416 | 3300039062 | Bacteria | 2148 |
| 272 | Ga0400483_212408 | 3300039062 | Bacteria | 1194 |
| 273 | Ga0400483_232074 | 3300039062 | Bacteria | 2782 |
| 274 | Ga0400483_244789 | 3300039062 | Bacteria | 7374 |
| 275 | Ga0436361_0141479 | 3300039447 | Bacteria | 768 |
| 276 | Ga0436361_0206192 | 3300039447 | Bacteria | 1247 |
| 277 | Ga0436361_0543848 | 3300039447 | Bacteria | 100906 |
| 278 | Ga0436362_1060925 | 3300039453 | Bacteria | 692 |
| 279 | Ga0451807_0661789 | 3300041486 | Bacteria | 716 |
| 280 | Ga0451853_0937781 | 3300041512 | Bacteria | 591 |
| 281 | Ga0451853_3216985 | 3300041512 | Bacteria | 511 |
| 282 | Ga0439448_0323086 | 3300042005 | Bacteria | 549 |
| 283 | Ga0450923_066779 | 3300042125 | Bacteria | 792 |
| 284 | Ga0450891_011426 | 3300042129 | Bacteria | 822 |
| 285 | Ga0450893_0028475 | 3300042532 | Bacteria | 988 |
| 286 | Ga0466986_0129293 | 3300044650 | Bacteria | 1722 |
| 287 | Ga0466969_0010208 | 3300044656 | Bacteria | 4978 |
| 288 | Ga0466969_0021124 | 3300044656 | Bacteria | 3368 |
| 289 | Ga0466969_0045648 | 3300044656 | Bacteria | 2174 |
| 290 | Ga0466972_0000818 | 3300044658 | Bacteria | 14877 |
| 291 | Ga0466972_0176155 | 3300044658 | Bacteria | 1003 |
| 292 | Ga0466978_0002487 | 3300044671 | Bacteria | 7974 |
| 293 | Ga0466982_0006703 | 3300044672 | Bacteria | 5600 |
| 294 | Ga0466965_0077856 | 3300044683 | Bacteria | 1674 |
| 295 | Ga0466965_0081970 | 3300044683 | Bacteria | 1631 |
| 296 | Ga0466965_0110432 | 3300044683 | Bacteria | 1412 |
| 297 | Ga0466966_0037298 | 3300044684 | Bacteria | 3135 |
| 298 | Ga0466966_0061629 | 3300044684 | Bacteria | 2365 |
| 299 | Ga0466966_0385227 | 3300044684 | Bacteria | 842 |
| 300 | Ga0466961_0000035 | 3300044693 | Bacteria | 82931 |
| 301 | Ga0466961_0003428 | 3300044693 | Bacteria | 9891 |
| 302 | Ga0466961_0006965 | 3300044693 | Bacteria | 7190 |
| 303 | Ga0466963_0049687 | 3300044694 | Bacteria | 2774 |
| 304 | Ga0466963_0243176 | 3300044694 | Bacteria | 1262 |
| 305 | Ga0466964_0005799 | 3300044706 | Bacteria | 4597 |
| 306 | Ga0466964_0012112 | 3300044706 | Bacteria | 3262 |
| 307 | Ga0453684_0045758 | 3300044712 | Bacteria | 5831 |
| 308 | Ga0466970_0000594 | 3300044765 | Bacteria | 17767 |
| 309 | Ga0466970_0017428 | 3300044765 | Bacteria | 3711 |
| 310 | Ga0466970_0030213 | 3300044765 | Bacteria | 2857 |
| 311 | Ga0466957_0176305 | 3300044842 | Bacteria | 1394 |
| 312 | Ga0466957_0303921 | 3300044842 | Bacteria | 1072 |
| 313 | Ga0466960_0016041 | 3300044901 | Bacteria | 3241 |
| 314 | Ga0466960_0157019 | 3300044901 | Bacteria | 1219 |
| 315 | Ga0466959_0000054 | 3300045049 | Bacteria | 79861 |
| 316 | Ga0466959_0005546 | 3300045049 | Bacteria | 8659 |
| 317 | Ga0466959_0006183 | 3300045049 | Bacteria | 8273 |
| 318 | Ga0466959_0263008 | 3300045049 | Bacteria | 1187 |
| 319 | Ga0466959_0461921 | 3300045049 | Bacteria | 860 |
| 320 | Ga0451576_2525774 | 3300045051 | Bacteria | 524 |
| 321 | Ga0466958_0098138 | 3300045836 | Bacteria | 1818 |
| 322 | Ga0466958_0386394 | 3300045836 | Bacteria | 903 |
| 323 | Ga0466967_0012606 | 3300045976 | Bacteria | 6478 |
| 324 | Ga0466967_0129161 | 3300045976 | Bacteria | 2344 |
| 325 | Ga0466967_0434486 | 3300045976 | Bacteria | 1281 |
| 326 | Ga0495603_0036999 | 3300046455 | Bacteria | 2929 |
| 327 | Ga0495590_0046645 | 3300046457 | Bacteria | 1512 |
| 328 | Ga0495638_0188774 | 3300046460 | Bacteria | 1170 |
| 329 | Ga0495651_0059752 | 3300046462 | Bacteria | 2922 |
| 330 | Ga0495653_0047687 | 3300046463 | Bacteria | 3313 |
| 331 | Ga0495584_0022915 | 3300046491 | Bacteria | 3168 |
| 332 | Ga0495585_0001411 | 3300046492 | Bacteria | 18902 |
| 333 | Ga0495596_0005469 | 3300046500 | Bacteria | 5996 |
| 334 | Ga0495607_0008913 | 3300046501 | Bacteria | 6831 |
| 335 | Ga0495583_0019589 | 3300046506 | Bacteria | 3527 |
| 336 | Ga0495608_0288986 | 3300046511 | Bacteria | 1016 |
| 337 | Ga0495616_0014775 | 3300046513 | Bacteria | 4359 |
| 338 | Ga0495652_0633497 | 3300046529 | Bacteria | 726 |
| 339 | Ga0495587_0031496 | 3300046536 | Bacteria | 3211 |
| 340 | Ga0495609_0000637 | 3300046538 | Bacteria | 27304 |
| 341 | Ga0495633_0363363 | 3300046558 | Bacteria | 655 |
| 342 | Ga0495667_0089033 | 3300046559 | Bacteria | 2001 |
| 343 | Ga0495625_0002253 | 3300046660 | Bacteria | 21209 |
| 344 | Ga0495625_0005445 | 3300046660 | Bacteria | 11604 |
| 345 | Ga0495625_0150256 | 3300046660 | Bacteria | 1566 |
| 346 | Ga0495588_0062060 | 3300046674 | Bacteria | 1937 |
| 347 | Ga0495657_0195521 | 3300046675 | Bacteria | 1234 |
| 348 | Ga0495669_0000434 | 3300046684 | Bacteria | 19893 |
| 349 | Ga0495613_0186478 | 3300046689 | Bacteria | 1468 |
| 350 | Ga0495671_0205904 | 3300046692 | Unclassified | 954 |
| 351 | Ga0495649_0132731 | 3300046694 | Bacteria | 1313 |
| 352 | Ga0495600_0387612 | 3300046809 | Bacteria | 871 |
| 353 | Ga0495660_0162307 | 3300046810 | Bacteria | 1095 |
| 354 | Ga0495636_0005092 | 3300047318 | Bacteria | 5163 |
| 355 | Ga0495636_0015927 | 3300047318 | Bacteria | 2998 |
| 356 | Ga0495674_0764231 | 3300047319 | Bacteria | 754 |
| 357 | Ga0495680_0137817 | 3300047322 | Bacteria | 1788 |
| 358 | Ga0495677_0063234 | 3300047445 | Bacteria | 1374 |
| 359 | Ga0495685_000659 | 3300047447 | Bacteria | 10538 |
| 360 | Ga0495681_0001428 | 3300047470 | Bacteria | 17955 |
| 361 | Ga0495684_0957706 | 3300047471 | Bacteria | 547 |
| 362 | Ga0495686_0001460 | 3300047472 | Bacteria | 25736 |
| 363 | Ga0495602_0330278 | 3300048088 | Bacteria | 1106 |
| 364 | Ga0495602_0494302 | 3300048088 | Bacteria | 856 |
| 365 | Ga0496107_0237333 | 3300048910 | Bacteria | 1357 |
| 366 | Ga0496108_0168447 | 3300048911 | Bacteria | 1894 |
| 367 | Ga0496109_0072475 | 3300048912 | Bacteria | 3164 |
| 368 | Ga0496111_0015728 | 3300048914 | Bacteria | 5202 |
| 369 | Ga0496112_0233288 | 3300048915 | Bacteria | 1794 |
| 370 | Ga0496112_0366988 | 3300048915 | Bacteria | 1381 |
| 371 | Ga0496113_0018655 | 3300048916 | Bacteria | 4835 |
| 372 | Ga0496116_0000046 | 3300048919 | Bacteria | 323643 |
| 373 | Ga0496116_0080538 | 3300048919 | Bacteria | 2022 |
| 374 | Ga0496117_0105965 | 3300048920 | Bacteria | 1765 |
| 375 | Ga0496118_0110002 | 3300048921 | Bacteria | 1832 |
| 376 | Ga0496118_0443113 | 3300048921 | Bacteria | 661 |
| 377 | Ga0496121_0081930 | 3300048924 | Bacteria | 2553 |
| 378 | Ga0496121_0089214 | 3300048924 | Bacteria | 2415 |
| 379 | Ga0496122_0003121 | 3300048925 | Bacteria | 22193 |
| 380 | Ga0496123_0000303 | 3300048926 | Bacteria | 95638 |
| 381 | Ga0496125_0737821 | 3300048928 | Bacteria | 518 |
| 382 | Ga0501034_0842650 | 3300049571 | Bacteria | 807 |
| 383 | Ga0501036_1449181 | 3300049572 | Unclassified | 556 |
| 384 | Ga0501046_0740989 | 3300049580 | Bacteria | 691 |
| 385 | Ga0501047_0192595 | 3300049581 | Bacteria | 1902 |
| 386 | Ga0501048_1253837 | 3300049582 | Bacteria | 533 |
| 387 | Ga0501075_0455907 | 3300049591 | Bacteria | 975 |
| 388 | Ga0501076_0108714 | 3300049592 | Bacteria | 2240 |
| 389 | Ga0501223_012613 | 3300049663 | Bacteria | 1688 |
| 390 | Ga0501279_000770 | 3300049775 | Bacteria | 4188 |
| 391 | Ga0501035_0656588 | 3300049822 | Bacteria | 850 |
| 392 | Ga0501226_023433 | 3300049853 | Bacteria | 687 |
| 393 | nmdc:mga07m45_225520_c1 | 3300050496 | Unclassified | 1090 |
| 394 | nmdc:mga06r32_1070667_c1 | 3300050510 | Bacteria | 756 |
| 395 | nmdc:mga08y16_678711_c1 | 3300050511 | Bacteria | 1032 |
| 396 | Ga0495601_0106843 | 3300053077 | Bacteria | 1810 |
| 397 | Ga0495595_0002379 | 3300053084 | Bacteria | 7334 |
| 398 | Ga0500619_000018 | 3300053154 | Bacteria | 52926 |
| 399 | Ga0500622_0003492 | 3300053156 | Bacteria | 10432 |
| 400 | Ga0500622_0299996 | 3300053156 | Bacteria | 685 |
| 401 | Ga0500622_0315549 | 3300053156 | Bacteria | 660 |
| 402 | Ga0466962_0107880 | 3300061719 | Bacteria | 1339 |
| 403 | Ga0466962_0321421 | 3300061719 | Bacteria | 768 |
| 404 | Ga0530510_0030175 | 3300061734 | Bacteria | 3893 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0045758 | Ga0453684_0045758_653_988 | 106 |
| 2 | 3300005445 | Ga0070708_100000270 | Ga0070708_10000027033 | 108 |
| 3 | 3300039062 | Ga0400483_036611 | Ga0400483_036611_531_869 | 108 |
| 4 | 3300039062 | Ga0400483_212408 | Ga0400483_212408_592_930 | 108 |
| 5 | 3300005841 | Ga0068863_101592132 | Ga0068863_1015921322 | 110 |
| 6 | 3300026088 | Ga0207641_11964450 | Ga0207641_119644502 | 110 |
| 7 | iso_pu_bacteria | 2513237096 | 2513661912 | 110 |
| 8 | iso_pu_bacteria | 2513237137 | 2513857465 | 110 |
| 9 | iso_pu_bacteria | 2513237145 | 2513923507 | 110 |
| 10 | iso_pu_bacteria | 2517572143 | 2517893423 | 110 |
| 11 | iso_pu_bacteria | 2547132374 | 2548500767 | 110 |
| 12 | iso_pu_bacteria | 2554235341 | 2555669521 | 110 |
| 13 | iso_pu_bacteria | 2596583598 | 2597031000 | 110 |
| 14 | iso_pu_bacteria | 2599185161 | 2599363878 | 110 |
| 15 | iso_pu_bacteria | 2599185162 | 2599370198 | 110 |
| 16 | iso_pu_bacteria | 2599185163 | 2599372505 | 110 |
| 17 | iso_pu_bacteria | 2599185166 | 2599391364 | 110 |
| 18 | iso_pu_bacteria | 2599185168 | 2599407610 | 110 |
| 19 | iso_pu_bacteria | 2599185178 | 2599445920 | 110 |
| 20 | iso_pu_bacteria | 2643221554 | 2643789823 | 110 |
| 21 | iso_pu_bacteria | 2643221638 | 2644214455 | 110 |
| 22 | iso_pu_bacteria | 2643221645 | 2644249814 | 110 |
| 23 | iso_pu_bacteria | 2643221653 | 2644297274 | 110 |
| 24 | iso_pu_bacteria | 2643221717 | 2644646681 | 110 |
| 25 | iso_pu_bacteria | 2643221719 | 2644655527 | 110 |
| 26 | iso_pu_bacteria | 2818991442 | 2819576898 | 110 |
| 27 | iso_pu_bacteria | 2818991464 | 2819705698 | 110 |
| 28 | iso_pu_bacteria | 2842718218 | 2842719750 | 110 |
| 29 | iso_pu_bacteria | 2852103415 | 2852103961 | 110 |
| 30 | iso_pu_bacteria | 2885266251 | 2885268260 | 110 |
| 31 | iso_pu_bacteria | 2903748898 | 2903755585 | 110 |
| 32 | iso_pu_bacteria | 2906610324 | 2906617375 | 110 |
| 33 | iso_pu_bacteria | 2906635258 | 2906640641 | 110 |
| 34 | iso_pu_bacteria | 2906660503 | 2906665860 | 110 |
| 35 | iso_pu_bacteria | 2917070673 | 2917073334 | 110 |
| 36 | iso_pu_bacteria | 2922425934 | 2922429047 | 110 |
| 37 | iso_pu_bacteria | 2928058823 | 2928059070 | 110 |
| 38 | iso_pu_bacteria | 2935630451 | 2935634396 | 110 |
| 39 | iso_pu_bacteria | 2941507105 | 2941511286 | 110 |
| 40 | iso_pu_bacteria | 2941515067 | 2941518670 | 110 |
| 41 | iso_pu_bacteria | 2941523033 | 2941530406 | 110 |
| 42 | iso_pu_bacteria | 2990710928 | 2990714862 | 110 |
| 43 | iso_pu_bacteria | 3005474847 | 3005479201 | 110 |
| 44 | iso_pu_bacteria | 8019555841 | 8019557879 | 110 |
| 45 | iso_pu_bacteria | 8019565922 | 8019567411 | 110 |
| 46 | 3300046660 | Ga0495625_0150256 | Ga0495625_0150256_622_957 | 111 |
| 47 | 3300047319 | Ga0495674_0764231 | Ga0495674_0764231_43_399 | 111 |
| 48 | 3300048088 | Ga0495602_0494302 | Ga0495602_0494302_378_734 | 111 |
| 49 | 3300005458 | Ga0070681_10000351 | Ga0070681_1000035127 | 112 |
| 50 | 3300005530 | Ga0070679_100000931 | Ga0070679_10000093123 | 112 |
| 51 | 3300005578 | Ga0068854_100216812 | Ga0068854_1002168122 | 112 |
| 52 | 3300007788 | Ga0099795_10010068 | Ga0099795_100100684 | 112 |
| 53 | 3300009093 | Ga0105240_10149146 | Ga0105240_101491463 | 112 |
| 54 | 3300010159 | Ga0099796_10198586 | Ga0099796_101985862 | 112 |
| 55 | 3300013104 | Ga0157370_10003780 | Ga0157370_1000378015 | 112 |
| 56 | 3300013307 | Ga0157372_10054060 | Ga0157372_100540602 | 112 |
| 57 | 3300025912 | Ga0207707_10024296 | Ga0207707_100242963 | 112 |
| 58 | 3300025913 | Ga0207695_10176320 | Ga0207695_101763202 | 112 |
| 59 | 3300025917 | Ga0207660_10021162 | Ga0207660_100211623 | 112 |
| 60 | 3300025921 | Ga0207652_10004148 | Ga0207652_1000414811 | 112 |
| 61 | 3300025981 | Ga0207640_10472602 | Ga0207640_104726022 | 112 |
| 62 | 3300027512 | Ga0209179_1003857 | Ga0209179_10038572 | 112 |
| 63 | 3300035083 | Ga0373926_0349489 | Ga0373926_0349489_44_382 | 112 |
| 64 | 3300035111 | Ga0373923_0327759 | Ga0373923_0327759_35_373 | 112 |
| 65 | 3300035116 | Ga0373945_0190812 | Ga0373945_0190812_101_439 | 112 |
| 66 | 3300035171 | Ga0373946_0042413 | Ga0373946_0042413_38_376 | 112 |
| 67 | 3300035725 | Ga0373947_0050051 | Ga0373947_0050051_684_1022 | 112 |
| 68 | 3300037068 | Ga0373925_0077079 | Ga0373925_0077079_433_771 | 112 |
| 69 | 3300041512 | Ga0451853_3216985 | Ga0451853_3216985_87_434 | 112 |
| 70 | 3300049572 | Ga0501036_1449181 | Ga0501036_1449181_115_492 | 112 |
| 71 | 3300049580 | Ga0501046_0740989 | Ga0501046_0740989_25_363 | 112 |
| 72 | 3300049591 | Ga0501075_0455907 | Ga0501075_0455907_109_447 | 112 |
| 73 | 3300049592 | Ga0501076_0108714 | Ga0501076_0108714_479_817 | 112 |
| 74 | 3300061734 | Ga0530510_0030175 | Ga0530510_0030175_3102_3440 | 112 |
| 75 | 3300001979 | JGI24740J21852_10000077 | JGI24740J21852_1000007728 | 114 |
| 76 | 3300002705 | JGI25156J39149_1024990 | JGI25156J39149_10249902 | 114 |
| 77 | 3300002738 | JGI25154J39366_1001752 | JGI25154J39366_10017525 | 114 |
| 78 | 3300002739 | JGI25158J39367_1005523 | JGI25158J39367_10055232 | 114 |
| 79 | 3300002741 | JGI25157J39369_1031449 | JGI25157J39369_10314491 | 114 |
| 80 | 3300002741 | JGI25157J39369_1040306 | JGI25157J39369_10403061 | 114 |
| 81 | 3300002773 | JGI25152J39213_1000342 | JGI25152J39213_100034226 | 114 |
| 82 | 3300002773 | JGI25152J39213_1014848 | JGI25152J39213_10148482 | 114 |
| 83 | 3300002774 | JGI25150J39212_1000839 | JGI25150J39212_10008397 | 114 |
| 84 | 3300002774 | JGI25150J39212_1000987 | JGI25150J39212_10009873 | 114 |
| 85 | 3300002987 | JGI25159J45721_1003570 | JGI25159J45721_10035702 | 114 |
| 86 | 3300002987 | JGI25159J45721_1007785 | JGI25159J45721_10077852 | 114 |
| 87 | 3300003215 | JGI25153J46596_10020081 | JGI25153J46596_100200813 | 114 |
| 88 | 3300003322 | rootL2_10006290 | rootL2_100062903 | 114 |
| 89 | 3300003322 | rootL2_10267707 | rootL2_102677071 | 114 |
| 90 | 3300003323 | rootH1_10046375 | rootH1_100463752 | 114 |
| 91 | 3300003323 | rootH1_10226935 | rootH1_102269352 | 114 |
| 92 | 3300003373 | JGI25407J50210_10165600 | JGI25407J50210_101656001 | 114 |
| 93 | 3300003374 | JGI25161J50226_1000275 | JGI25161J50226_10002755 | 114 |
| 94 | 3300003374 | JGI25161J50226_1000808 | JGI25161J50226_10008089 | 114 |
| 95 | 3300003578 | Ga0006562J51391_1092436 | Ga0006562J51391_10924363 | 114 |
| 96 | 3300003752 | Ga0055539_1012469 | Ga0055539_10124692 | 114 |
| 97 | 3300003756 | Ga0055533_1001698 | Ga0055533_10016982 | 114 |
| 98 | 3300003762 | Ga0055542_1000929 | Ga0055542_100092916 | 114 |
| 99 | 3300003771 | Ga0055526_1003349 | Ga0055526_10033492 | 114 |
| 100 | 3300003771 | Ga0055526_1041187 | Ga0055526_10411872 | 114 |
| 101 | 3300003773 | Ga0055537_1003179 | Ga0055537_10031794 | 114 |
| 102 | 3300003773 | Ga0055537_1004797 | Ga0055537_10047973 | 114 |
| 103 | 3300003773 | Ga0055537_1007991 | Ga0055537_10079913 | 114 |
| 104 | 3300003773 | Ga0055537_1029530 | Ga0055537_10295302 | 114 |
| 105 | 3300003775 | Ga0055524_1000628 | Ga0055524_100062820 | 114 |
| 106 | 3300003775 | Ga0055524_1001322 | Ga0055524_100132211 | 114 |
| 107 | 3300003775 | Ga0055524_1001988 | Ga0055524_10019885 | 114 |
| 108 | 3300003784 | Ga0055534_1000658 | Ga0055534_10006584 | 114 |
| 109 | 3300003784 | Ga0055534_1007008 | Ga0055534_10070082 | 114 |
| 110 | 3300003791 | Ga0055530_10002828 | Ga0055530_100028289 | 114 |
| 111 | 3300003791 | Ga0055530_10005473 | Ga0055530_100054735 | 114 |
| 112 | 3300003791 | Ga0055530_10007525 | Ga0055530_100075254 | 114 |
| 113 | 3300003794 | Ga0055531_10004846 | Ga0055531_100048468 | 114 |
| 114 | 3300003841 | Ga0055541_1000403 | Ga0055541_10004037 | 114 |
| 115 | 3300004625 | Ga0055543_1001930 | Ga0055543_10019302 | 114 |
| 116 | 3300005262 | Ga0065165_1001152 | Ga0065165_10011526 | 114 |
| 117 | 3300005262 | Ga0065165_1060548 | Ga0065165_10605482 | 114 |
| 118 | 3300005262 | Ga0065165_1131927 | Ga0065165_11319271 | 114 |
| 119 | 3300005290 | Ga0065712_10274297 | Ga0065712_102742972 | 114 |
| 120 | 3300005329 | Ga0070683_100413688 | Ga0070683_1004136882 | 114 |
| 121 | 3300005331 | Ga0070670_100099859 | Ga0070670_1000998593 | 114 |
| 122 | 3300005336 | Ga0070680_100070560 | Ga0070680_1000705603 | 114 |
| 123 | 3300005337 | Ga0070682_100252854 | Ga0070682_1002528542 | 114 |
| 124 | 3300005339 | Ga0070660_101510752 | Ga0070660_1015107521 | 114 |
| 125 | 3300005340 | Ga0070689_100014900 | Ga0070689_1000149005 | 114 |
| 126 | 3300005344 | Ga0070661_100168719 | Ga0070661_1001687192 | 114 |
| 127 | 3300005344 | Ga0070661_100860308 | Ga0070661_1008603082 | 114 |
| 128 | 3300005345 | Ga0070692_10562785 | Ga0070692_105627851 | 114 |
| 129 | 3300005364 | Ga0070673_102412820 | Ga0070673_1024128201 | 114 |
| 130 | 3300005365 | Ga0070688_100179144 | Ga0070688_1001791443 | 114 |
| 131 | 3300005366 | Ga0070659_100001564 | Ga0070659_10000156413 | 114 |
| 132 | 3300005366 | Ga0070659_101103594 | Ga0070659_1011035941 | 114 |
| 133 | 3300005435 | Ga0070714_100610912 | Ga0070714_1006109122 | 114 |
| 134 | 3300005438 | Ga0070701_10002701 | Ga0070701_100027015 | 114 |
| 135 | 3300005438 | Ga0070701_10935841 | Ga0070701_109358411 | 114 |
| 136 | 3300005440 | Ga0070705_100858647 | Ga0070705_1008586471 | 114 |
| 137 | 3300005441 | Ga0070700_100018001 | Ga0070700_1000180011 | 114 |
| 138 | 3300005459 | Ga0068867_100023673 | Ga0068867_1000236734 | 114 |
| 139 | 3300005467 | Ga0070706_100026831 | Ga0070706_1000268315 | 114 |
| 140 | 3300005468 | Ga0070707_100006830 | Ga0070707_10000683010 | 114 |
| 141 | 3300005471 | Ga0070698_100010194 | Ga0070698_1000101941 | 114 |
| 142 | 3300005518 | Ga0070699_100379030 | Ga0070699_1003790302 | 114 |
| 143 | 3300005530 | Ga0070679_100202925 | Ga0070679_1002029251 | 114 |
| 144 | 3300005530 | Ga0070679_100265629 | Ga0070679_1002656292 | 114 |
| 145 | 3300005530 | Ga0070679_100586312 | Ga0070679_1005863122 | 114 |
| 146 | 3300005530 | Ga0070679_101048383 | Ga0070679_1010483831 | 114 |
| 147 | 3300005539 | Ga0068853_101280950 | Ga0068853_1012809502 | 114 |
| 148 | 3300005539 | Ga0068853_102356678 | Ga0068853_1023566781 | 114 |
| 149 | 3300005544 | Ga0070686_100782811 | Ga0070686_1007828112 | 114 |
| 150 | 3300005545 | Ga0070695_100024164 | Ga0070695_1000241646 | 114 |
| 151 | 3300005546 | Ga0070696_100034673 | Ga0070696_1000346734 | 114 |
| 152 | 3300005546 | Ga0070696_100465706 | Ga0070696_1004657062 | 114 |
| 153 | 3300005547 | Ga0070693_100038300 | Ga0070693_1000383003 | 114 |
| 154 | 3300005549 | Ga0070704_100025951 | Ga0070704_1000259515 | 114 |
| 155 | 3300005563 | Ga0068855_100021251 | Ga0068855_1000212518 | 114 |
| 156 | 3300005563 | Ga0068855_100982210 | Ga0068855_1009822102 | 114 |
| 157 | 3300005564 | Ga0070664_100141093 | Ga0070664_1001410932 | 114 |
| 158 | 3300005578 | Ga0068854_100087367 | Ga0068854_1000873675 | 114 |
| 159 | 3300005614 | Ga0068856_101223894 | Ga0068856_1012238942 | 114 |
| 160 | 3300005615 | Ga0070702_100005020 | Ga0070702_1000050204 | 114 |
| 161 | 3300005616 | Ga0068852_100032253 | Ga0068852_1000322537 | 114 |
| 162 | 3300005616 | Ga0068852_101004496 | Ga0068852_1010044962 | 114 |
| 163 | 3300005616 | Ga0068852_102865632 | Ga0068852_1028656322 | 114 |
| 164 | 3300005617 | Ga0068859_101398785 | Ga0068859_1013987853 | 114 |
| 165 | 3300005718 | Ga0068866_10004982 | Ga0068866_100049824 | 114 |
| 166 | 3300005719 | Ga0068861_100010399 | Ga0068861_1000103998 | 114 |
| 167 | 3300005834 | Ga0068851_10976093 | Ga0068851_109760931 | 114 |
| 168 | 3300005840 | Ga0068870_10591681 | Ga0068870_105916813 | 114 |
| 169 | 3300005842 | Ga0068858_100005372 | Ga0068858_1000053724 | 114 |
| 170 | 3300005843 | Ga0068860_100016669 | Ga0068860_10001666910 | 114 |
| 171 | 3300005844 | Ga0068862_100011795 | Ga0068862_1000117951 | 114 |
| 172 | 3300005981 | Ga0081538_10025955 | Ga0081538_100259553 | 114 |
| 173 | 3300005983 | Ga0081540_1279893 | Ga0081540_12798931 | 114 |
| 174 | 3300005985 | Ga0081539_10075160 | Ga0081539_100751602 | 114 |
| 175 | 3300006237 | Ga0097621_100017698 | Ga0097621_1000176984 | 114 |
| 176 | 3300006353 | Ga0075370_10507121 | Ga0075370_105071212 | 114 |
| 177 | 3300006358 | Ga0068871_100009817 | Ga0068871_1000098174 | 114 |
| 178 | 3300006847 | Ga0075431_101328471 | Ga0075431_1013284711 | 114 |
| 179 | 3300006881 | Ga0068865_101287964 | Ga0068865_1012879642 | 114 |
| 180 | 3300006931 | Ga0097620_101398797 | Ga0097620_1013987972 | 114 |
| 181 | 3300009036 | Ga0105244_10000086 | Ga0105244_1000008636 | 114 |
| 182 | 3300009036 | Ga0105244_10497764 | Ga0105244_104977642 | 114 |
| 183 | 3300009094 | Ga0111539_10469451 | Ga0111539_104694512 | 114 |
| 184 | 3300009098 | Ga0105245_10010950 | Ga0105245_100109507 | 114 |
| 185 | 3300009101 | Ga0105247_10012684 | Ga0105247_100126848 | 114 |
| 186 | 3300009148 | Ga0105243_10003679 | Ga0105243_1000367912 | 114 |
| 187 | 3300009174 | Ga0105241_11073299 | Ga0105241_110732992 | 114 |
| 188 | 3300009176 | Ga0105242_10014148 | Ga0105242_100141484 | 114 |
| 189 | 3300009177 | Ga0105248_11427881 | Ga0105248_114278811 | 114 |
| 190 | 3300009545 | Ga0105237_11106878 | Ga0105237_111068781 | 114 |
| 191 | 3300009551 | Ga0105238_10579061 | Ga0105238_105790611 | 114 |
| 192 | 3300009551 | Ga0105238_11576123 | Ga0105238_115761232 | 114 |
| 193 | 3300009553 | Ga0105249_10018354 | Ga0105249_100183548 | 114 |
| 194 | 3300010375 | Ga0105239_10371060 | Ga0105239_103710602 | 114 |
| 195 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001934 | 114 |
| 196 | 3300013104 | Ga0157370_10005370 | Ga0157370_100053707 | 114 |
| 197 | 3300013104 | Ga0157370_10008074 | Ga0157370_100080749 | 114 |
| 198 | 3300013297 | Ga0157378_10018884 | Ga0157378_100188844 | 114 |
| 199 | 3300013306 | Ga0163162_10056187 | Ga0163162_100561875 | 114 |
| 200 | 3300013307 | Ga0157372_10736230 | Ga0157372_107362301 | 114 |
| 201 | 3300014325 | Ga0163163_10135855 | Ga0163163_101358552 | 114 |
| 202 | 3300014326 | Ga0157380_10166167 | Ga0157380_101661672 | 114 |
| 203 | 3300014326 | Ga0157380_11865580 | Ga0157380_118655802 | 114 |
| 204 | 3300014497 | Ga0182008_10021161 | Ga0182008_100211613 | 114 |
| 205 | 3300014497 | Ga0182008_10619033 | Ga0182008_106190331 | 114 |
| 206 | 3300014968 | Ga0157379_10027623 | Ga0157379_100276234 | 114 |
| 207 | 3300014969 | Ga0157376_10159089 | Ga0157376_101590891 | 114 |
| 208 | 3300015261 | Ga0182006_1017545 | Ga0182006_10175454 | 114 |
| 209 | 3300015261 | Ga0182006_1019528 | Ga0182006_10195283 | 114 |
| 210 | 3300015262 | Ga0182007_10055299 | Ga0182007_100552993 | 114 |
| 211 | 3300015262 | Ga0182007_10102548 | Ga0182007_101025481 | 114 |
| 212 | 3300015265 | Ga0182005_1000107 | Ga0182005_100010710 | 114 |
| 213 | 3300017792 | Ga0163161_11001143 | Ga0163161_110011431 | 114 |
| 214 | 3300021361 | Ga0213872_10000476 | Ga0213872_1000047621 | 114 |
| 215 | 3300025208 | Ga0209436_100114 | Ga0209436_1001143 | 114 |
| 216 | 3300025208 | Ga0209436_100129 | Ga0209436_10012912 | 114 |
| 217 | 3300025224 | Ga0209784_100339 | Ga0209784_1003394 | 114 |
| 218 | 3300025225 | Ga0209566_100620 | Ga0209566_10062013 | 114 |
| 219 | 3300025226 | Ga0209674_100224 | Ga0209674_10022440 | 114 |
| 220 | 3300025230 | Ga0209563_105556 | Ga0209563_1055562 | 114 |
| 221 | 3300025230 | Ga0209563_112563 | Ga0209563_1125632 | 114 |
| 222 | 3300025245 | Ga0207425_1000013 | Ga0207425_1000013258 | 114 |
| 223 | 3300025245 | Ga0207425_1000145 | Ga0207425_100014552 | 114 |
| 224 | 3300025245 | Ga0207425_1068994 | Ga0207425_10689942 | 114 |
| 225 | 3300025246 | Ga0209646_1000016 | Ga0209646_100001645 | 114 |
| 226 | 3300025250 | Ga0209026_1005612 | Ga0209026_10056124 | 114 |
| 227 | 3300025250 | Ga0209026_1007920 | Ga0209026_10079204 | 114 |
| 228 | 3300025253 | Ga0209677_104336 | Ga0209677_1043364 | 114 |
| 229 | 3300025254 | Ga0209148_1000051 | Ga0209148_1000051326 | 114 |
| 230 | 3300025256 | Ga0209759_1011668 | Ga0209759_10116682 | 114 |
| 231 | 3300025256 | Ga0209759_1054864 | Ga0209759_10548641 | 114 |
| 232 | 3300025258 | Ga0209129_1000102 | Ga0209129_100010212 | 114 |
| 233 | 3300025258 | Ga0209129_1003102 | Ga0209129_10031027 | 114 |
| 234 | 3300025263 | Ga0209565_1000205 | Ga0209565_100020567 | 114 |
| 235 | 3300025263 | Ga0209565_1003041 | Ga0209565_10030413 | 114 |
| 236 | 3300025263 | Ga0209565_1007218 | Ga0209565_10072183 | 114 |
| 237 | 3300025263 | Ga0209565_1007717 | Ga0209565_10077172 | 114 |
| 238 | 3300025263 | Ga0209565_1008611 | Ga0209565_10086113 | 114 |
| 239 | 3300025273 | Ga0209673_1024819 | Ga0209673_10248192 | 114 |
| 240 | 3300025284 | Ga0209130_1000554 | Ga0209130_100055427 | 114 |
| 241 | 3300025284 | Ga0209130_1001832 | Ga0209130_100183212 | 114 |
| 242 | 3300025291 | Ga0209675_1001036 | Ga0209675_100103614 | 114 |
| 243 | 3300025291 | Ga0209675_1004746 | Ga0209675_10047462 | 114 |
| 244 | 3300025295 | Ga0209564_1000088 | Ga0209564_1000088171 | 114 |
| 245 | 3300025295 | Ga0209564_1001549 | Ga0209564_100154921 | 114 |
| 246 | 3300025295 | Ga0209564_1016325 | Ga0209564_10163252 | 114 |
| 247 | 3300025297 | Ga0209758_1000031 | Ga0209758_1000031206 | 114 |
| 248 | 3300025298 | Ga0209050_1000078 | Ga0209050_100007886 | 114 |
| 249 | 3300025298 | Ga0209050_1000899 | Ga0209050_100089912 | 114 |
| 250 | 3300025298 | Ga0209050_1001496 | Ga0209050_100149620 | 114 |
| 251 | 3300025299 | Ga0209256_1000035 | Ga0209256_1000035211 | 114 |
| 252 | 3300025299 | Ga0209256_1000712 | Ga0209256_100071222 | 114 |
| 253 | 3300025299 | Ga0209256_1000798 | Ga0209256_100079830 | 114 |
| 254 | 3300025299 | Ga0209256_1001186 | Ga0209256_100118630 | 114 |
| 255 | 3300025302 | Ga0207426_1001995 | Ga0207426_10019952 | 114 |
| 256 | 3300025302 | Ga0207426_1040608 | Ga0207426_10406082 | 114 |
| 257 | 3300025303 | Ga0209051_1019929 | Ga0209051_10199294 | 114 |
| 258 | 3300025304 | Ga0209257_1000097 | Ga0209257_100009764 | 114 |
| 259 | 3300025304 | Ga0209257_1004311 | Ga0209257_10043115 | 114 |
| 260 | 3300025728 | Ga0207655_1000322 | Ga0207655_100032236 | 114 |
| 261 | 3300025899 | Ga0207642_10004999 | Ga0207642_100049994 | 114 |
| 262 | 3300025900 | Ga0207710_10014571 | Ga0207710_100145714 | 114 |
| 263 | 3300025913 | Ga0207695_10019207 | Ga0207695_100192078 | 114 |
| 264 | 3300025917 | Ga0207660_10203463 | Ga0207660_102034633 | 114 |
| 265 | 3300025919 | Ga0207657_10826197 | Ga0207657_108261972 | 114 |
| 266 | 3300025921 | Ga0207652_10275863 | Ga0207652_102758632 | 114 |
| 267 | 3300025921 | Ga0207652_10504379 | Ga0207652_105043792 | 114 |
| 268 | 3300025922 | Ga0207646_10013686 | Ga0207646_100136868 | 114 |
| 269 | 3300025925 | Ga0207650_10174680 | Ga0207650_101746803 | 114 |
| 270 | 3300025927 | Ga0207687_10010116 | Ga0207687_100101164 | 114 |
| 271 | 3300025932 | Ga0207690_10000985 | Ga0207690_100009858 | 114 |
| 272 | 3300025934 | Ga0207686_10004055 | Ga0207686_100040553 | 114 |
| 273 | 3300025935 | Ga0207709_10061639 | Ga0207709_100616391 | 114 |
| 274 | 3300025942 | Ga0207689_10010105 | Ga0207689_100101054 | 114 |
| 275 | 3300025944 | Ga0207661_10452139 | Ga0207661_104521392 | 114 |
| 276 | 3300025945 | Ga0207679_10139708 | Ga0207679_101397082 | 114 |
| 277 | 3300025945 | Ga0207679_10232208 | Ga0207679_102322083 | 114 |
| 278 | 3300025949 | Ga0207667_10055259 | Ga0207667_100552592 | 114 |
| 279 | 3300025949 | Ga0207667_10563719 | Ga0207667_105637191 | 114 |
| 280 | 3300025981 | Ga0207640_11058384 | Ga0207640_110583842 | 114 |
| 281 | 3300026041 | Ga0207639_10674657 | Ga0207639_106746572 | 114 |
| 282 | 3300026067 | Ga0207678_10676839 | Ga0207678_106768392 | 114 |
| 283 | 3300026075 | Ga0207708_10001674 | Ga0207708_100016748 | 114 |
| 284 | 3300026078 | Ga0207702_10185660 | Ga0207702_101856602 | 114 |
| 285 | 3300026089 | Ga0207648_10010955 | Ga0207648_100109552 | 114 |
| 286 | 3300026095 | Ga0207676_12068184 | Ga0207676_120681841 | 114 |
| 287 | 3300026118 | Ga0207675_100004136 | Ga0207675_10000413610 | 114 |
| 288 | 3300026121 | Ga0207683_10033238 | Ga0207683_100332382 | 114 |
| 289 | 3300026142 | Ga0207698_10649955 | Ga0207698_106499551 | 114 |
| 290 | 3300026142 | Ga0207698_11055522 | Ga0207698_110555222 | 114 |
| 291 | 3300026142 | Ga0207698_12622449 | Ga0207698_126224492 | 114 |
| 292 | 3300027907 | Ga0207428_10427179 | Ga0207428_104271792 | 114 |
| 293 | 3300028379 | Ga0268266_12133974 | Ga0268266_121339742 | 114 |
| 294 | 3300028380 | Ga0268265_10102542 | Ga0268265_101025423 | 114 |
| 295 | 3300028794 | Ga0307515_10238975 | Ga0307515_102389751 | 114 |
| 296 | 3300031548 | Ga0307408_100000136 | Ga0307408_10000013667 | 114 |
| 297 | 3300031548 | Ga0307408_100001264 | Ga0307408_1000012642 | 114 |
| 298 | 3300031548 | Ga0307408_100002943 | Ga0307408_1000029439 | 114 |
| 299 | 3300031548 | Ga0307408_100007763 | Ga0307408_1000077635 | 114 |
| 300 | 3300031548 | Ga0307408_100098646 | Ga0307408_1000986464 | 114 |
| 301 | 3300031901 | Ga0307406_10008672 | Ga0307406_100086725 | 114 |
| 302 | 3300031901 | Ga0307406_10703100 | Ga0307406_107031001 | 114 |
| 303 | 3300032002 | Ga0307416_100343372 | Ga0307416_1003433722 | 114 |
| 304 | 3300032002 | Ga0307416_103512207 | Ga0307416_1035122071 | 114 |
| 305 | 3300032133 | Ga0316583_10007949 | Ga0316583_100079493 | 114 |
| 306 | 3300033442 | Ga0315911_1000009 | Ga0315911_100000937 | 114 |
| 307 | 3300035086 | Ga0373934_0233417 | Ga0373934_0233417_151_495 | 114 |
| 308 | 3300035117 | Ga0373953_0009518 | Ga0373953_0009518_1586_1930 | 114 |
| 309 | 3300035119 | Ga0373956_0037424 | Ga0373956_0037424_1063_1407 | 114 |
| 310 | 3300035120 | Ga0373957_0108698 | Ga0373957_0108698_549_893 | 114 |
| 311 | 3300035172 | Ga0373955_0234462 | Ga0373955_0234462_194_538 | 114 |
| 312 | 3300035724 | Ga0373933_0261631 | Ga0373933_0261631_574_918 | 114 |
| 313 | 3300035725 | Ga0373947_0253406 | Ga0373947_0253406_542_889 | 114 |
| 314 | 3300036401 | Ga0373937_0026630 | Ga0373937_0026630_4756_5100 | 114 |
| 315 | 3300037068 | Ga0373925_0164514 | Ga0373925_0164514_118_465 | 114 |
| 316 | 3300037312 | Ga0395899_0157236 | Ga0395899_0157236_57_401 | 114 |
| 317 | 3300037418 | Ga0395900_0015727 | Ga0395900_0015727_5716_6063 | 114 |
| 318 | 3300037471 | Ga0395905_0035826 | Ga0395905_0035826_3229_3573 | 114 |
| 319 | 3300038443 | Ga0395901_0382761 | Ga0395901_0382761_24_383 | 114 |
| 320 | 3300039062 | Ga0400483_008570 | Ga0400483_008570_14202_14546 | 114 |
| 321 | 3300039062 | Ga0400483_037416 | Ga0400483_037416_66_410 | 114 |
| 322 | 3300039062 | Ga0400483_232074 | Ga0400483_232074_2355_2699 | 114 |
| 323 | 3300039062 | Ga0400483_244789 | Ga0400483_244789_2791_3135 | 114 |
| 324 | 3300039447 | Ga0436361_0141479 | Ga0436361_0141479_367_753 | 114 |
| 325 | 3300039447 | Ga0436361_0206192 | Ga0436361_0206192_544_903 | 114 |
| 326 | 3300039447 | Ga0436361_0543848 | Ga0436361_0543848_93850_94236 | 114 |
| 327 | 3300039453 | Ga0436362_1060925 | Ga0436362_1060925_34_393 | 114 |
| 328 | 3300041486 | Ga0451807_0661789 | Ga0451807_0661789_357_701 | 114 |
| 329 | 3300041512 | Ga0451853_0937781 | Ga0451853_0937781_45_389 | 114 |
| 330 | 3300042005 | Ga0439448_0323086 | Ga0439448_0323086_26_373 | 114 |
| 331 | 3300042125 | Ga0450923_066779 | Ga0450923_066779_290_634 | 114 |
| 332 | 3300042129 | Ga0450891_011426 | Ga0450891_011426_431_775 | 114 |
| 333 | 3300042532 | Ga0450893_0028475 | Ga0450893_0028475_263_607 | 114 |
| 334 | 3300044650 | Ga0466986_0129293 | Ga0466986_0129293_1033_1377 | 114 |
| 335 | 3300044656 | Ga0466969_0010208 | Ga0466969_0010208_3167_3511 | 114 |
| 336 | 3300044656 | Ga0466969_0021124 | Ga0466969_0021124_271_684 | 114 |
| 337 | 3300044656 | Ga0466969_0045648 | Ga0466969_0045648_532_888 | 114 |
| 338 | 3300044658 | Ga0466972_0000818 | Ga0466972_0000818_8876_9220 | 114 |
| 339 | 3300044658 | Ga0466972_0176155 | Ga0466972_0176155_366_713 | 114 |
| 340 | 3300044671 | Ga0466978_0002487 | Ga0466978_0002487_862_1206 | 114 |
| 341 | 3300044672 | Ga0466982_0006703 | Ga0466982_0006703_2436_2780 | 114 |
| 342 | 3300044683 | Ga0466965_0077856 | Ga0466965_0077856_141_485 | 114 |
| 343 | 3300044683 | Ga0466965_0081970 | Ga0466965_0081970_30_386 | 114 |
| 344 | 3300044683 | Ga0466965_0110432 | Ga0466965_0110432_557_904 | 114 |
| 345 | 3300044684 | Ga0466966_0037298 | Ga0466966_0037298_1022_1369 | 114 |
| 346 | 3300044684 | Ga0466966_0061629 | Ga0466966_0061629_855_1211 | 114 |
| 347 | 3300044684 | Ga0466966_0385227 | Ga0466966_0385227_177_590 | 114 |
| 348 | 3300044693 | Ga0466961_0000035 | Ga0466961_0000035_43938_44282 | 114 |
| 349 | 3300044693 | Ga0466961_0003428 | Ga0466961_0003428_6691_7050 | 114 |
| 350 | 3300044693 | Ga0466961_0006965 | Ga0466961_0006965_2028_2384 | 114 |
| 351 | 3300044694 | Ga0466963_0049687 | Ga0466963_0049687_1084_1440 | 114 |
| 352 | 3300044694 | Ga0466963_0243176 | Ga0466963_0243176_240_584 | 114 |
| 353 | 3300044706 | Ga0466964_0005799 | Ga0466964_0005799_1399_1743 | 114 |
| 354 | 3300044706 | Ga0466964_0012112 | Ga0466964_0012112_2098_2454 | 114 |
| 355 | 3300044765 | Ga0466970_0000594 | Ga0466970_0000594_13026_13370 | 114 |
| 356 | 3300044765 | Ga0466970_0017428 | Ga0466970_0017428_1361_1717 | 114 |
| 357 | 3300044765 | Ga0466970_0030213 | Ga0466970_0030213_1242_1589 | 114 |
| 358 | 3300044842 | Ga0466957_0176305 | Ga0466957_0176305_37_381 | 114 |
| 359 | 3300044842 | Ga0466957_0303921 | Ga0466957_0303921_21_377 | 114 |
| 360 | 3300044901 | Ga0466960_0016041 | Ga0466960_0016041_146_493 | 114 |
| 361 | 3300044901 | Ga0466960_0157019 | Ga0466960_0157019_174_518 | 114 |
| 362 | 3300045049 | Ga0466959_0000054 | Ga0466959_0000054_9534_9890 | 114 |
| 363 | 3300045049 | Ga0466959_0005546 | Ga0466959_0005546_4449_4793 | 114 |
| 364 | 3300045049 | Ga0466959_0006183 | Ga0466959_0006183_6801_7160 | 114 |
| 365 | 3300045049 | Ga0466959_0263008 | Ga0466959_0263008_95_508 | 114 |
| 366 | 3300045049 | Ga0466959_0461921 | Ga0466959_0461921_132_476 | 114 |
| 367 | 3300045051 | Ga0451576_2525774 | Ga0451576_2525774_101_448 | 114 |
| 368 | 3300045836 | Ga0466958_0098138 | Ga0466958_0098138_464_820 | 114 |
| 369 | 3300045836 | Ga0466958_0386394 | Ga0466958_0386394_186_530 | 114 |
| 370 | 3300045976 | Ga0466967_0012606 | Ga0466967_0012606_4542_4886 | 114 |
| 371 | 3300045976 | Ga0466967_0129161 | Ga0466967_0129161_954_1298 | 114 |
| 372 | 3300045976 | Ga0466967_0434486 | Ga0466967_0434486_372_716 | 114 |
| 373 | 3300046455 | Ga0495603_0036999 | Ga0495603_0036999_137_484 | 114 |
| 374 | 3300046457 | Ga0495590_0046645 | Ga0495590_0046645_746_1102 | 114 |
| 375 | 3300046460 | Ga0495638_0188774 | Ga0495638_0188774_609_965 | 114 |
| 376 | 3300046462 | Ga0495651_0059752 | Ga0495651_0059752_1840_2184 | 114 |
| 377 | 3300046463 | Ga0495653_0047687 | Ga0495653_0047687_2875_3219 | 114 |
| 378 | 3300046491 | Ga0495584_0022915 | Ga0495584_0022915_2661_3017 | 114 |
| 379 | 3300046492 | Ga0495585_0001411 | Ga0495585_0001411_5114_5461 | 114 |
| 380 | 3300046500 | Ga0495596_0005469 | Ga0495596_0005469_3924_4268 | 114 |
| 381 | 3300046501 | Ga0495607_0008913 | Ga0495607_0008913_608_964 | 114 |
| 382 | 3300046506 | Ga0495583_0019589 | Ga0495583_0019589_2579_2935 | 114 |
| 383 | 3300046511 | Ga0495608_0288986 | Ga0495608_0288986_242_586 | 114 |
| 384 | 3300046513 | Ga0495616_0014775 | Ga0495616_0014775_3748_4104 | 114 |
| 385 | 3300046529 | Ga0495652_0633497 | Ga0495652_0633497_338_682 | 114 |
| 386 | 3300046536 | Ga0495587_0031496 | Ga0495587_0031496_1174_1518 | 114 |
| 387 | 3300046538 | Ga0495609_0000637 | Ga0495609_0000637_5819_6175 | 114 |
| 388 | 3300046558 | Ga0495633_0363363 | Ga0495633_0363363_179_526 | 114 |
| 389 | 3300046559 | Ga0495667_0089033 | Ga0495667_0089033_561_905 | 114 |
| 390 | 3300046660 | Ga0495625_0002253 | Ga0495625_0002253_19099_19446 | 114 |
| 391 | 3300046660 | Ga0495625_0005445 | Ga0495625_0005445_5382_5738 | 114 |
| 392 | 3300046674 | Ga0495588_0062060 | Ga0495588_0062060_425_772 | 114 |
| 393 | 3300046675 | Ga0495657_0195521 | Ga0495657_0195521_561_905 | 114 |
| 394 | 3300046684 | Ga0495669_0000434 | Ga0495669_0000434_5829_6185 | 114 |
| 395 | 3300046689 | Ga0495613_0186478 | Ga0495613_0186478_713_1060 | 114 |
| 396 | 3300046692 | Ga0495671_0205904 | Ga0495671_0205904_267_614 | 114 |
| 397 | 3300046694 | Ga0495649_0132731 | Ga0495649_0132731_829_1185 | 114 |
| 398 | 3300046809 | Ga0495600_0387612 | Ga0495600_0387612_89_433 | 114 |
| 399 | 3300046810 | Ga0495660_0162307 | Ga0495660_0162307_650_1006 | 114 |
| 400 | 3300047318 | Ga0495636_0005092 | Ga0495636_0005092_3497_3853 | 114 |
| 401 | 3300047318 | Ga0495636_0015927 | Ga0495636_0015927_1650_2009 | 114 |
| 402 | 3300047322 | Ga0495680_0137817 | Ga0495680_0137817_1247_1591 | 114 |
| 403 | 3300047445 | Ga0495677_0063234 | Ga0495677_0063234_743_1099 | 114 |
| 404 | 3300047447 | Ga0495685_000659 | Ga0495685_000659_4554_4910 | 114 |
| 405 | 3300047470 | Ga0495681_0001428 | Ga0495681_0001428_5731_6087 | 114 |
| 406 | 3300047471 | Ga0495684_0957706 | Ga0495684_0957706_135_479 | 114 |
| 407 | 3300047472 | Ga0495686_0001460 | Ga0495686_0001460_11472_11831 | 114 |
| 408 | 3300048088 | Ga0495602_0330278 | Ga0495602_0330278_532_876 | 114 |
| 409 | 3300048910 | Ga0496107_0237333 | Ga0496107_0237333_365_718 | 114 |
| 410 | 3300048911 | Ga0496108_0168447 | Ga0496108_0168447_1378_1722 | 114 |
| 411 | 3300048912 | Ga0496109_0072475 | Ga0496109_0072475_2307_2651 | 114 |
| 412 | 3300048914 | Ga0496111_0015728 | Ga0496111_0015728_1508_1852 | 114 |
| 413 | 3300048915 | Ga0496112_0233288 | Ga0496112_0233288_445_789 | 114 |
| 414 | 3300048915 | Ga0496112_0366988 | Ga0496112_0366988_1014_1367 | 114 |
| 415 | 3300048916 | Ga0496113_0018655 | Ga0496113_0018655_1837_2181 | 114 |
| 416 | 3300048919 | Ga0496116_0000046 | Ga0496116_0000046_22429_22776 | 114 |
| 417 | 3300048919 | Ga0496116_0080538 | Ga0496116_0080538_272_616 | 114 |
| 418 | 3300048920 | Ga0496117_0105965 | Ga0496117_0105965_821_1165 | 114 |
| 419 | 3300048921 | Ga0496118_0110002 | Ga0496118_0110002_484_828 | 114 |
| 420 | 3300048921 | Ga0496118_0443113 | Ga0496118_0443113_23_370 | 114 |
| 421 | 3300048924 | Ga0496121_0081930 | Ga0496121_0081930_1642_1995 | 114 |
| 422 | 3300048924 | Ga0496121_0089214 | Ga0496121_0089214_1099_1449 | 114 |
| 423 | 3300048925 | Ga0496122_0003121 | Ga0496122_0003121_9162_9509 | 114 |
| 424 | 3300048926 | Ga0496123_0000303 | Ga0496123_0000303_9429_9776 | 114 |
| 425 | 3300048928 | Ga0496125_0737821 | Ga0496125_0737821_65_412 | 114 |
| 426 | 3300049571 | Ga0501034_0842650 | Ga0501034_0842650_129_473 | 114 |
| 427 | 3300049581 | Ga0501047_0192595 | Ga0501047_0192595_990_1364 | 114 |
| 428 | 3300049582 | Ga0501048_1253837 | Ga0501048_1253837_98_472 | 114 |
| 429 | 3300049663 | Ga0501223_012613 | Ga0501223_012613_193_537 | 114 |
| 430 | 3300049775 | Ga0501279_000770 | Ga0501279_000770_1305_1649 | 114 |
| 431 | 3300049822 | Ga0501035_0656588 | Ga0501035_0656588_364_738 | 114 |
| 432 | 3300049853 | Ga0501226_023433 | Ga0501226_023433_190_534 | 114 |
| 433 | 3300050496 | nmdc:mga07m45_225520_c1 | nmdc:mga07m45_225520_c1_251_619 | 114 |
| 434 | 3300050510 | nmdc:mga06r32_1070667_c1 | nmdc:mga06r32_1070667_c1_55_399 | 114 |
| 435 | 3300050511 | nmdc:mga08y16_678711_c1 | nmdc:mga08y16_678711_c1_250_594 | 114 |
| 436 | 3300053077 | Ga0495601_0106843 | Ga0495601_0106843_75_419 | 114 |
| 437 | 3300053084 | Ga0495595_0002379 | Ga0495595_0002379_5098_5442 | 114 |
| 438 | 3300053154 | Ga0500619_000018 | Ga0500619_000018_3048_3392 | 114 |
| 439 | 3300053156 | Ga0500622_0003492 | Ga0500622_0003492_817_1176 | 114 |
| 440 | 3300053156 | Ga0500622_0299996 | Ga0500622_0299996_114_467 | 114 |
| 441 | 3300053156 | Ga0500622_0315549 | Ga0500622_0315549_118_465 | 114 |
| 442 | 3300061719 | Ga0466962_0107880 | Ga0466962_0107880_682_1038 | 114 |
| 443 | 3300061719 | Ga0466962_0321421 | Ga0466962_0321421_77_427 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bbe-assembly1.cif.gz_A | crystal structure of protein so0527 from shewanella oneidensis | 0.9279 | 2 | 93 |
| 1y0h-assembly1.cif.gz_B | structure of rv0793 from mycobacterium tuberculosis | 0.9071 | 2 | 98 |
| 3mcs-assembly1.cif.gz_A | crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution | 0.905 | 2 | 95 |
| 4dpo-assembly1.cif.gz_B | crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 | 0.9043 | 2 | 91 |
| 2gff-assembly1.cif.gz_A | crystal structure of yersinia pestis lsrg | 0.8906 | 1 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2bbeA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9279 | 2 | 93 | 3.30.70.100 |
| af_Q54J03_9_103_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.92 | 2 | 93 | 3.30.70.100 |
| 3mcsA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9073 | 2 | 95 | 3.30.70.100 |
| 1y0hB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9071 | 2 | 98 | 3.30.70.100 |
| af_A0A1D8PRM8_52_147_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9056 | 2 | 93 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q4XGP9-F1-model_v4 | ABM domain-containing protein | 0.9941 | 2 | 98 |
GO:0000166
GO:0016491 |
| AF-A0A1G9CJC5-F1-model_v4 | Heme-degrading monooxygenase HmoA | 0.9932 | 1 | 112 |
GO:0004497
|
| AF-B2UIF7-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.993 | 1 | 114 |
GO:0004497
|
| AF-A0A2S2CYB5-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9915 | 1 | 106 |
GO:0004497
|
| AF-A0A1C3Y5V5-F1-model_v4 | Heme-degrading monooxygenase HmoA | 0.99 | 1 | 113 |
GO:0004497
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar