F445054

General Info

Members Datasets Scaffolds Average Seq Length
443 171 443 120

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10035249|Ga0081455_100352496
Length 131
Sequence VNLVHAAIVPPVEPELRRGAATLGDLELELDEDRWRDDEDDHSGWFCVKTDPFPCPAESCTFIADYMTAAHLVLVWEERDDPNLLWHAQRAKEVGRNPHIVEYAPSFGPSASYYAWEAAGRPVHGKKKQPR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
100 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
101 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
104 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
107 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
108 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.13
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10091416 3300003373 Bacteria 753
2 Ga0070690_100037337 3300005330 Bacteria 3061
3 Ga0070670_100021366 3300005331 Bacteria 5569
4 Ga0070689_100021737 3300005340 Bacteria 4781
5 Ga0070675_100106902 3300005354 Bacteria 2362
6 Ga0070674_100040566 3300005356 Unclassified 3150
7 Ga0070674_100472013 3300005356 Bacteria 1040
8 Ga0070688_100017728 3300005365 Bacteria 4091
9 Ga0070700_100011967 3300005441 Unclassified 4821
10 Ga0070663_100486104 3300005455 Unclassified 1023
11 Ga0070678_100218330 3300005456 Bacteria 1584
12 Ga0068867_100390536 3300005459 Bacteria 1171
13 Ga0070685_10010311 3300005466 Bacteria 4852
14 Ga0070706_101228959 3300005467 Unclassified 688
15 Ga0070686_100031796 3300005544 Bacteria 3230
16 Ga0070696_101088448 3300005546 Unclassified 671
17 Ga0070664_100055280 3300005564 Bacteria 3369
18 Ga0068857_100206672 3300005577 Archaea 1791
19 Ga0068854_100275313 3300005578 Unclassified 1353
20 Ga0070702_100408207 3300005615 Bacteria 974
21 Ga0068864_100028818 3300005618 Bacteria 4697
22 Ga0068870_10044432 3300005840 Bacteria 2321
23 Ga0068863_100415582 3300005841 Unclassified 1317
24 Ga0081455_10027376 3300005937 Bacteria 5224
25 Ga0081455_10035249 3300005937 Bacteria 4474
26 Ga0081455_10101633 3300005937 Unclassified 2307
27 Ga0081538_10000113 3300005981 Bacteria 81440
28 Ga0081538_10000516 3300005981 Bacteria 43216
29 Ga0081538_10003385 3300005981 Bacteria 15090
30 Ga0081538_10043491 3300005981 Bacteria 2819
31 Ga0075364_10749703 3300006051 Unclassified 666
32 Ga0075432_10556417 3300006058 Unclassified 519
33 Ga0075427_10073091 3300006194 Unclassified 613
34 Ga0075428_100025605 3300006844 Bacteria 6533
35 Ga0075428_100342798 3300006844 Bacteria 1604
36 Ga0075430_101278856 3300006846 Unclassified 603
37 Ga0075431_100842183 3300006847 Bacteria 889
38 Ga0075431_101768553 3300006847 Unclassified 574
39 Ga0075429_100030176 3300006880 Bacteria 4710
40 Ga0075429_100060321 3300006880 Bacteria 3304
41 Ga0075436_100139120 3300006914 Bacteria 1705
42 Ga0075435_100247466 3300007076 Unclassified 1517
43 Ga0105244_10391354 3300009036 Unclassified 640
44 Ga0111539_10034964 3300009094 Bacteria 6086
45 Ga0111539_10118650 3300009094 Bacteria 3101
46 Ga0111539_10849038 3300009094 Bacteria 1062
47 Ga0105245_10073805 3300009098 Unclassified 3103
48 Ga0114129_10057852 3300009147 Bacteria 5424
49 Ga0114129_10317512 3300009147 Bacteria 2072
50 Ga0114129_11049648 3300009147 Bacteria 1023
51 Ga0114129_12501304 3300009147 Unclassified 617
52 Ga0105243_10039573 3300009148 Bacteria 3676
53 Ga0105243_10537110 3300009148 Bacteria 1115
54 Ga0105242_10020189 3300009176 Bacteria 5223
55 Ga0105238_11884304 3300009551 Bacteria 631
56 Ga0105249_10947909 3300009553 Archaea 928
57 Ga0105246_10088357 3300011119 Bacteria 2227
58 Ga0157374_10215823 3300013296 Unclassified 1882
59 Ga0157378_10410810 3300013297 Bacteria 1336
60 Ga0163162_10648752 3300013306 Bacteria 1179
61 Ga0157375_10004686 3300013308 Bacteria 11898
62 Ga0163163_10070051 3300014325 Bacteria 3492
63 Ga0163163_10866002 3300014325 Bacteria 967
64 Ga0157380_10154798 3300014326 Archaea 1986
65 Ga0157380_10377561 3300014326 Unclassified 1336
66 Ga0157377_10013609 3300014745 Unclassified 4122
67 Ga0157376_10552832 3300014969 Bacteria 1139
68 Ga0207699_10719718 3300025906 Bacteria 731
69 Ga0207645_10052308 3300025907 Unclassified 2609
70 Ga0207643_10009768 3300025908 Bacteria 5150
71 Ga0207681_10292092 3300025923 Bacteria 1287
72 Ga0207644_10173051 3300025931 Unclassified 1687
73 Ga0207690_10490560 3300025932 Unclassified 992
74 Ga0207706_10114154 3300025933 Bacteria 2376
75 Ga0207686_10203456 3300025934 Unclassified 1419
76 Ga0207709_10094269 3300025935 Unclassified 1965
77 Ga0207709_10664231 3300025935 Bacteria 831
78 Ga0207669_10160766 3300025937 Bacteria 1586
79 Ga0207704_10035507 3300025938 Bacteria 2857
80 Ga0207691_10018551 3300025940 Bacteria 6594
81 Ga0207689_10027320 3300025942 Bacteria 4778
82 Ga0207651_10207080 3300025960 Bacteria 1576
83 Ga0207678_10518360 3300026067 Unclassified 1040
84 Ga0207648_10062209 3300026089 Unclassified 3255
85 Ga0207674_10562275 3300026116 Archaea 1102
86 Ga0207675_100066241 3300026118 Unclassified 3375
87 Ga0207683_10024380 3300026121 Bacteria 5210
88 Ga0207683_10328355 3300026121 Bacteria 1402
89 Ga0207428_10004162 3300027907 Bacteria 13866
90 Ga0268266_10352905 3300028379 Unclassified 1382
91 Ga0265337_1030668 3300028556 Bacteria 1600
92 Ga0265334_10021910 3300028573 Bacteria 2607
93 Ga0265318_10005140 3300028577 Bacteria 6184
94 Ga0265323_10052500 3300028653 Unclassified 1442
95 Ga0265322_10008252 3300028654 Bacteria 3035
96 Ga0265338_10112316 3300028800 Bacteria 2191
97 Ga0265330_10004763 3300031235 Bacteria 6854
98 Ga0265332_10032067 3300031238 Bacteria 2290
99 Ga0265328_10002764 3300031239 Bacteria 7857
100 Ga0265320_10255674 3300031240 Bacteria 776
101 Ga0265325_10001447 3300031241 Bacteria 16683
102 Ga0265329_10004723 3300031242 Bacteria 5610
103 Ga0265340_10102797 3300031247 Bacteria 1326
104 Ga0265339_10010714 3300031249 Bacteria 5678
105 Ga0265331_10005895 3300031250 Bacteria 7329
106 Ga0265327_10012512 3300031251 Bacteria 5716
107 Ga0265316_10061197 3300031344 Bacteria 2924
108 Ga0265313_10213034 3300031595 Bacteria 799
109 Ga0265342_10012750 3300031712 Bacteria 5678
110 Ga0307412_10414665 3300031911 Bacteria 1100
111 Ga0307409_100084524 3300031995 Bacteria 2577
112 Ga0307409_100950640 3300031995 Unclassified 875
113 Ga0307416_100047968 3300032002 Bacteria 3385
114 Ga0307416_100659314 3300032002 Bacteria 1132
115 Ga0307411_10483101 3300032005 Bacteria 1044
116 Ga0307411_10865025 3300032005 Bacteria 801
117 Ga0307415_100054918 3300032126 Bacteria 2722
118 Ga0373961_0328849 3300035241 Unclassified 572
119 Ga0395900_0158224 3300037418 Bacteria 2313
120 Ga0395901_0141940 3300038443 Bacteria 2524
121 Ga0395901_1067530 3300038443 Unclassified 780
122 Ga0439438_133638 3300041405 Bacteria 595
123 Ga0439453_0071952 3300041408 Unclassified 733
124 Ga0439453_0077979 3300041408 Unclassified 710
125 Ga0439461_0005745 3300041410 Bacteria 2131
126 Ga0439466_0158082 3300041411 Bacteria 693
127 Ga0439432_031286 3300042006 Bacteria 1722
128 Ga0439451_039851 3300042009 Unclassified 943
129 Ga0439462_0246810 3300042015 Bacteria 513
130 Ga0450920_001147 3300042122 Bacteria 4342
131 Ga0450920_023618 3300042122 Bacteria 1192
132 Ga0450923_038053 3300042125 Bacteria 1002
133 Ga0450907_011832 3300042146 Bacteria 1449
134 Ga0450907_015481 3300042146 Unclassified 1273
135 Ga0450907_017800 3300042146 Bacteria 1186
136 Ga0439446_0008141 3300042156 Bacteria 2775
137 Ga0439446_0018224 3300042156 Bacteria 1965
138 Ga0439446_0174047 3300042156 Bacteria 717
139 Ga0450909_037592 3300042185 Bacteria 742
140 Ga0439434_0030833 3300042435 Bacteria 1629
141 Ga0439434_0062497 3300042435 Bacteria 1166
142 Ga0439464_0119271 3300042439 Unclassified 812
143 Ga0450918_025948 3300042531 Unclassified 1027
144 Ga0495603_0069819 3300046455 Unclassified 2066
145 Ga0495585_0274022 3300046492 Bacteria 836
146 Ga0495644_0293233 3300046523 Bacteria 636
147 Ga0495656_0287879 3300046615 Unclassified 839
148 Ga0495656_0594659 3300046615 Bacteria 592
149 Ga0495659_0122696 3300046664 Bacteria 1024
150 Ga0496100_0357222 3300048903 Bacteria 1105
151 Ga0496100_0485850 3300048903 Bacteria 950
152 Ga0496108_0098565 3300048911 Unclassified 2491
153 Ga0496109_0109951 3300048912 Unclassified 2562
154 Ga0496110_0058124 3300048913 Unclassified 3406
155 Ga0501031_0001125 3300049568 Bacteria 16264
156 Ga0501031_0016102 3300049568 Bacteria 4855
157 Ga0501031_0027652 3300049568 Bacteria 3697
158 Ga0501031_0030652 3300049568 Bacteria 3509
159 Ga0501031_0033498 3300049568 Bacteria 3351
160 Ga0501031_0039568 3300049568 Bacteria 3077
161 Ga0501031_0088641 3300049568 Bacteria 2017
162 Ga0501031_0801483 3300049568 Unclassified 604
163 Ga0501031_0872466 3300049568 Unclassified 576
164 Ga0501032_0011785 3300049569 Bacteria 6267
165 Ga0501032_0016186 3300049569 Bacteria 5248
166 Ga0501032_0029391 3300049569 Bacteria 3771
167 Ga0501033_0023404 3300049570 Bacteria 4658
168 Ga0501033_0044772 3300049570 Bacteria 3294
169 Ga0501033_0279626 3300049570 Bacteria 1178
170 Ga0501034_0167792 3300049571 Bacteria 2163
171 Ga0501036_0003552 3300049572 Bacteria 12463
172 Ga0501036_0012790 3300049572 Bacteria 6963
173 Ga0501036_0034146 3300049572 Bacteria 4302
174 Ga0501036_0055879 3300049572 Bacteria 3344
175 Ga0501036_0076214 3300049572 Bacteria 2837
176 Ga0501036_0139757 3300049572 Unclassified 2044
177 Ga0501036_0153583 3300049572 Unclassified 1941
178 Ga0501036_0216556 3300049572 Bacteria 1608
179 Ga0501036_0247054 3300049572 Bacteria 1496
180 Ga0501037_0007959 3300049573 Bacteria 7768
181 Ga0501037_0100894 3300049573 Bacteria 2084
182 Ga0501037_0178606 3300049573 Bacteria 1507
183 Ga0501038_0028645 3300049574 Bacteria 4947
184 Ga0501038_0040368 3300049574 Bacteria 4076
185 Ga0501038_0053457 3300049574 Bacteria 3477
186 Ga0501038_0069042 3300049574 Bacteria 3003
187 Ga0501038_0097293 3300049574 Bacteria 2455
188 Ga0501038_0236859 3300049574 Bacteria 1450
189 Ga0501038_0531132 3300049574 Bacteria 897
190 Ga0501039_0000567 3300049575 Bacteria 26741
191 Ga0501039_0002258 3300049575 Bacteria 14302
192 Ga0501039_0007432 3300049575 Bacteria 8361
193 Ga0501039_0023517 3300049575 Bacteria 4728
194 Ga0501039_0037357 3300049575 Bacteria 3748
195 Ga0501039_0269755 3300049575 Bacteria 1338
196 Ga0501039_0322301 3300049575 Unclassified 1214
197 Ga0501039_0847125 3300049575 Bacteria 712
198 Ga0501040_0004482 3300049576 Bacteria 9069
199 Ga0501040_0009824 3300049576 Bacteria 6246
200 Ga0501040_0014620 3300049576 Bacteria 5176
201 Ga0501040_0047307 3300049576 Bacteria 2938
202 Ga0501040_0078849 3300049576 Bacteria 2279
203 Ga0501040_0088258 3300049576 Bacteria 2153
204 Ga0501040_0123772 3300049576 Bacteria 1815
205 Ga0501040_0180588 3300049576 Bacteria 1496
206 Ga0501040_0186544 3300049576 Unclassified 1471
207 Ga0501040_0286675 3300049576 Bacteria 1176
208 Ga0501041_0000979 3300049577 Bacteria 15588
209 Ga0501041_0006203 3300049577 Bacteria 6988
210 Ga0501041_0010463 3300049577 Bacteria 5467
211 Ga0501041_0018449 3300049577 Bacteria 4156
212 Ga0501041_0032879 3300049577 Bacteria 3135
213 Ga0501041_0144991 3300049577 Bacteria 1481
214 Ga0501041_0191742 3300049577 Unclassified 1280
215 Ga0501041_0903780 3300049577 Unclassified 567
216 Ga0501042_0002580 3300049578 Bacteria 11144
217 Ga0501042_0006933 3300049578 Bacteria 7393
218 Ga0501042_0009419 3300049578 Bacteria 6508
219 Ga0501042_0016796 3300049578 Bacteria 5033
220 Ga0501042_0035051 3300049578 Bacteria 3560
221 Ga0501042_0137902 3300049578 Bacteria 1758
222 Ga0501042_0170625 3300049578 Unclassified 1569
223 Ga0501042_0218486 3300049578 Bacteria 1375
224 Ga0501042_1413861 3300049578 Bacteria 507
225 Ga0501043_0007925 3300049579 Bacteria 8394
226 Ga0501043_0089426 3300049579 Bacteria 2420
227 Ga0501043_0094870 3300049579 Bacteria 2345
228 Ga0501043_0127988 3300049579 Bacteria 1991
229 Ga0501046_0004391 3300049580 Bacteria 12818
230 Ga0501046_0017756 3300049580 Bacteria 5934
231 Ga0501046_0020366 3300049580 Bacteria 5487
232 Ga0501046_0057951 3300049580 Bacteria 3037
233 Ga0501046_0064260 3300049580 Bacteria 2865
234 Ga0501046_0100754 3300049580 Bacteria 2216
235 Ga0501046_0456326 3300049580 Unclassified 919
236 Ga0501047_0141189 3300049581 Bacteria 2287
237 Ga0501048_0006148 3300049582 Bacteria 9139
238 Ga0501048_0006261 3300049582 Bacteria 9051
239 Ga0501048_0016302 3300049582 Bacteria 5476
240 Ga0501048_0018182 3300049582 Bacteria 5171
241 Ga0501048_0064209 3300049582 Bacteria 2597
242 Ga0501048_0157514 3300049582 Bacteria 1606
243 Ga0501048_0236429 3300049582 Unclassified 1296
244 Ga0501048_0568698 3300049582 Bacteria 813
245 Ga0501067_0006397 3300049583 Bacteria 6525
246 Ga0501067_0009228 3300049583 Bacteria 5462
247 Ga0501067_0102799 3300049583 Unclassified 1587
248 Ga0501068_0011596 3300049584 Bacteria 4978
249 Ga0501068_0017585 3300049584 Bacteria 4137
250 Ga0501068_0030242 3300049584 Bacteria 3211
251 Ga0501068_0047781 3300049584 Bacteria 2582
252 Ga0501068_0075834 3300049584 Bacteria 2057
253 Ga0501068_0076470 3300049584 Bacteria 2049
254 Ga0501068_0117064 3300049584 Bacteria 1660
255 Ga0501068_0227341 3300049584 Bacteria 1186
256 Ga0501068_0381765 3300049584 Bacteria 907
257 Ga0501068_0472749 3300049584 Bacteria 812
258 Ga0501069_0004571 3300049585 Bacteria 7155
259 Ga0501069_0017011 3300049585 Bacteria 3909
260 Ga0501069_0076763 3300049585 Bacteria 1879
261 Ga0501069_0102016 3300049585 Bacteria 1629
262 Ga0501069_0286725 3300049585 Unclassified 964
263 Ga0501069_0364532 3300049585 Bacteria 853
264 Ga0501070_0004557 3300049586 Bacteria 11886
265 Ga0501070_0145210 3300049586 Unclassified 1958
266 Ga0501070_0251358 3300049586 Bacteria 1446
267 Ga0501070_0565479 3300049586 Bacteria 909
268 Ga0501070_1295259 3300049586 Unclassified 556
269 Ga0501071_0000103 3300049587 Bacteria 32610
270 Ga0501071_0002253 3300049587 Bacteria 11614
271 Ga0501071_0007048 3300049587 Bacteria 7345
272 Ga0501071_0007629 3300049587 Bacteria 7128
273 Ga0501071_0009996 3300049587 Bacteria 6340
274 Ga0501071_0014285 3300049587 Bacteria 5430
275 Ga0501071_0088703 3300049587 Bacteria 2269
276 Ga0501071_0108802 3300049587 Unclassified 2047
277 Ga0501071_0266999 3300049587 Unclassified 1293
278 Ga0501071_0791498 3300049587 Bacteria 731
279 Ga0501071_1541523 3300049587 Unclassified 513
280 Ga0501072_0000831 3300049588 Bacteria 22737
281 Ga0501072_0001074 3300049588 Bacteria 20312
282 Ga0501072_0002078 3300049588 Bacteria 14897
283 Ga0501072_0006720 3300049588 Bacteria 8743
284 Ga0501072_0042424 3300049588 Bacteria 3573
285 Ga0501072_0169915 3300049588 Bacteria 1740
286 Ga0501072_0174163 3300049588 Unclassified 1717
287 Ga0501072_0365323 3300049588 Bacteria 1145
288 Ga0501072_0427334 3300049588 Unclassified 1050
289 Ga0501072_0792280 3300049588 Bacteria 742
290 Ga0501072_1059440 3300049588 Bacteria 631
291 Ga0501073_0033619 3300049589 Bacteria 3650
292 Ga0501073_0037977 3300049589 Bacteria 3418
293 Ga0501073_0082023 3300049589 Bacteria 2243
294 Ga0501073_0509613 3300049589 Bacteria 832
295 Ga0501074_0003520 3300049590 Bacteria 11116
296 Ga0501074_0014210 3300049590 Bacteria 5791
297 Ga0501074_0055377 3300049590 Bacteria 2858
298 Ga0501074_0081044 3300049590 Bacteria 2327
299 Ga0501074_0090557 3300049590 Bacteria 2190
300 Ga0501074_0170526 3300049590 Bacteria 1553
301 Ga0501074_0430355 3300049590 Bacteria 936
302 Ga0501074_0635964 3300049590 Unclassified 754
303 Ga0501074_0837371 3300049590 Unclassified 648
304 Ga0501074_1297156 3300049590 Bacteria 510
305 Ga0501075_0004644 3300049591 Bacteria 9320
306 Ga0501075_0005305 3300049591 Bacteria 8812
307 Ga0501075_0008231 3300049591 Bacteria 7262
308 Ga0501075_0028623 3300049591 Bacteria 4113
309 Ga0501075_0080628 3300049591 Bacteria 2463
310 Ga0501075_0181937 3300049591 Bacteria 1603
311 Ga0501075_0223275 3300049591 Unclassified 1437
312 Ga0501075_0420774 3300049591 Unclassified 1019
313 Ga0501075_1115422 3300049591 Unclassified 599
314 Ga0501076_0001908 3300049592 Bacteria 14228
315 Ga0501076_0001971 3300049592 Bacteria 14012
316 Ga0501076_0002037 3300049592 Bacteria 13834
317 Ga0501076_0004847 3300049592 Bacteria 9606
318 Ga0501076_0050995 3300049592 Bacteria 3274
319 Ga0501076_0164003 3300049592 Bacteria 1811
320 Ga0501076_0205587 3300049592 Bacteria 1608
321 Ga0501076_0301540 3300049592 Unclassified 1313
322 Ga0501076_0470309 3300049592 Unclassified 1035
323 Ga0501076_0616118 3300049592 Bacteria 895
324 Ga0501076_0745130 3300049592 Unclassified 808
325 Ga0501077_0000531 3300049593 Bacteria 23114
326 Ga0501077_0011250 3300049593 Bacteria 5583
327 Ga0501077_0016185 3300049593 Bacteria 4697
328 Ga0501077_0025064 3300049593 Bacteria 3788
329 Ga0501077_0056633 3300049593 Bacteria 2488
330 Ga0501077_0464037 3300049593 Bacteria 811
331 Ga0501077_0612592 3300049593 Unclassified 699
332 Ga0501079_0004472 3300049741 Bacteria 10372
333 Ga0501079_0005738 3300049741 Bacteria 9276
334 Ga0501079_0009253 3300049741 Bacteria 7463
335 Ga0501079_0011082 3300049741 Bacteria 6876
336 Ga0501079_0057089 3300049741 Bacteria 3012
337 Ga0501079_0087797 3300049741 Bacteria 2407
338 Ga0501079_0126419 3300049741 Bacteria 1989
339 Ga0501079_0282976 3300049741 Bacteria 1297
340 Ga0501079_0775884 3300049741 Bacteria 755
341 Ga0501079_0980883 3300049741 Unclassified 666
342 Ga0501079_1027615 3300049741 Archaea 649
343 Ga0501079_1356197 3300049741 Unclassified 560
344 Ga0501080_0025327 3300049742 Bacteria 5504
345 Ga0501080_0034281 3300049742 Bacteria 4738
346 Ga0501080_0052867 3300049742 Bacteria 3781
347 Ga0501080_0077993 3300049742 Bacteria 3081
348 Ga0501080_0093868 3300049742 Bacteria 2786
349 Ga0501080_0263455 3300049742 Bacteria 1570
350 Ga0501080_1108247 3300049742 Unclassified 683
351 Ga0501081_0000330 3300049743 Bacteria 25438
352 Ga0501081_0001505 3300049743 Bacteria 14301
353 Ga0501081_0004178 3300049743 Bacteria 9261
354 Ga0501081_0031455 3300049743 Bacteria 3596
355 Ga0501081_0035229 3300049743 Bacteria 3407
356 Ga0501081_0038155 3300049743 Bacteria 3280
357 Ga0501081_0233716 3300049743 Bacteria 1339
358 Ga0501081_0335373 3300049743 Bacteria 1113
359 Ga0501081_0468681 3300049743 Bacteria 937
360 Ga0501083_0051333 3300049744 Bacteria 2773
361 Ga0501083_0070314 3300049744 Bacteria 2328
362 Ga0501083_0335878 3300049744 Unclassified 982
363 Ga0501083_0438291 3300049744 Bacteria 850
364 Ga0501083_0517292 3300049744 Unclassified 777
365 Ga0501035_0038914 3300049822 Bacteria 4306
366 Ga0501035_0041623 3300049822 Bacteria 4148
367 Ga0501035_0055926 3300049822 Bacteria 3522
368 Ga0501035_0191488 3300049822 Bacteria 1758
369 Ga0501035_0235827 3300049822 Bacteria 1558
370 Ga0501035_0318449 3300049822 Bacteria 1307
371 Ga0501035_0322646 3300049822 Unclassified 1297
372 Ga0501035_0668360 3300049822 Bacteria 841
373 Ga0501044_0042370 3300049823 Bacteria 4735
374 Ga0501044_0717632 3300049823 Bacteria 884
375 Ga0501044_0838906 3300049823 Unclassified 796
376 Ga0501044_1121091 3300049823 Unclassified 656
377 Ga0501045_0000404 3300049824 Bacteria 26259
378 Ga0501045_0000824 3300049824 Bacteria 20065
379 Ga0501045_0006073 3300049824 Bacteria 8366
380 Ga0501045_0026675 3300049824 Bacteria 4157
381 Ga0501045_0030448 3300049824 Bacteria 3906
382 Ga0501045_0226727 3300049824 Unclassified 1391
383 Ga0501045_0244766 3300049824 Bacteria 1335
384 Ga0501045_0292564 3300049824 Unclassified 1212
385 Ga0501045_0525296 3300049824 Bacteria 878
386 nmdc:mga00v17_1061889_c1 3300050491 Unclassified 508
387 nmdc:mga0yw44_332170_c1 3300050492 Bacteria 1022
388 nmdc:mga05p37_2229300_c1 3300050507 Bacteria 507
389 nmdc:mga05p37_75069_c1 3300050507 Bacteria 4162
390 nmdc:mga09592_1180727_c1 3300050508 Bacteria 633
391 nmdc:mga09592_448870_c1 3300050508 Bacteria 1113
392 nmdc:mga09592_9111_c1 3300050508 Bacteria 8072
393 nmdc:mga0qj67_10862_c1 3300050509 Bacteria 6811
394 nmdc:mga0qj67_25429_c1 3300050509 Bacteria 4574
395 nmdc:mga0qj67_368308_c1 3300050509 Bacteria 1161
396 nmdc:mga06r32_223693_c1 3300050510 Unclassified 1870
397 nmdc:mga06r32_547180_c1 3300050510 Bacteria 1132
398 nmdc:mga06r32_6010_c1 3300050510 Bacteria 10922
399 nmdc:mga08y16_115061_c1 3300050511 Archaea 2800
400 nmdc:mga08y16_244116_c1 3300050511 Unclassified 1856
401 nmdc:mga08y16_6966_c1 3300050511 Bacteria 11850
402 nmdc:mga0n895_567889_c1 3300050512 Unclassified 1139
403 nmdc:mga0rr50_1132676_c1 3300050513 Bacteria 665
404 nmdc:mga0rr50_93045_c1 3300050513 Bacteria 2351
405 nmdc:mga08x19_110474_c1 3300050514 Bacteria 1833
406 Ga0495655_0180534 3300053083 Unclassified 680
407 Ga0501084_0005300 3300054114 Bacteria 10555
408 Ga0501084_0008644 3300054114 Bacteria 8416
409 Ga0501084_0018506 3300054114 Bacteria 5798
410 Ga0501084_0026068 3300054114 Bacteria 4877
411 Ga0501084_0171444 3300054114 Unclassified 1831
412 Ga0501084_0175389 3300054114 Bacteria 1809
413 Ga0501084_0180972 3300054114 Bacteria 1779
414 Ga0501084_0182922 3300054114 Bacteria 1769
415 Ga0501084_0247610 3300054114 Unclassified 1505
416 Ga0501084_0279815 3300054114 Bacteria 1409
417 Ga0501084_0308955 3300054114 Bacteria 1335
418 Ga0501084_1138297 3300054114 Bacteria 655
419 Ga0501084_1363231 3300054114 Unclassified 594
420 Ga0590071_107763 3300059421 Unclassified 705
421 Ga0590077_039152 3300059426 Bacteria 1050
422 Ga0501082_0002605 3300060353 Bacteria 15764
423 Ga0501082_0005809 3300060353 Bacteria 10714
424 Ga0501082_0006028 3300060353 Bacteria 10514
425 Ga0501082_0015511 3300060353 Bacteria 6559
426 Ga0501082_0020947 3300060353 Bacteria 5640
427 Ga0501082_0062514 3300060353 Bacteria 3205
428 Ga0501082_0150600 3300060353 Unclassified 2020
429 Ga0501082_0398615 3300060353 Unclassified 1201
430 Ga0501082_0437328 3300060353 Bacteria 1143
431 Ga0501082_0470362 3300060353 Bacteria 1098
432 Ga0501082_0876928 3300060353 Bacteria 785
433 Ga0530510_0001272 3300061734 Bacteria 16837
434 Ga0530510_0001867 3300061734 Bacteria 14406
435 Ga0530510_0005078 3300061734 Bacteria 9079
436 Ga0530510_0042031 3300061734 Bacteria 3301
437 Ga0530510_0064422 3300061734 Bacteria 2654
438 Ga0530510_0064701 3300061734 Bacteria 2648
439 Ga0530510_0238895 3300061734 Unclassified 1352
440 Ga0530510_0298512 3300061734 Unclassified 1205
441 Ga0530510_0469398 3300061734 Unclassified 952
442 Ga0530510_0571316 3300061734 Bacteria 859
443 Ga0530510_0697661 3300061734 Bacteria 773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100040566 Ga0070674_1000405662 98
2 3300005456 Ga0070678_100218330 Ga0070678_1002183302 98
3 3300009148 Ga0105243_10537110 Ga0105243_105371102 98
4 3300014325 Ga0163163_10866002 Ga0163163_108660022 98
5 3300014326 Ga0157380_10377561 Ga0157380_103775613 98
6 3300025937 Ga0207669_10160766 Ga0207669_101607663 98
7 3300026121 Ga0207683_10328355 Ga0207683_103283552 98
8 3300046455 Ga0495603_0069819 Ga0495603_0069819_872_1198 98
9 3300049583 Ga0501067_0102799 Ga0501067_0102799_1131_1457 98
10 3300049584 Ga0501068_0075834 Ga0501068_0075834_1288_1614 98
11 3300049584 Ga0501068_0472749 Ga0501068_0472749_436_762 98
12 3300049586 Ga0501070_1295259 Ga0501070_1295259_172_498 98
13 3300053083 Ga0495655_0180534 Ga0495655_0180534_285_611 98
14 3300061734 Ga0530510_0469398 Ga0530510_0469398_73_399 98
15 3300048903 Ga0496100_0357222 Ga0496100_0357222_135_464 99
16 3300005615 Ga0070702_100408207 Ga0070702_1004082073 100
17 3300042122 Ga0450920_023618 Ga0450920_023618_722_1054 100
18 3300042146 Ga0450907_017800 Ga0450907_017800_675_1007 100
19 3300049591 Ga0501075_0420774 Ga0501075_0420774_43_393 101
20 3300041408 Ga0439453_0077979 Ga0439453_0077979_25_369 104
21 3300042009 Ga0439451_039851 Ga0439451_039851_241_585 104
22 3300025906 Ga0207699_10719718 Ga0207699_107197182 106
23 3300025935 Ga0207709_10664231 Ga0207709_106642312 106
24 3300042122 Ga0450920_001147 Ga0450920_001147_2530_2898 106
25 3300042146 Ga0450907_015481 Ga0450907_015481_462_830 106
26 3300042531 Ga0450918_025948 Ga0450918_025948_203_571 106
27 3300049584 Ga0501068_0011596 Ga0501068_0011596_182_544 106
28 3300046615 Ga0495656_0287879 Ga0495656_0287879_411_770 107
29 3300046664 Ga0495659_0122696 Ga0495659_0122696_416_769 107
30 3300049578 Ga0501042_1413861 Ga0501042_1413861_126_485 107
31 3300049592 Ga0501076_0616118 Ga0501076_0616118_312_671 107
32 3300049741 Ga0501079_1027615 Ga0501079_1027615_277_636 107
33 3300049824 Ga0501045_0244766 Ga0501045_0244766_697_1056 107
34 3300005330 Ga0070690_100037337 Ga0070690_1000373373 108
35 3300005331 Ga0070670_100021366 Ga0070670_1000213663 108
36 3300005340 Ga0070689_100021737 Ga0070689_1000217373 108
37 3300005354 Ga0070675_100106902 Ga0070675_1001069023 108
38 3300005356 Ga0070674_100472013 Ga0070674_1004720132 108
39 3300005365 Ga0070688_100017728 Ga0070688_1000177284 108
40 3300005441 Ga0070700_100011967 Ga0070700_1000119678 108
41 3300005455 Ga0070663_100486104 Ga0070663_1004861042 108
42 3300005466 Ga0070685_10010311 Ga0070685_100103116 108
43 3300005467 Ga0070706_101228959 Ga0070706_1012289592 108
44 3300005544 Ga0070686_100031796 Ga0070686_1000317963 108
45 3300005564 Ga0070664_100055280 Ga0070664_1000552803 108
46 3300005577 Ga0068857_100206672 Ga0068857_1002066722 108
47 3300005578 Ga0068854_100275313 Ga0068854_1002753132 108
48 3300005618 Ga0068864_100028818 Ga0068864_1000288185 108
49 3300005840 Ga0068870_10044432 Ga0068870_100444323 108
50 3300005841 Ga0068863_100415582 Ga0068863_1004155822 108
51 3300005981 Ga0081538_10000113 Ga0081538_1000011347 108
52 3300006847 Ga0075431_100842183 Ga0075431_1008421832 108
53 3300009036 Ga0105244_10391354 Ga0105244_103913541 108
54 3300009094 Ga0111539_10034964 Ga0111539_100349644 108
55 3300009094 Ga0111539_10849038 Ga0111539_108490382 108
56 3300009098 Ga0105245_10073805 Ga0105245_100738053 108
57 3300009147 Ga0114129_11049648 Ga0114129_110496482 108
58 3300009148 Ga0105243_10039573 Ga0105243_100395731 108
59 3300009176 Ga0105242_10020189 Ga0105242_100201892 108
60 3300009551 Ga0105238_11884304 Ga0105238_118843042 108
61 3300009553 Ga0105249_10947909 Ga0105249_109479092 108
62 3300011119 Ga0105246_10088357 Ga0105246_100883573 108
63 3300013296 Ga0157374_10215823 Ga0157374_102158234 108
64 3300013297 Ga0157378_10410810 Ga0157378_104108102 108
65 3300013308 Ga0157375_10004686 Ga0157375_100046868 108
66 3300014325 Ga0163163_10070051 Ga0163163_100700513 108
67 3300014326 Ga0157380_10154798 Ga0157380_101547983 108
68 3300014745 Ga0157377_10013609 Ga0157377_100136096 108
69 3300025907 Ga0207645_10052308 Ga0207645_100523085 108
70 3300025908 Ga0207643_10009768 Ga0207643_100097687 108
71 3300025931 Ga0207644_10173051 Ga0207644_101730513 108
72 3300025932 Ga0207690_10490560 Ga0207690_104905602 108
73 3300025933 Ga0207706_10114154 Ga0207706_101141541 108
74 3300025935 Ga0207709_10094269 Ga0207709_100942691 108
75 3300025938 Ga0207704_10035507 Ga0207704_100355073 108
76 3300025940 Ga0207691_10018551 Ga0207691_100185519 108
77 3300025942 Ga0207689_10027320 Ga0207689_100273203 108
78 3300025960 Ga0207651_10207080 Ga0207651_102070802 108
79 3300026067 Ga0207678_10518360 Ga0207678_105183602 108
80 3300026089 Ga0207648_10062209 Ga0207648_100622092 108
81 3300026116 Ga0207674_10562275 Ga0207674_105622752 108
82 3300026118 Ga0207675_100066241 Ga0207675_1000662412 108
83 3300026121 Ga0207683_10024380 Ga0207683_100243803 108
84 3300028379 Ga0268266_10352905 Ga0268266_103529052 108
85 3300048911 Ga0496108_0098565 Ga0496108_0098565_1339_1695 108
86 3300048912 Ga0496109_0109951 Ga0496109_0109951_1672_2028 108
87 3300048913 Ga0496110_0058124 Ga0496110_0058124_364_720 108
88 3300049576 Ga0501040_0186544 Ga0501040_0186544_954_1310 108
89 3300049578 Ga0501042_0218486 Ga0501042_0218486_180_536 108
90 3300049582 Ga0501048_0236429 Ga0501048_0236429_894_1250 108
91 3300049587 Ga0501071_0791498 Ga0501071_0791498_254_610 108
92 3300049587 Ga0501071_1541523 Ga0501071_1541523_108_464 108
93 3300049588 Ga0501072_1059440 Ga0501072_1059440_107_463 108
94 3300049590 Ga0501074_1297156 Ga0501074_1297156_11_367 108
95 3300049592 Ga0501076_0470309 Ga0501076_0470309_376_732 108
96 3300049743 Ga0501081_0468681 Ga0501081_0468681_445_801 108
97 3300050508 nmdc:mga09592_1180727_c1 nmdc:mga09592_1180727_c1_37_393 108
98 3300050509 nmdc:mga0qj67_25429_c1 nmdc:mga0qj67_25429_c1_606_962 108
99 3300050510 nmdc:mga06r32_223693_c1 nmdc:mga06r32_223693_c1_817_1173 108
100 3300050511 nmdc:mga08y16_115061_c1 nmdc:mga08y16_115061_c1_1423_1779 108
101 3300050511 nmdc:mga08y16_244116_c1 nmdc:mga08y16_244116_c1_1315_1671 108
102 3300054114 Ga0501084_0247610 Ga0501084_0247610_1047_1403 108
103 3300060353 Ga0501082_0437328 Ga0501082_0437328_108_464 108
104 3300005546 Ga0070696_101088448 Ga0070696_1010884481 109
105 3300007076 Ga0075435_100247466 Ga0075435_1002474663 109
106 3300009147 Ga0114129_10317512 Ga0114129_103175124 109
107 3300049568 Ga0501031_0001125 Ga0501031_0001125_11449_11808 109
108 3300049568 Ga0501031_0016102 Ga0501031_0016102_4294_4653 109
109 3300049568 Ga0501031_0027652 Ga0501031_0027652_1036_1401 109
110 3300049569 Ga0501032_0016186 Ga0501032_0016186_4423_4782 109
111 3300049569 Ga0501032_0029391 Ga0501032_0029391_1249_1608 109
112 3300049570 Ga0501033_0279626 Ga0501033_0279626_732_1091 109
113 3300049572 Ga0501036_0003552 Ga0501036_0003552_4803_5162 109
114 3300049572 Ga0501036_0153583 Ga0501036_0153583_1433_1798 109
115 3300049572 Ga0501036_0247054 Ga0501036_0247054_914_1270 109
116 3300049573 Ga0501037_0178606 Ga0501037_0178606_956_1315 109
117 3300049574 Ga0501038_0069042 Ga0501038_0069042_1484_1843 109
118 3300049574 Ga0501038_0236859 Ga0501038_0236859_114_473 109
119 3300049575 Ga0501039_0000567 Ga0501039_0000567_21746_22105 109
120 3300049575 Ga0501039_0002258 Ga0501039_0002258_4753_5112 109
121 3300049575 Ga0501039_0037357 Ga0501039_0037357_1704_2069 109
122 3300049576 Ga0501040_0009824 Ga0501040_0009824_3901_4260 109
123 3300049576 Ga0501040_0078849 Ga0501040_0078849_1311_1676 109
124 3300049576 Ga0501040_0123772 Ga0501040_0123772_1069_1428 109
125 3300049576 Ga0501040_0180588 Ga0501040_0180588_580_936 109
126 3300049577 Ga0501041_0010463 Ga0501041_0010463_306_665 109
127 3300049577 Ga0501041_0018449 Ga0501041_0018449_981_1340 109
128 3300049577 Ga0501041_0191742 Ga0501041_0191742_890_1255 109
129 3300049578 Ga0501042_0002580 Ga0501042_0002580_173_532 109
130 3300049578 Ga0501042_0006933 Ga0501042_0006933_7011_7370 109
131 3300049578 Ga0501042_0016796 Ga0501042_0016796_712_1077 109
132 3300049579 Ga0501043_0089426 Ga0501043_0089426_1260_1619 109
133 3300049579 Ga0501043_0127988 Ga0501043_0127988_752_1111 109
134 3300049580 Ga0501046_0004391 Ga0501046_0004391_1125_1484 109
135 3300049580 Ga0501046_0057951 Ga0501046_0057951_279_638 109
136 3300049580 Ga0501046_0456326 Ga0501046_0456326_166_522 109
137 3300049582 Ga0501048_0006261 Ga0501048_0006261_4050_4409 109
138 3300049582 Ga0501048_0064209 Ga0501048_0064209_1623_1988 109
139 3300049582 Ga0501048_0157514 Ga0501048_0157514_169_528 109
140 3300049584 Ga0501068_0030242 Ga0501068_0030242_2777_3136 109
141 3300049584 Ga0501068_0117064 Ga0501068_0117064_229_588 109
142 3300049584 Ga0501068_0227341 Ga0501068_0227341_349_714 109
143 3300049585 Ga0501069_0017011 Ga0501069_0017011_2387_2746 109
144 3300049586 Ga0501070_0004557 Ga0501070_0004557_10205_10564 109
145 3300049586 Ga0501070_0565479 Ga0501070_0565479_117_482 109
146 3300049587 Ga0501071_0000103 Ga0501071_0000103_2723_3082 109
147 3300049587 Ga0501071_0002253 Ga0501071_0002253_8270_8629 109
148 3300049587 Ga0501071_0007629 Ga0501071_0007629_3547_3912 109
149 3300049588 Ga0501072_0001074 Ga0501072_0001074_8567_8926 109
150 3300049588 Ga0501072_0042424 Ga0501072_0042424_2843_3208 109
151 3300049588 Ga0501072_0427334 Ga0501072_0427334_306_662 109
152 3300049588 Ga0501072_0792280 Ga0501072_0792280_124_483 109
153 3300049589 Ga0501073_0037977 Ga0501073_0037977_1846_2205 109
154 3300049589 Ga0501073_0509613 Ga0501073_0509613_66_425 109
155 3300049590 Ga0501074_0003520 Ga0501074_0003520_10167_10526 109
156 3300049590 Ga0501074_0055377 Ga0501074_0055377_1145_1504 109
157 3300049590 Ga0501074_0635964 Ga0501074_0635964_77_439 109
158 3300049591 Ga0501075_0004644 Ga0501075_0004644_1160_1519 109
159 3300049591 Ga0501075_0028623 Ga0501075_0028623_949_1314 109
160 3300049591 Ga0501075_0080628 Ga0501075_0080628_1461_1820 109
161 3300049591 Ga0501075_1115422 Ga0501075_1115422_181_537 109
162 3300049592 Ga0501076_0001971 Ga0501076_0001971_4063_4428 109
163 3300049592 Ga0501076_0002037 Ga0501076_0002037_5157_5516 109
164 3300049592 Ga0501076_0164003 Ga0501076_0164003_404_760 109
165 3300049593 Ga0501077_0011250 Ga0501077_0011250_2698_3057 109
166 3300049593 Ga0501077_0025064 Ga0501077_0025064_3411_3770 109
167 3300049593 Ga0501077_0612592 Ga0501077_0612592_291_656 109
168 3300049741 Ga0501079_0005738 Ga0501079_0005738_8819_9178 109
169 3300049741 Ga0501079_0009253 Ga0501079_0009253_301_660 109
170 3300049741 Ga0501079_0282976 Ga0501079_0282976_43_399 109
171 3300049741 Ga0501079_0980883 Ga0501079_0980883_46_411 109
172 3300049741 Ga0501079_1356197 Ga0501079_1356197_49_408 109
173 3300049742 Ga0501080_0034281 Ga0501080_0034281_3507_3866 109
174 3300049742 Ga0501080_0052867 Ga0501080_0052867_460_825 109
175 3300049743 Ga0501081_0000330 Ga0501081_0000330_22060_22419 109
176 3300049743 Ga0501081_0004178 Ga0501081_0004178_7389_7748 109
177 3300049743 Ga0501081_0035229 Ga0501081_0035229_1393_1758 109
178 3300049743 Ga0501081_0335373 Ga0501081_0335373_43_399 109
179 3300049744 Ga0501083_0438291 Ga0501083_0438291_283_642 109
180 3300049744 Ga0501083_0517292 Ga0501083_0517292_143_499 109
181 3300049822 Ga0501035_0038914 Ga0501035_0038914_217_573 109
182 3300049822 Ga0501035_0041623 Ga0501035_0041623_120_479 109
183 3300049822 Ga0501035_0191488 Ga0501035_0191488_1307_1672 109
184 3300049824 Ga0501045_0000404 Ga0501045_0000404_11924_12283 109
185 3300049824 Ga0501045_0026675 Ga0501045_0026675_232_597 109
186 3300049824 Ga0501045_0226727 Ga0501045_0226727_680_1036 109
187 3300050512 nmdc:mga0n895_567889_c1 nmdc:mga0n895_567889_c1_16_375 109
188 3300050513 nmdc:mga0rr50_1132676_c1 nmdc:mga0rr50_1132676_c1_241_600 109
189 3300050513 nmdc:mga0rr50_93045_c1 nmdc:mga0rr50_93045_c1_1345_1704 109
190 3300054114 Ga0501084_0018506 Ga0501084_0018506_5007_5366 109
191 3300054114 Ga0501084_0180972 Ga0501084_0180972_1119_1478 109
192 3300054114 Ga0501084_0182922 Ga0501084_0182922_363_728 109
193 3300054114 Ga0501084_0279815 Ga0501084_0279815_94_450 109
194 3300060353 Ga0501082_0002605 Ga0501082_0002605_13975_14334 109
195 3300060353 Ga0501082_0006028 Ga0501082_0006028_2590_2949 109
196 3300060353 Ga0501082_0062514 Ga0501082_0062514_1869_2234 109
197 3300060353 Ga0501082_0398615 Ga0501082_0398615_524_880 109
198 3300061734 Ga0530510_0001272 Ga0530510_0001272_13703_14062 109
199 3300061734 Ga0530510_0042031 Ga0530510_0042031_121_480 109
200 3300005937 Ga0081455_10035249 Ga0081455_100352496 110
201 3300005937 Ga0081455_10101633 Ga0081455_101016332 110
202 3300006051 Ga0075364_10749703 Ga0075364_107497032 110
203 3300006058 Ga0075432_10556417 Ga0075432_105564172 110
204 3300006194 Ga0075427_10073091 Ga0075427_100730912 110
205 3300006844 Ga0075428_100025605 Ga0075428_1000256053 110
206 3300006880 Ga0075429_100030176 Ga0075429_1000301764 110
207 3300006914 Ga0075436_100139120 Ga0075436_1001391202 110
208 3300009094 Ga0111539_10118650 Ga0111539_101186503 110
209 3300009147 Ga0114129_10057852 Ga0114129_100578524 110
210 3300025923 Ga0207681_10292092 Ga0207681_102920922 110
211 3300025934 Ga0207686_10203456 Ga0207686_102034561 110
212 3300027907 Ga0207428_10004162 Ga0207428_1000416213 110
213 3300031911 Ga0307412_10414665 Ga0307412_104146652 110
214 3300031995 Ga0307409_100084524 Ga0307409_1000845242 110
215 3300031995 Ga0307409_100950640 Ga0307409_1009506402 110
216 3300032002 Ga0307416_100047968 Ga0307416_1000479682 110
217 3300032002 Ga0307416_100659314 Ga0307416_1006593142 110
218 3300032005 Ga0307411_10483101 Ga0307411_104831012 110
219 3300032005 Ga0307411_10865025 Ga0307411_108650252 110
220 3300032126 Ga0307415_100054918 Ga0307415_1000549182 110
221 3300037418 Ga0395900_0158224 Ga0395900_0158224_615_977 110
222 3300038443 Ga0395901_0141940 Ga0395901_0141940_1009_1371 110
223 3300038443 Ga0395901_1067530 Ga0395901_1067530_137_502 110
224 3300041405 Ga0439438_133638 Ga0439438_133638_75_437 110
225 3300041410 Ga0439461_0005745 Ga0439461_0005745_1223_1585 110
226 3300041411 Ga0439466_0158082 Ga0439466_0158082_225_587 110
227 3300042006 Ga0439432_031286 Ga0439432_031286_567_929 110
228 3300042146 Ga0450907_011832 Ga0450907_011832_1032_1394 110
229 3300042156 Ga0439446_0018224 Ga0439446_0018224_285_647 110
230 3300042156 Ga0439446_0174047 Ga0439446_0174047_140_502 110
231 3300042185 Ga0450909_037592 Ga0450909_037592_217_579 110
232 3300042435 Ga0439434_0030833 Ga0439434_0030833_841_1203 110
233 3300046492 Ga0495585_0274022 Ga0495585_0274022_406_765 110
234 3300046523 Ga0495644_0293233 Ga0495644_0293233_64_426 110
235 3300049568 Ga0501031_0039568 Ga0501031_0039568_1297_1668 110
236 3300049568 Ga0501031_0872466 Ga0501031_0872466_143_520 110
237 3300049572 Ga0501036_0076214 Ga0501036_0076214_2156_2518 110
238 3300049572 Ga0501036_0216556 Ga0501036_0216556_80_451 110
239 3300049574 Ga0501038_0097293 Ga0501038_0097293_1834_2205 110
240 3300049574 Ga0501038_0531132 Ga0501038_0531132_442_804 110
241 3300049575 Ga0501039_0023517 Ga0501039_0023517_3797_4168 110
242 3300049575 Ga0501039_0269755 Ga0501039_0269755_801_1178 110
243 3300049576 Ga0501040_0047307 Ga0501040_0047307_1315_1686 110
244 3300049576 Ga0501040_0286675 Ga0501040_0286675_655_1017 110
245 3300049577 Ga0501041_0032879 Ga0501041_0032879_312_683 110
246 3300049577 Ga0501041_0903780 Ga0501041_0903780_12_389 110
247 3300049578 Ga0501042_0137902 Ga0501042_0137902_525_896 110
248 3300049580 Ga0501046_0064260 Ga0501046_0064260_1194_1565 110
249 3300049582 Ga0501048_0018182 Ga0501048_0018182_466_837 110
250 3300049582 Ga0501048_0568698 Ga0501048_0568698_292_654 110
251 3300049583 Ga0501067_0009228 Ga0501067_0009228_1081_1443 110
252 3300049584 Ga0501068_0047781 Ga0501068_0047781_1203_1574 110
253 3300049585 Ga0501069_0102016 Ga0501069_0102016_319_690 110
254 3300049585 Ga0501069_0364532 Ga0501069_0364532_375_737 110
255 3300049587 Ga0501071_0014285 Ga0501071_0014285_2648_3019 110
256 3300049588 Ga0501072_0006720 Ga0501072_0006720_5867_6238 110
257 3300049588 Ga0501072_0169915 Ga0501072_0169915_451_813 110
258 3300049590 Ga0501074_0081044 Ga0501074_0081044_1475_1846 110
259 3300049590 Ga0501074_0430355 Ga0501074_0430355_407_769 110
260 3300049590 Ga0501074_0837371 Ga0501074_0837371_72_449 110
261 3300049591 Ga0501075_0005305 Ga0501075_0005305_5843_6214 110
262 3300049592 Ga0501076_0050995 Ga0501076_0050995_2241_2612 110
263 3300049592 Ga0501076_0205587 Ga0501076_0205587_962_1324 110
264 3300049593 Ga0501077_0464037 Ga0501077_0464037_211_573 110
265 3300049741 Ga0501079_0004472 Ga0501079_0004472_4152_4523 110
266 3300049742 Ga0501080_0263455 Ga0501080_0263455_545_907 110
267 3300049743 Ga0501081_0038155 Ga0501081_0038155_2454_2825 110
268 3300049744 Ga0501083_0335878 Ga0501083_0335878_178_549 110
269 3300049822 Ga0501035_0318449 Ga0501035_0318449_802_1173 110
270 3300049823 Ga0501044_0838906 Ga0501044_0838906_14_385 110
271 3300049824 Ga0501045_0030448 Ga0501045_0030448_1437_1808 110
272 3300050491 nmdc:mga00v17_1061889_c1 nmdc:mga00v17_1061889_c1_84_461 110
273 3300050492 nmdc:mga0yw44_332170_c1 nmdc:mga0yw44_332170_c1_629_1006 110
274 3300050507 nmdc:mga05p37_2229300_c1 nmdc:mga05p37_2229300_c1_94_459 110
275 3300050507 nmdc:mga05p37_75069_c1 nmdc:mga05p37_75069_c1_2076_2453 110
276 3300050508 nmdc:mga09592_9111_c1 nmdc:mga09592_9111_c1_3938_4315 110
277 3300050509 nmdc:mga0qj67_10862_c1 nmdc:mga0qj67_10862_c1_4052_4429 110
278 3300050510 nmdc:mga06r32_6010_c1 nmdc:mga06r32_6010_c1_1746_2123 110
279 3300050511 nmdc:mga08y16_6966_c1 nmdc:mga08y16_6966_c1_8578_8955 110
280 3300050514 nmdc:mga08x19_110474_c1 nmdc:mga08x19_110474_c1_566_928 110
281 3300054114 Ga0501084_0008644 Ga0501084_0008644_1418_1789 110
282 3300054114 Ga0501084_0026068 Ga0501084_0026068_1591_1953 110
283 3300054114 Ga0501084_1138297 Ga0501084_1138297_122_484 110
284 3300054114 Ga0501084_1363231 Ga0501084_1363231_12_389 110
285 3300059421 Ga0590071_107763 Ga0590071_107763_235_612 110
286 3300059426 Ga0590077_039152 Ga0590077_039152_250_612 110
287 3300060353 Ga0501082_0015511 Ga0501082_0015511_4747_5118 110
288 3300061734 Ga0530510_0064701 Ga0530510_0064701_607_978 110
289 3300061734 Ga0530510_0238895 Ga0530510_0238895_852_1214 110
290 3300061734 Ga0530510_0697661 Ga0530510_0697661_103_468 110
291 3300005459 Ga0068867_100390536 Ga0068867_1003905362 111
292 3300013306 Ga0163162_10648752 Ga0163162_106487523 111
293 3300014969 Ga0157376_10552832 Ga0157376_105528322 111
294 3300028556 Ga0265337_1030668 Ga0265337_10306682 111
295 3300028573 Ga0265334_10021910 Ga0265334_100219102 111
296 3300028577 Ga0265318_10005140 Ga0265318_100051405 111
297 3300028653 Ga0265323_10052500 Ga0265323_100525002 111
298 3300028654 Ga0265322_10008252 Ga0265322_100082523 111
299 3300028800 Ga0265338_10112316 Ga0265338_101123162 111
300 3300031235 Ga0265330_10004763 Ga0265330_100047633 111
301 3300031238 Ga0265332_10032067 Ga0265332_100320673 111
302 3300031239 Ga0265328_10002764 Ga0265328_100027646 111
303 3300031240 Ga0265320_10255674 Ga0265320_102556742 111
304 3300031241 Ga0265325_10001447 Ga0265325_1000144714 111
305 3300031242 Ga0265329_10004723 Ga0265329_100047233 111
306 3300031247 Ga0265340_10102797 Ga0265340_101027972 111
307 3300031249 Ga0265339_10010714 Ga0265339_100107145 111
308 3300031250 Ga0265331_10005895 Ga0265331_100058953 111
309 3300031251 Ga0265327_10012512 Ga0265327_100125125 111
310 3300031344 Ga0265316_10061197 Ga0265316_100611972 111
311 3300031595 Ga0265313_10213034 Ga0265313_102130342 111
312 3300031712 Ga0265342_10012750 Ga0265342_100127502 111
313 3300035241 Ga0373961_0328849 Ga0373961_0328849_18_395 111
314 3300042015 Ga0439462_0246810 Ga0439462_0246810_60_434 111
315 3300042125 Ga0450923_038053 Ga0450923_038053_54_431 111
316 3300042156 Ga0439446_0008141 Ga0439446_0008141_437_826 111
317 3300042435 Ga0439434_0062497 Ga0439434_0062497_203_592 111
318 3300046615 Ga0495656_0594659 Ga0495656_0594659_147_527 111
319 3300048903 Ga0496100_0485850 Ga0496100_0485850_21_401 111
320 3300049568 Ga0501031_0033498 Ga0501031_0033498_964_1329 111
321 3300049568 Ga0501031_0801483 Ga0501031_0801483_159_524 111
322 3300049569 Ga0501032_0011785 Ga0501032_0011785_4893_5258 111
323 3300049570 Ga0501033_0023404 Ga0501033_0023404_2784_3149 111
324 3300049571 Ga0501034_0167792 Ga0501034_0167792_1317_1682 111
325 3300049572 Ga0501036_0055879 Ga0501036_0055879_1384_1749 111
326 3300049572 Ga0501036_0139757 Ga0501036_0139757_1433_1810 111
327 3300049573 Ga0501037_0007959 Ga0501037_0007959_3106_3471 111
328 3300049574 Ga0501038_0040368 Ga0501038_0040368_927_1292 111
329 3300049575 Ga0501039_0322301 Ga0501039_0322301_830_1195 111
330 3300049576 Ga0501040_0088258 Ga0501040_0088258_1769_2134 111
331 3300049577 Ga0501041_0006203 Ga0501041_0006203_6520_6885 111
332 3300049578 Ga0501042_0170625 Ga0501042_0170625_997_1362 111
333 3300049579 Ga0501043_0007925 Ga0501043_0007925_5783_6148 111
334 3300049580 Ga0501046_0017756 Ga0501046_0017756_3489_3854 111
335 3300049581 Ga0501047_0141189 Ga0501047_0141189_141_506 111
336 3300049582 Ga0501048_0006148 Ga0501048_0006148_3389_3754 111
337 3300049583 Ga0501067_0006397 Ga0501067_0006397_1095_1469 111
338 3300049584 Ga0501068_0017585 Ga0501068_0017585_1510_1875 111
339 3300049584 Ga0501068_0381765 Ga0501068_0381765_465_839 111
340 3300049585 Ga0501069_0004571 Ga0501069_0004571_5593_5958 111
341 3300049585 Ga0501069_0286725 Ga0501069_0286725_214_597 111
342 3300049586 Ga0501070_0145210 Ga0501070_0145210_210_575 111
343 3300049587 Ga0501071_0088703 Ga0501071_0088703_562_927 111
344 3300049587 Ga0501071_0108802 Ga0501071_0108802_53_436 111
345 3300049587 Ga0501071_0266999 Ga0501071_0266999_283_660 111
346 3300049588 Ga0501072_0174163 Ga0501072_0174163_460_843 111
347 3300049588 Ga0501072_0365323 Ga0501072_0365323_677_1042 111
348 3300049589 Ga0501073_0033619 Ga0501073_0033619_1650_2015 111
349 3300049590 Ga0501074_0090557 Ga0501074_0090557_651_1016 111
350 3300049591 Ga0501075_0181937 Ga0501075_0181937_677_1042 111
351 3300049591 Ga0501075_0223275 Ga0501075_0223275_195_578 111
352 3300049592 Ga0501076_0301540 Ga0501076_0301540_869_1234 111
353 3300049592 Ga0501076_0745130 Ga0501076_0745130_421_798 111
354 3300049593 Ga0501077_0056633 Ga0501077_0056633_1447_1812 111
355 3300049741 Ga0501079_0057089 Ga0501079_0057089_677_1042 111
356 3300049741 Ga0501079_0126419 Ga0501079_0126419_913_1290 111
357 3300049741 Ga0501079_0775884 Ga0501079_0775884_85_462 111
358 3300049742 Ga0501080_0025327 Ga0501080_0025327_2644_3009 111
359 3300049742 Ga0501080_1108247 Ga0501080_1108247_96_479 111
360 3300049743 Ga0501081_0233716 Ga0501081_0233716_677_1042 111
361 3300049744 Ga0501083_0051333 Ga0501083_0051333_2305_2670 111
362 3300049822 Ga0501035_0055926 Ga0501035_0055926_2289_2654 111
363 3300049823 Ga0501044_0042370 Ga0501044_0042370_2094_2459 111
364 3300049823 Ga0501044_1121091 Ga0501044_1121091_249_620 111
365 3300049824 Ga0501045_0292564 Ga0501045_0292564_322_705 111
366 3300049824 Ga0501045_0525296 Ga0501045_0525296_434_799 111
367 3300054114 Ga0501084_0171444 Ga0501084_0171444_1447_1812 111
368 3300054114 Ga0501084_0308955 Ga0501084_0308955_205_582 111
369 3300060353 Ga0501082_0150600 Ga0501082_0150600_1636_2001 111
370 3300060353 Ga0501082_0470362 Ga0501082_0470362_405_782 111
371 3300061734 Ga0530510_0064422 Ga0530510_0064422_1034_1399 111
372 3300061734 Ga0530510_0298512 Ga0530510_0298512_145_528 111
373 3300061734 Ga0530510_0571316 Ga0530510_0571316_318_695 111
374 3300005937 Ga0081455_10027376 Ga0081455_100273762 112
375 3300005981 Ga0081538_10000516 Ga0081538_1000051637 112
376 3300006844 Ga0075428_100342798 Ga0075428_1003427983 112
377 3300006846 Ga0075430_101278856 Ga0075430_1012788562 112
378 3300006847 Ga0075431_101768553 Ga0075431_1017685532 112
379 3300006880 Ga0075429_100060321 Ga0075429_1000603215 112
380 3300009147 Ga0114129_12501304 Ga0114129_125013042 112
381 3300041408 Ga0439453_0071952 Ga0439453_0071952_87_455 112
382 3300042439 Ga0439464_0119271 Ga0439464_0119271_171_539 112
383 3300049568 Ga0501031_0030652 Ga0501031_0030652_3110_3478 112
384 3300049568 Ga0501031_0088641 Ga0501031_0088641_916_1284 112
385 3300049570 Ga0501033_0044772 Ga0501033_0044772_2083_2451 112
386 3300049572 Ga0501036_0012790 Ga0501036_0012790_1895_2263 112
387 3300049572 Ga0501036_0034146 Ga0501036_0034146_3436_3804 112
388 3300049573 Ga0501037_0100894 Ga0501037_0100894_727_1095 112
389 3300049574 Ga0501038_0028645 Ga0501038_0028645_1119_1487 112
390 3300049574 Ga0501038_0053457 Ga0501038_0053457_1918_2286 112
391 3300049575 Ga0501039_0007432 Ga0501039_0007432_530_898 112
392 3300049575 Ga0501039_0847125 Ga0501039_0847125_206_574 112
393 3300049576 Ga0501040_0004482 Ga0501040_0004482_3927_4295 112
394 3300049576 Ga0501040_0014620 Ga0501040_0014620_4722_5090 112
395 3300049577 Ga0501041_0000979 Ga0501041_0000979_343_711 112
396 3300049577 Ga0501041_0144991 Ga0501041_0144991_1056_1424 112
397 3300049578 Ga0501042_0009419 Ga0501042_0009419_2866_3234 112
398 3300049578 Ga0501042_0035051 Ga0501042_0035051_1098_1466 112
399 3300049579 Ga0501043_0094870 Ga0501043_0094870_1725_2093 112
400 3300049580 Ga0501046_0020366 Ga0501046_0020366_3993_4361 112
401 3300049580 Ga0501046_0100754 Ga0501046_0100754_391_759 112
402 3300049582 Ga0501048_0016302 Ga0501048_0016302_2834_3202 112
403 3300049584 Ga0501068_0076470 Ga0501068_0076470_1312_1680 112
404 3300049585 Ga0501069_0076763 Ga0501069_0076763_960_1328 112
405 3300049586 Ga0501070_0251358 Ga0501070_0251358_281_649 112
406 3300049587 Ga0501071_0007048 Ga0501071_0007048_4737_5105 112
407 3300049587 Ga0501071_0009996 Ga0501071_0009996_4192_4560 112
408 3300049588 Ga0501072_0000831 Ga0501072_0000831_13259_13627 112
409 3300049588 Ga0501072_0002078 Ga0501072_0002078_248_616 112
410 3300049589 Ga0501073_0082023 Ga0501073_0082023_1650_2018 112
411 3300049590 Ga0501074_0014210 Ga0501074_0014210_1108_1476 112
412 3300049590 Ga0501074_0170526 Ga0501074_0170526_548_916 112
413 3300049591 Ga0501075_0008231 Ga0501075_0008231_3036_3404 112
414 3300049592 Ga0501076_0001908 Ga0501076_0001908_11905_12273 112
415 3300049592 Ga0501076_0004847 Ga0501076_0004847_4456_4824 112
416 3300049593 Ga0501077_0000531 Ga0501077_0000531_3519_3887 112
417 3300049593 Ga0501077_0016185 Ga0501077_0016185_474_842 112
418 3300049741 Ga0501079_0011082 Ga0501079_0011082_1893_2261 112
419 3300049741 Ga0501079_0087797 Ga0501079_0087797_1072_1440 112
420 3300049742 Ga0501080_0077993 Ga0501080_0077993_796_1164 112
421 3300049742 Ga0501080_0093868 Ga0501080_0093868_1409_1777 112
422 3300049743 Ga0501081_0001505 Ga0501081_0001505_4734_5102 112
423 3300049743 Ga0501081_0031455 Ga0501081_0031455_2805_3173 112
424 3300049744 Ga0501083_0070314 Ga0501083_0070314_1106_1474 112
425 3300049822 Ga0501035_0235827 Ga0501035_0235827_1110_1478 112
426 3300049822 Ga0501035_0322646 Ga0501035_0322646_48_416 112
427 3300049822 Ga0501035_0668360 Ga0501035_0668360_408_776 112
428 3300049823 Ga0501044_0717632 Ga0501044_0717632_445_813 112
429 3300049824 Ga0501045_0000824 Ga0501045_0000824_7310_7678 112
430 3300049824 Ga0501045_0006073 Ga0501045_0006073_4236_4604 112
431 3300050508 nmdc:mga09592_448870_c1 nmdc:mga09592_448870_c1_96_464 112
432 3300050509 nmdc:mga0qj67_368308_c1 nmdc:mga0qj67_368308_c1_491_859 112
433 3300050510 nmdc:mga06r32_547180_c1 nmdc:mga06r32_547180_c1_72_440 112
434 3300054114 Ga0501084_0005300 Ga0501084_0005300_3842_4210 112
435 3300054114 Ga0501084_0175389 Ga0501084_0175389_557_925 112
436 3300060353 Ga0501082_0005809 Ga0501082_0005809_8781_9149 112
437 3300060353 Ga0501082_0020947 Ga0501082_0020947_551_919 112
438 3300060353 Ga0501082_0876928 Ga0501082_0876928_371_739 112
439 3300061734 Ga0530510_0001867 Ga0530510_0001867_9461_9829 112
440 3300061734 Ga0530510_0005078 Ga0530510_0005078_3140_3508 112
441 3300005981 Ga0081538_10003385 Ga0081538_1000338510 113
442 3300003373 JGI25407J50210_10091416 JGI25407J50210_100914162 114
443 3300005981 Ga0081538_10043491 Ga0081538_100434912 114

Feature Viewer

pLDDT pTM Quality
46.83 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map