metagRoot

F445059

General Info

Members	Datasets	Scaffolds	Average Seq Length
443	188	443	322

Family's Representative Sequence

Representative Sequence	3300006852\|Ga0075433_10000555\|Ga0075433_1000055518
Length	383
Sequence	MTPFTPAKASLDIPTESLAGVQCLLARFARGTAMRVASAMIPTTIRTAVQSSYECDRYNRCSTRMTILIADDALRQRILDHTFPIWNEGLSREAYSRXXXXQLRTEWGRTHLQRIALVDDSGELLATAKRYRFDVRIDERVGWMCGIGAVFTPADRRGRGYASRLIERMLAEARREGALFASLFSEIGTAFYERLGFTTLPLDEVTVGVTRKGGAPAMLVRAGEDRDLVNVAAMHHVRSAGARVALRRSPALVQYAIAKKRLLAGLGPADGRQIEFFVAEEGASAVAYVLLHENANGWTLEEAGDRDPAGARLGAMLQALLAREPHRPAPLIRTWWPRPFTVPPQLELRDRIDARDVLMVCPLADVAMPITADDVFYWRSDYF

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
3	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
6	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
11	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
12	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
15	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
18	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
19	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
20	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
21	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
26	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
27	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
36	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
39	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
44	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
45	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
46	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
47	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
48	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
51	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
54	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
55	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
56	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
57	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
58	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
59	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
60	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
61	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
62	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
63	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
64	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
65	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
66	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
67	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
69	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
70	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
73	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
74	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
75	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
76	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
77	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
78	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
79	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
80	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
81	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
82	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
83	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
84	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
85	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
126	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
129	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
130	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
131	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
132	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
133	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
134	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
135	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
136	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
137	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
138	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
139	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
140	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
141	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
142	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
143	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
144	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
145	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
146	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
147	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
148	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
149	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
150	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
151	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
152	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
153	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
154	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
155	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
156	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
157	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
158	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
159	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
160	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
161	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
162	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
163	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
164	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
165	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
166	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
167	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
168	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
169	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
170	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
171	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
172	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
173	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
174	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
175	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
176	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
177	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
178	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
179	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
180	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
181	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
182	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
183	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
184	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
185	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
186	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
187	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
188	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	1.58
Rhizosphere	98.19
Stem	0
Stem Tuber	0
Unclassified	0.23

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_8841003	2162886012	Unclassified	1166
2	JGI24746J21847_1008937	3300001977	Unclassified	1505
3	Ga0065704_10002104	3300005289	Bacteria	6235
4	Ga0065715_10014533	3300005293	Unclassified	4293
5	Ga0065707_10000779	3300005295	Bacteria	11400
6	Ga0065707_10013881	3300005295	Bacteria	1960
7	Ga0070658_10256179	3300005327	Bacteria	1485
8	Ga0070683_100088364	3300005329	Unclassified	2907
9	Ga0070690_100126866	3300005330	Bacteria	1719
10	Ga0070670_100012346	3300005331	Bacteria	7308
11	Ga0070670_100164619	3300005331	Unclassified	1922
12	Ga0070677_10066399	3300005333	Bacteria	1504
13	Ga0068869_100004693	3300005334	Bacteria	8529
14	Ga0068869_100024853	3300005334	Bacteria	4153
15	Ga0070666_10047893	3300005335	Unclassified	2870
16	Ga0070666_10115172	3300005335	Unclassified	1862
17	Ga0068868_100002029	3300005338	Bacteria	13921
18	Ga0070691_10022824	3300005341	Bacteria	2905
19	Ga0070687_100006068	3300005343	Bacteria	4929
20	Ga0070687_100008182	3300005343	Bacteria	4414
21	Ga0070687_100010866	3300005343	Bacteria	3959
22	Ga0070687_100165060	3300005343	Unclassified	1313
23	Ga0070661_100401995	3300005344	Bacteria	1083
24	Ga0070668_100200274	3300005347	Bacteria	1639
25	Ga0070669_100025328	3300005353	Bacteria	4260
26	Ga0070669_100031997	3300005353	Unclassified	3799
27	Ga0070669_100048234	3300005353	Bacteria	3108
28	Ga0070675_100000179	3300005354	Bacteria	39545
29	Ga0070675_100000385	3300005354	Bacteria	29879
30	Ga0070675_100006084	3300005354	Bacteria	9249
31	Ga0070675_100010003	3300005354	Bacteria	7395
32	Ga0070675_100036995	3300005354	Bacteria	3974
33	Ga0070675_100040445	3300005354	Bacteria	3806
34	Ga0070675_100092817	3300005354	Bacteria	2531
35	Ga0070671_100021991	3300005355	Bacteria	5209
36	Ga0070671_100061669	3300005355	Bacteria	3123
37	Ga0070674_100002445	3300005356	Bacteria	10280
38	Ga0070674_100005071	3300005356	Bacteria	7569
39	Ga0070674_100161080	3300005356	Unclassified	1702
40	Ga0070673_100021523	3300005364	Unclassified	4677
41	Ga0070673_100053029	3300005364	Bacteria	3184
42	Ga0070673_100076425	3300005364	Bacteria	2704
43	Ga0070673_100120449	3300005364	Unclassified	2188
44	Ga0070673_100134468	3300005364	Bacteria	2079
45	Ga0070673_100244625	3300005364	Bacteria	1561
46	Ga0070673_100307762	3300005364	Unclassified	1397
47	Ga0070688_100039703	3300005365	Bacteria	2882
48	Ga0070659_100114632	3300005366	Bacteria	2178
49	Ga0070659_100191214	3300005366	Bacteria	1682
50	Ga0070713_100022857	3300005436	Bacteria	4840
51	Ga0070701_10003444	3300005438	Bacteria	6264
52	Ga0070701_10038060	3300005438	Bacteria	2432
53	Ga0070705_100002741	3300005440	Bacteria	8788
54	Ga0070700_100019558	3300005441	Unclassified	3910
55	Ga0070700_100024984	3300005441	Bacteria	3514
56	Ga0070700_100042095	3300005441	Bacteria	2803
57	Ga0070694_100004314	3300005444	Bacteria	8545
58	Ga0070694_100006985	3300005444	Bacteria	6863
59	Ga0070694_100147739	3300005444	Unclassified	1714
60	Ga0070708_100035684	3300005445	Bacteria	4333
61	Ga0070663_100336862	3300005455	Bacteria	1217
62	Ga0070678_100004443	3300005456	Bacteria	7958
63	Ga0070678_100051340	3300005456	Bacteria	2989
64	Ga0070678_100193923	3300005456	Bacteria	1672
65	Ga0070662_100029392	3300005457	Bacteria	3835
66	Ga0070662_100048100	3300005457	Bacteria	3071
67	Ga0068867_100000594	3300005459	Bacteria	23939
68	Ga0068867_100001397	3300005459	Bacteria	16695
69	Ga0070707_100028450	3300005468	Bacteria	5320
70	Ga0070707_100148786	3300005468	Bacteria	2280
71	Ga0070698_100003720	3300005471	Bacteria	16754
72	Ga0070698_100056751	3300005471	Bacteria	3966
73	Ga0070698_100099792	3300005471	Bacteria	2876
74	Ga0070698_100288489	3300005471	Unclassified	1572
75	Ga0070699_100001411	3300005518	Bacteria	22076
76	Ga0070699_100003891	3300005518	Bacteria	13200
77	Ga0070699_100023998	3300005518	Bacteria	5256
78	Ga0070697_100076187	3300005536	Bacteria	2759
79	Ga0070697_100210740	3300005536	Bacteria	1654
80	Ga0070672_100024944	3300005543	Bacteria	4427
81	Ga0070672_100062251	3300005543	Bacteria	2944
82	Ga0070672_100099925	3300005543	Bacteria	2352
83	Ga0070672_100212029	3300005543	Bacteria	1622
84	Ga0070672_100233336	3300005543	Bacteria	1546
85	Ga0070686_100008779	3300005544	Bacteria	5662
86	Ga0070686_100055633	3300005544	Bacteria	2535
87	Ga0070686_100247408	3300005544	Unclassified	1301
88	Ga0070695_100002507	3300005545	Bacteria	10581
89	Ga0070695_100147617	3300005545	Unclassified	1638
90	Ga0070696_100002271	3300005546	Bacteria	12669
91	Ga0070696_100003087	3300005546	Bacteria	11076
92	Ga0070696_100006141	3300005546	Bacteria	8027
93	Ga0070696_100067258	3300005546	Bacteria	2514
94	Ga0070704_100004515	3300005549	Bacteria	8038
95	Ga0070704_100136503	3300005549	Bacteria	1909
96	Ga0070704_100301666	3300005549	Unclassified	1335
97	Ga0070704_100533577	3300005549	Bacteria	1023
98	Ga0068855_100248007	3300005563	Unclassified	1987
99	Ga0070664_100005188	3300005564	Bacteria	10447
100	Ga0070664_100023364	3300005564	Bacteria	5106
101	Ga0068857_100017351	3300005577	Bacteria	6306
102	Ga0068857_100113709	3300005577	Bacteria	2434
103	Ga0068854_100057869	3300005578	Bacteria	2797
104	Ga0068854_100110524	3300005578	Bacteria	2073
105	Ga0070702_100030793	3300005615	Bacteria	2929
106	Ga0070702_100081717	3300005615	Bacteria	1937
107	Ga0068859_100001202	3300005617	Bacteria	26419
108	Ga0068859_100005809	3300005617	Bacteria	12531
109	Ga0068859_100068116	3300005617	Bacteria	3594
110	Ga0068859_100163220	3300005617	Bacteria	2307
111	Ga0068859_100235903	3300005617	Unclassified	1918
112	Ga0068859_100431769	3300005617	Bacteria	1414
113	Ga0068864_100050135	3300005618	Bacteria	3592
114	Ga0068864_100105109	3300005618	Bacteria	2509
115	Ga0068864_100118802	3300005618	Bacteria	2361
116	Ga0068864_100157996	3300005618	Bacteria	2059
117	Ga0068866_10028676	3300005718	Bacteria	2655
118	Ga0068861_100017638	3300005719	Bacteria	5073
119	Ga0068861_100122209	3300005719	Bacteria	2102
120	Ga0068861_100276908	3300005719	Unclassified	1443
121	Ga0068851_10006118	3300005834	Bacteria	5491
122	Ga0068870_10016718	3300005840	Bacteria	3512
123	Ga0068870_10018196	3300005840	Unclassified	3389
124	Ga0068870_10023570	3300005840	Bacteria	3037
125	Ga0068863_100025032	3300005841	Bacteria	5692
126	Ga0068863_100048745	3300005841	Bacteria	4016
127	Ga0068858_100020312	3300005842	Bacteria	6212
128	Ga0068858_100117584	3300005842	Bacteria	2485
129	Ga0068860_100008479	3300005843	Bacteria	10242
130	Ga0068860_100011410	3300005843	Bacteria	8755
131	Ga0068860_100027542	3300005843	Bacteria	5472
132	Ga0068860_100112637	3300005843	Bacteria	2601
133	Ga0068862_100000554	3300005844	Bacteria	39072
134	Ga0068862_100047760	3300005844	Bacteria	3654
135	Ga0068871_100220053	3300006358	Bacteria	1645
136	Ga0075428_100003021	3300006844	Bacteria	18363
137	Ga0075428_100004391	3300006844	Bacteria	15569
138	Ga0075428_100004797	3300006844	Bacteria	14992
139	Ga0075428_100265149	3300006844	Bacteria	1849
140	Ga0075430_100000572	3300006846	Bacteria	27946
141	Ga0075430_100005451	3300006846	Bacteria	10748
142	Ga0075431_100000551	3300006847	Bacteria	31528
143	Ga0075431_100025073	3300006847	Bacteria	6115
144	Ga0075433_10000555	3300006852	Bacteria	24602
145	Ga0075433_10010593	3300006852	Bacteria	7411
146	Ga0075433_10273461	3300006852	Unclassified	1497
147	Ga0075433_10297723	3300006852	Unclassified	1429
148	Ga0075434_100001213	3300006871	Bacteria	21404
149	Ga0075434_100011136	3300006871	Bacteria	8463
150	Ga0075434_100044943	3300006871	Bacteria	4381
151	Ga0075434_100070794	3300006871	Bacteria	3478
152	Ga0075434_100247578	3300006871	Unclassified	1802
153	Ga0075434_100531284	3300006871	Bacteria	1196
154	Ga0075429_100024270	3300006880	Bacteria	5261
155	Ga0075429_100037687	3300006880	Unclassified	4209
156	Ga0075429_100115735	3300006880	Unclassified	2344
157	Ga0075429_100148825	3300006880	Unclassified	2050
158	Ga0068865_100007639	3300006881	Bacteria	6658
159	Ga0097620_100001202	3300006931	Bacteria	26419
160	Ga0097620_100005810	3300006931	Bacteria	12531
161	Ga0097620_100068116	3300006931	Bacteria	3594
162	Ga0097620_100163216	3300006931	Bacteria	2307
163	Ga0097620_100235899	3300006931	Unclassified	1918
164	Ga0097620_100431742	3300006931	Bacteria	1414
165	Ga0075435_100002765	3300007076	Bacteria	11718
166	Ga0075435_100007149	3300007076	Bacteria	7935
167	Ga0075435_100045079	3300007076	Bacteria	3533
168	Ga0075435_100174121	3300007076	Bacteria	1816
169	Ga0075435_100296297	3300007076	Bacteria	1383
170	Ga0105240_10229701	3300009093	Bacteria	2157
171	Ga0111539_10000057	3300009094	Bacteria	114860
172	Ga0111539_10000442	3300009094	Bacteria	52293
173	Ga0111539_10000716	3300009094	Bacteria	43096
174	Ga0111539_10002452	3300009094	Bacteria	24652
175	Ga0111539_10026984	3300009094	Bacteria	7014
176	Ga0111539_10044795	3300009094	Bacteria	5298
177	Ga0111539_10069812	3300009094	Bacteria	4148
178	Ga0111539_10375623	3300009094	Bacteria	1655
179	Ga0111539_10542636	3300009094	Unclassified	1355
180	Ga0114129_10000428	3300009147	Bacteria	49983
181	Ga0114129_10003809	3300009147	Bacteria	21256
182	Ga0114129_10022531	3300009147	Bacteria	8937
183	Ga0114129_10046468	3300009147	Bacteria	6101
184	Ga0114129_10054833	3300009147	Bacteria	5588
185	Ga0114129_10092125	3300009147	Bacteria	4199
186	Ga0114129_10384155	3300009147	Bacteria	1854
187	Ga0114129_10522125	3300009147	Bacteria	1548
188	Ga0114129_10681595	3300009147	Unclassified	1323
189	Ga0105243_10565669	3300009148	Bacteria	1089
190	Ga0105241_10127348	3300009174	Unclassified	2058
191	Ga0105242_10003459	3300009176	Bacteria	12280
192	Ga0105248_10069117	3300009177	Unclassified	3965
193	Ga0105248_10260479	3300009177	Bacteria	1952
194	Ga0105248_10532695	3300009177	Bacteria	1325
195	Ga0105248_10597649	3300009177	Bacteria	1245
196	Ga0105249_10126671	3300009553	Unclassified	2433
197	Ga0105249_10273574	3300009553	Bacteria	1683
198	Ga0163162_10034122	3300013306	Bacteria	5062
199	Ga0157375_10037739	3300013308	Bacteria	4632
200	Ga0157375_10077240	3300013308	Bacteria	3359
201	Ga0157375_10155329	3300013308	Bacteria	2427
202	Ga0157375_10204091	3300013308	Unclassified	2133
203	Ga0157375_10268325	3300013308	Unclassified	1868
204	Ga0157375_10282054	3300013308	Bacteria	1824
205	Ga0157375_10300046	3300013308	Bacteria	1770
206	Ga0163163_10059109	3300014325	Bacteria	3791
207	Ga0163163_10088087	3300014325	Bacteria	3116
208	Ga0157380_10004321	3300014326	Bacteria	9852
209	Ga0157380_10014696	3300014326	Bacteria	5733
210	Ga0157380_10035266	3300014326	Unclassified	3863
211	Ga0157380_10048247	3300014326	Bacteria	3353
212	Ga0157380_10087554	3300014326	Bacteria	2561
213	Ga0157380_10129190	3300014326	Unclassified	2153
214	Ga0157380_10160733	3300014326	Unclassified	1952
215	Ga0157377_10016027	3300014745	Bacteria	3847
216	Ga0157377_10026770	3300014745	Bacteria	3090
217	Ga0157377_10119062	3300014745	Unclassified	1598
218	Ga0157379_10030803	3300014968	Bacteria	4777
219	Ga0157379_10146180	3300014968	Bacteria	2132
220	Ga0157379_10385655	3300014968	Bacteria	1286
221	Ga0157376_10137984	3300014969	Bacteria	2184
222	Ga0157376_10600303	3300014969	Unclassified	1095
223	Ga0163161_10322253	3300017792	Bacteria	1222
224	Ga0207656_10064428	3300025321	Bacteria	1615
225	Ga0207682_10016070	3300025893	Bacteria	2917
226	Ga0207682_10033665	3300025893	Unclassified	2064
227	Ga0207642_10017769	3300025899	Bacteria	2713
228	Ga0207688_10229700	3300025901	Bacteria	1120
229	Ga0207680_10150661	3300025903	Unclassified	1550
230	Ga0207645_10001086	3300025907	Bacteria	22411
231	Ga0207645_10004581	3300025907	Bacteria	10193
232	Ga0207645_10053886	3300025907	Bacteria	2569
233	Ga0207643_10013434	3300025908	Bacteria	4435
234	Ga0207643_10023324	3300025908	Unclassified	3411
235	Ga0207643_10070961	3300025908	Bacteria	2004
236	Ga0207643_10101488	3300025908	Unclassified	1687
237	Ga0207705_10219533	3300025909	Bacteria	1444
238	Ga0207695_10086515	3300025913	Bacteria	3161
239	Ga0207662_10000203	3300025918	Bacteria	27604
240	Ga0207662_10004389	3300025918	Bacteria	7409
241	Ga0207662_10192333	3300025918	Unclassified	1317
242	Ga0207649_10084139	3300025920	Unclassified	2067
243	Ga0207646_10126567	3300025922	Bacteria	2298
244	Ga0207646_10409944	3300025922	Bacteria	1224
245	Ga0207681_10023167	3300025923	Unclassified	3969
246	Ga0207681_10083555	3300025923	Unclassified	2260
247	Ga0207681_10107628	3300025923	Bacteria	2022
248	Ga0207681_10135142	3300025923	Bacteria	1829
249	Ga0207681_10145850	3300025923	Bacteria	1768
250	Ga0207681_10155555	3300025923	Bacteria	1718
251	Ga0207681_10238288	3300025923	Unclassified	1415
252	Ga0207650_10015383	3300025925	Bacteria	5327
253	Ga0207650_10229959	3300025925	Unclassified	1495
254	Ga0207650_10444767	3300025925	Bacteria	1078
255	Ga0207659_10000228	3300025926	Bacteria	34204
256	Ga0207659_10004480	3300025926	Bacteria	8452
257	Ga0207659_10016978	3300025926	Bacteria	4748
258	Ga0207659_10032413	3300025926	Bacteria	3586
259	Ga0207659_10033754	3300025926	Unclassified	3525
260	Ga0207659_10068423	3300025926	Bacteria	2582
261	Ga0207659_10100456	3300025926	Bacteria	2180
262	Ga0207659_10263107	3300025926	Bacteria	1404
263	Ga0207687_10146876	3300025927	Unclassified	1795
264	Ga0207644_10039370	3300025931	Bacteria	3336
265	Ga0207644_10068007	3300025931	Bacteria	2598
266	Ga0207690_10129186	3300025932	Bacteria	1847
267	Ga0207706_10003779	3300025933	Bacteria	14441
268	Ga0207706_10045894	3300025933	Bacteria	3870
269	Ga0207706_10092010	3300025933	Bacteria	2666
270	Ga0207669_10000432	3300025937	Bacteria	18312
271	Ga0207669_10004138	3300025937	Bacteria	6359
272	Ga0207704_10081427	3300025938	Bacteria	2094
273	Ga0207691_10008762	3300025940	Bacteria	9705
274	Ga0207691_10060158	3300025940	Bacteria	3452
275	Ga0207691_10074796	3300025940	Bacteria	3055
276	Ga0207711_10133942	3300025941	Bacteria	2224
277	Ga0207711_10229795	3300025941	Bacteria	1699
278	Ga0207711_10318494	3300025941	Bacteria	1437
279	Ga0207689_10001594	3300025942	Bacteria	21468
280	Ga0207689_10002683	3300025942	Bacteria	16455
281	Ga0207689_10076559	3300025942	Unclassified	2750
282	Ga0207661_10096085	3300025944	Unclassified	2479
283	Ga0207679_10019254	3300025945	Bacteria	4583
284	Ga0207679_10440011	3300025945	Bacteria	1154
285	Ga0207651_10005627	3300025960	Bacteria	6457
286	Ga0207651_10355388	3300025960	Bacteria	1235
287	Ga0207712_10103901	3300025961	Unclassified	2118
288	Ga0207668_10083419	3300025972	Unclassified	2325
289	Ga0207668_10200101	3300025972	Bacteria	1590
290	Ga0207640_10046776	3300025981	Bacteria	2787
291	Ga0207658_10080222	3300025986	Bacteria	2499
292	Ga0207703_10024969	3300026035	Bacteria	4701
293	Ga0207703_10073578	3300026035	Bacteria	2827
294	Ga0207708_10004413	3300026075	Bacteria	10368
295	Ga0207708_10020511	3300026075	Bacteria	4985
296	Ga0207708_10096566	3300026075	Unclassified	2283
297	Ga0207708_10148067	3300026075	Bacteria	1846
298	Ga0207708_10188029	3300026075	Bacteria	1642
299	Ga0207708_10210426	3300026075	Unclassified	1554
300	Ga0207641_10104087	3300026088	Bacteria	2505
301	Ga0207648_10000163	3300026089	Bacteria	68352
302	Ga0207648_10000600	3300026089	Bacteria	40518
303	Ga0207648_10037583	3300026089	Bacteria	4266
304	Ga0207648_10075304	3300026089	Bacteria	2942
305	Ga0207676_10057118	3300026095	Bacteria	3072
306	Ga0207676_10124521	3300026095	Bacteria	2180
307	Ga0207676_10224891	3300026095	Bacteria	1674
308	Ga0207676_10239799	3300026095	Bacteria	1626
309	Ga0207674_10091661	3300026116	Bacteria	3029
310	Ga0207674_10395709	3300026116	Unclassified	1335
311	Ga0207675_100006784	3300026118	Bacteria	10833
312	Ga0207675_100012666	3300026118	Bacteria	7879
313	Ga0207675_100013916	3300026118	Bacteria	7501
314	Ga0207675_100036898	3300026118	Bacteria	4559
315	Ga0207675_100131835	3300026118	Bacteria	2370
316	Ga0207675_100147640	3300026118	Bacteria	2237
317	Ga0207675_100151204	3300026118	Bacteria	2209
318	Ga0207675_100414192	3300026118	Unclassified	1330
319	Ga0207683_10071858	3300026121	Bacteria	3060
320	Ga0207683_10083626	3300026121	Bacteria	2836
321	Ga0207683_10122196	3300026121	Bacteria	2338
322	Ga0207683_10253522	3300026121	Unclassified	1606
323	Ga0209974_10011637	3300027876	Unclassified	2953
324	Ga0207428_10000520	3300027907	Bacteria	46036
325	Ga0207428_10001289	3300027907	Bacteria	26736
326	Ga0207428_10001366	3300027907	Bacteria	25889
327	Ga0207428_10008732	3300027907	Bacteria	9142
328	Ga0207428_10053534	3300027907	Bacteria	3217
329	Ga0207428_10160393	3300027907	Bacteria	1708
330	Ga0268265_10019075	3300028380	Bacteria	4762
331	Ga0268265_10074586	3300028380	Unclassified	2654
332	Ga0268265_10452669	3300028380	Bacteria	1199
333	Ga0268264_10065174	3300028381	Bacteria	3068
334	Ga0268264_10172074	3300028381	Bacteria	1959
335	Ga0268264_10194192	3300028381	Bacteria	1852
336	Ga0268264_10331598	3300028381	Bacteria	1442
337	Ga0307405_10002964	3300031731	Bacteria	7667
338	Ga0307412_10024732	3300031911	Bacteria	3710
339	Ga0307409_100008021	3300031995	Bacteria	6367
340	Ga0307409_100697789	3300031995	Bacteria	1014
341	Ga0307414_10219674	3300032004	Unclassified	1559
342	Ga0307411_10005070	3300032005	Bacteria	6413
343	Ga0307415_100008036	3300032126	Bacteria	5821
344	Ga0373950_0000460	3300034818	Bacteria	4991
345	Ga0373958_0001457	3300034819	Bacteria	3186
346	Ga0373958_0017841	3300034819	Bacteria	1281
347	Ga0373938_0003863	3300034957	Bacteria	2475
348	Ga0373928_0006798	3300035084	Unclassified	2203
349	Ga0373940_0001709	3300035088	Bacteria	4063
350	Ga0373951_0001829	3300035091	Bacteria	5518
351	Ga0373939_0003370	3300035114	Bacteria	3751
352	Ga0373941_0008296	3300035115	Unclassified	2574
353	Ga0373960_0003188	3300035121	Bacteria	3708
354	Ga0373942_0013145	3300035207	Unclassified	1986
355	Ga0373961_0001523	3300035241	Bacteria	6730
356	Ga0373962_0003877	3300035242	Unclassified	3600
357	Ga0373931_0008753	3300035691	Bacteria	4816
358	Ga0439453_0014953	3300041408	Unclassified	1337
359	Ga0451853_1179651	3300041512	Bacteria	1512
360	Ga0439433_0013096	3300041999	Unclassified	1821
361	Ga0439435_0034556	3300042436	Bacteria	1390
362	Ga0439435_0055373	3300042436	Bacteria	1144
363	Ga0450916_002418	3300042530	Unclassified	1980
364	Ga0451576_0017464	3300045051	Bacteria	7888
365	Ga0451576_0028322	3300045051	Bacteria	6002
366	Ga0451576_0033893	3300045051	Bacteria	5425
367	Ga0451576_0083459	3300045051	Bacteria	3324
368	Ga0451576_0084420	3300045051	Bacteria	3303
369	Ga0451576_0370661	3300045051	Bacteria	1500
370	Ga0451576_0462669	3300045051	Bacteria	1332
371	Ga0495603_0034110	3300046455	Bacteria	3062
372	Ga0495629_0002252	3300046459	Bacteria	14871
373	Ga0495580_0195542	3300046472	Bacteria	1394
374	Ga0495584_0199266	3300046491	Bacteria	1018
375	Ga0495594_0012130	3300046499	Bacteria	4487
376	Ga0495643_0006435	3300046522	Bacteria	7744
377	Ga0495598_0010671	3300046537	Unclassified	2206
378	Ga0495621_0001751	3300046539	Bacteria	5690
379	Ga0495621_0013956	3300046539	Unclassified	2535
380	Ga0495621_0035073	3300046539	Bacteria	1736
381	Ga0495621_0057468	3300046539	Bacteria	1405
382	Ga0495656_0011886	3300046615	Unclassified	3202
383	Ga0495659_0006671	3300046664	Bacteria	3647
384	Ga0495659_0044306	3300046664	Unclassified	1599
385	Ga0495659_0055452	3300046664	Unclassified	1452
386	Ga0495588_0023061	3300046674	Bacteria	3078
387	Ga0495623_0043593	3300046679	Unclassified	2854
388	Ga0495658_0007615	3300046683	Bacteria	5367
389	Ga0495669_0137313	3300046684	Unclassified	1153
390	Ga0495670_0025598	3300046691	Unclassified	2919
391	Ga0495685_049437	3300047447	Bacteria	1428
392	Ga0496104_0148029	3300048907	Bacteria	2255
393	Ga0496104_0341668	3300048907	Bacteria	1410
394	Ga0496106_0132982	3300048909	Bacteria	1952
395	Ga0496106_0171475	3300048909	Bacteria	1720
396	Ga0496108_0166850	3300048911	Bacteria	1904
397	Ga0496113_0081798	3300048916	Bacteria	2476
398	Ga0496114_0113412	3300048917	Bacteria	2324
399	Ga0501039_0272291	3300049575	Unclassified	1331
400	Ga0501040_0092306	3300049576	Unclassified	2105
401	Ga0501048_0242494	3300049582	Unclassified	1279
402	Ga0501068_0088766	3300049584	Bacteria	1905
403	Ga0501071_0179060	3300049587	Unclassified	1588
404	Ga0501074_0234652	3300049590	Bacteria	1305
405	Ga0501074_0394344	3300049590	Bacteria	982
406	Ga0501081_0016787	3300049743	Bacteria	4840
407	nmdc:mga05p37_16849_c1	3300050507	Bacteria	8809
408	nmdc:mga05p37_312251_c1	3300050507	Bacteria	1863
409	nmdc:mga05p37_4324_c1	3300050507	Bacteria	16595
410	nmdc:mga05p37_55453_c1	3300050507	Unclassified	4877
411	nmdc:mga09592_108065_c1	3300050508	Unclassified	2386
412	nmdc:mga09592_2762_c2	3300050508	Bacteria	11953
413	nmdc:mga09592_51315_c1	3300050508	Unclassified	3480
414	nmdc:mga09592_64612_c1	3300050508	Bacteria	3098
415	nmdc:mga09592_69501_c1	3300050508	Unclassified	2988
416	nmdc:mga0qj67_4492_c1	3300050509	Bacteria	10107
417	nmdc:mga06r32_109628_c1	3300050510	Bacteria	2715
418	nmdc:mga06r32_153957_c1	3300050510	Unclassified	2279
419	nmdc:mga06r32_23352_c1	3300050510	Bacteria	5721
420	nmdc:mga08y16_1036_c1	3300050511	Bacteria	12243
421	nmdc:mga08y16_117367_c1	3300050511	Unclassified	2770
422	nmdc:mga08y16_1831_c1	3300050511	Bacteria	21551
423	nmdc:mga08y16_3411_c1	3300050511	Bacteria	16480
424	nmdc:mga08y16_495406_c1	3300050511	Unclassified	1242
425	nmdc:mga08y16_5024_c1	3300050511	Bacteria	13831
426	nmdc:mga08y16_55090_c1	3300050511	Bacteria	4156
427	nmdc:mga08y16_8801_c1	3300050511	Bacteria	10596
428	nmdc:mga0n895_116477_c1	3300050512	Bacteria	2691
429	nmdc:mga0n895_139298_c1	3300050512	Bacteria	2454
430	nmdc:mga0n895_25092_c1	3300050512	Bacteria	5628
431	nmdc:mga0n895_37444_c1	3300050512	Bacteria	4693
432	nmdc:mga0n895_78576_c1	3300050512	Bacteria	3284
433	nmdc:mga0rr50_1933_c1	3300050513	Bacteria	11522
434	nmdc:mga0rr50_25334_c1	3300050513	Bacteria	4122
435	nmdc:mga0rr50_322456_c1	3300050513	Unclassified	1295
436	nmdc:mga0rr50_96415_c1	3300050513	Bacteria	2314
437	nmdc:mga0a205_121405_c1	3300050515	Bacteria	2512
438	nmdc:mga0a205_277455_c1	3300050515	Bacteria	1552
439	nmdc:mga0a205_33354_c1	3300050515	Bacteria	4937
440	nmdc:mga0a205_35723_c1	3300050515	Unclassified	4772
441	nmdc:mga0a205_44307_c1	3300050515	Bacteria	4288
442	nmdc:mga0a205_58166_c1	3300050515	Unclassified	3734
443	nmdc:mga0a205_7033_c1	3300050515	Bacteria	10166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005471	Ga0070698_100056751	Ga0070698_1000567511	297
2	3300005518	Ga0070699_100001411	Ga0070699_10000141111	297
3	3300005546	Ga0070696_100002271	Ga0070696_10000227113	297
4	3300009147	Ga0114129_10522125	Ga0114129_105221252	301
5	3300005444	Ga0070694_100006985	Ga0070694_1000069859	305
6	3300005545	Ga0070695_100002507	Ga0070695_10000250714	305
7	3300005546	Ga0070696_100067258	Ga0070696_1000672582	305
8	3300005549	Ga0070704_100301666	Ga0070704_1003016661	305
9	3300046664	Ga0495659_0055452	Ga0495659_0055452_339_1310	306
10	3300005455	Ga0070663_100336862	Ga0070663_1003368621	307
11	3300005440	Ga0070705_100002741	Ga0070705_1000027412	308
12	3300005444	Ga0070694_100004314	Ga0070694_1000043142	308
13	3300005468	Ga0070707_100148786	Ga0070707_1001487862	308
14	3300005471	Ga0070698_100003720	Ga0070698_10000372012	308
15	3300005518	Ga0070699_100003891	Ga0070699_10000389111	308
16	3300005546	Ga0070696_100006141	Ga0070696_10000614112	308
17	3300005549	Ga0070704_100004515	Ga0070704_10000451512	308
18	3300007076	Ga0075435_100174121	Ga0075435_1001741213	308
19	3300009094	Ga0111539_10000442	Ga0111539_100004425	308
20	3300009147	Ga0114129_10681595	Ga0114129_106815952	308
21	3300025922	Ga0207646_10126567	Ga0207646_101265673	308
22	3300027907	Ga0207428_10001366	Ga0207428_1000136618	308
23	3300050511	nmdc:mga08y16_1036_c1	nmdc:mga08y16_1036_c1_9388_10347	308
24	3300009094	Ga0111539_10026984	Ga0111539_100269845	309
25	3300027907	Ga0207428_10053534	Ga0207428_100535343	309
26	3300041512	Ga0451853_1179651	Ga0451853_1179651_322_1284	311
27	3300006871	Ga0075434_100531284	Ga0075434_1005312841	312
28	3300050512	nmdc:mga0n895_139298_c1	nmdc:mga0n895_139298_c1_1301_2260	312
29	3300050515	nmdc:mga0a205_33354_c1	nmdc:mga0a205_33354_c1_167_1126	312
30	3300005436	Ga0070713_100022857	Ga0070713_1000228574	315
31	3300007076	Ga0075435_100002765	Ga0075435_1000027652	315
32	3300050513	nmdc:mga0rr50_1933_c1	nmdc:mga0rr50_1933_c1_1785_2747	315
33	3300005333	Ga0070677_10066399	Ga0070677_100663991	317
34	3300005343	Ga0070687_100008182	Ga0070687_1000081823	317
35	3300005347	Ga0070668_100200274	Ga0070668_1002002742	317
36	3300005356	Ga0070674_100005071	Ga0070674_1000050712	317
37	3300005441	Ga0070700_100042095	Ga0070700_1000420952	317
38	3300005445	Ga0070708_100035684	Ga0070708_1000356843	317
39	3300005471	Ga0070698_100288489	Ga0070698_1002884892	317
40	3300005544	Ga0070686_100055633	Ga0070686_1000556332	317
41	3300005544	Ga0070686_100247408	Ga0070686_1002474081	317
42	3300005545	Ga0070695_100147617	Ga0070695_1001476172	317
43	3300005563	Ga0068855_100248007	Ga0068855_1002480072	317
44	3300005578	Ga0068854_100110524	Ga0068854_1001105242	317
45	3300005719	Ga0068861_100276908	Ga0068861_1002769082	317
46	3300006871	Ga0075434_100044943	Ga0075434_1000449431	317
47	3300007076	Ga0075435_100296297	Ga0075435_1002962972	317
48	3300009093	Ga0105240_10229701	Ga0105240_102297013	317
49	3300009147	Ga0114129_10092125	Ga0114129_100921254	317
50	3300009174	Ga0105241_10127348	Ga0105241_101273482	317
51	3300014326	Ga0157380_10014696	Ga0157380_100146962	317
52	3300025913	Ga0207695_10086515	Ga0207695_100865153	317
53	3300025933	Ga0207706_10045894	Ga0207706_100458942	317
54	3300025937	Ga0207669_10004138	Ga0207669_100041386	317
55	3300025941	Ga0207711_10229795	Ga0207711_102297951	317
56	3300025972	Ga0207668_10200101	Ga0207668_102001012	317
57	3300025981	Ga0207640_10046776	Ga0207640_100467762	317
58	3300026118	Ga0207675_100414192	Ga0207675_1004141922	317
59	3300031995	Ga0307409_100697789	Ga0307409_1006977891	317
60	3300034818	Ga0373950_0000460	Ga0373950_0000460_1654_2631	317
61	3300034819	Ga0373958_0001457	Ga0373958_0001457_1701_2678	317
62	3300034957	Ga0373938_0003863	Ga0373938_0003863_509_1486	317
63	3300035084	Ga0373928_0006798	Ga0373928_0006798_618_1595	317
64	3300035088	Ga0373940_0001709	Ga0373940_0001709_2148_3125	317
65	3300035091	Ga0373951_0001829	Ga0373951_0001829_2715_3692	317
66	3300035114	Ga0373939_0003370	Ga0373939_0003370_1884_2861	317
67	3300035115	Ga0373941_0008296	Ga0373941_0008296_1013_1990	317
68	3300035121	Ga0373960_0003188	Ga0373960_0003188_1836_2813	317
69	3300035207	Ga0373942_0013145	Ga0373942_0013145_578_1555	317
70	3300035241	Ga0373961_0001523	Ga0373961_0001523_598_1575	317
71	3300035242	Ga0373962_0003877	Ga0373962_0003877_784_1761	317
72	3300035691	Ga0373931_0008753	Ga0373931_0008753_1507_2484	317
73	3300045051	Ga0451576_0084420	Ga0451576_0084420_2113_3090	317
74	3300048907	Ga0496104_0148029	Ga0496104_0148029_612_1592	317
75	3300048909	Ga0496106_0132982	Ga0496106_0132982_94_1071	317
76	3300048909	Ga0496106_0171475	Ga0496106_0171475_42_1022	317
77	3300048917	Ga0496114_0113412	Ga0496114_0113412_1233_2213	317
78	3300049575	Ga0501039_0272291	Ga0501039_0272291_71_1042	317
79	3300049576	Ga0501040_0092306	Ga0501040_0092306_855_1826	317
80	3300049582	Ga0501048_0242494	Ga0501048_0242494_48_1019	317
81	3300049587	Ga0501071_0179060	Ga0501071_0179060_31_1002	317
82	3300050513	nmdc:mga0rr50_96415_c1	nmdc:mga0rr50_96415_c1_152_1129	317
83	3300001977	JGI24746J21847_1008937	JGI24746J21847_10089371	318
84	3300005327	Ga0070658_10256179	Ga0070658_102561792	318
85	3300005335	Ga0070666_10047893	Ga0070666_100478932	318
86	3300005343	Ga0070687_100010866	Ga0070687_1000108663	318
87	3300005353	Ga0070669_100031997	Ga0070669_1000319972	318
88	3300005543	Ga0070672_100024944	Ga0070672_1000249442	318
89	3300005544	Ga0070686_100008779	Ga0070686_1000087796	318
90	3300005617	Ga0068859_100005809	Ga0068859_10000580912	318
91	3300005618	Ga0068864_100105109	Ga0068864_1001051092	318
92	3300005840	Ga0068870_10018196	Ga0068870_100181962	318
93	3300006844	Ga0075428_100003021	Ga0075428_10000302114	318
94	3300006852	Ga0075433_10010593	Ga0075433_100105937	318
95	3300006871	Ga0075434_100011136	Ga0075434_1000111368	318
96	3300006880	Ga0075429_100037687	Ga0075429_1000376873	318
97	3300006931	Ga0097620_100005810	Ga0097620_1000058101	318
98	3300009094	Ga0111539_10044795	Ga0111539_100447951	318
99	3300009553	Ga0105249_10126671	Ga0105249_101266714	318
100	3300013306	Ga0163162_10034122	Ga0163162_100341226	318
101	3300013308	Ga0157375_10268325	Ga0157375_102683252	318
102	3300014326	Ga0157380_10035266	Ga0157380_100352665	318
103	3300014968	Ga0157379_10030803	Ga0157379_100308031	318
104	3300025893	Ga0207682_10033665	Ga0207682_100336651	318
105	3300025908	Ga0207643_10023324	Ga0207643_100233241	318
106	3300025909	Ga0207705_10219533	Ga0207705_102195332	318
107	3300025918	Ga0207662_10000203	Ga0207662_1000020311	318
108	3300025920	Ga0207649_10084139	Ga0207649_100841391	318
109	3300025923	Ga0207681_10083555	Ga0207681_100835554	318
110	3300025942	Ga0207689_10001594	Ga0207689_1000159421	318
111	3300025961	Ga0207712_10103901	Ga0207712_101039011	318
112	3300025972	Ga0207668_10083419	Ga0207668_100834192	318
113	3300026075	Ga0207708_10096566	Ga0207708_100965661	318
114	3300026095	Ga0207676_10239799	Ga0207676_102397992	318
115	3300026118	Ga0207675_100012666	Ga0207675_1000126662	318
116	3300028380	Ga0268265_10074586	Ga0268265_100745864	318
117	3300034819	Ga0373958_0017841	Ga0373958_0017841_25_981	318
118	3300045051	Ga0451576_0028322	Ga0451576_0028322_26_982	318
119	3300050508	nmdc:mga09592_51315_c1	nmdc:mga09592_51315_c1_912_1868	318
120	3300050512	nmdc:mga0n895_37444_c1	nmdc:mga0n895_37444_c1_227_1183	318
121	3300050515	nmdc:mga0a205_58166_c1	nmdc:mga0a205_58166_c1_2749_3705	318
122	3300005293	Ga0065715_10014533	Ga0065715_100145332	319
123	3300005295	Ga0065707_10013881	Ga0065707_100138813	319
124	3300005331	Ga0070670_100164619	Ga0070670_1001646192	319
125	3300005334	Ga0068869_100004693	Ga0068869_1000046934	319
126	3300005334	Ga0068869_100024853	Ga0068869_1000248532	319
127	3300005335	Ga0070666_10115172	Ga0070666_101151722	319
128	3300005338	Ga0068868_100002029	Ga0068868_1000020292	319
129	3300005343	Ga0070687_100165060	Ga0070687_1001650601	319
130	3300005353	Ga0070669_100048234	Ga0070669_1000482344	319
131	3300005354	Ga0070675_100000385	Ga0070675_10000038516	319
132	3300005354	Ga0070675_100006084	Ga0070675_1000060846	319
133	3300005354	Ga0070675_100010003	Ga0070675_1000100037	319
134	3300005354	Ga0070675_100040445	Ga0070675_1000404452	319
135	3300005354	Ga0070675_100092817	Ga0070675_1000928174	319
136	3300005355	Ga0070671_100021991	Ga0070671_1000219915	319
137	3300005355	Ga0070671_100061669	Ga0070671_1000616692	319
138	3300005356	Ga0070674_100002445	Ga0070674_1000024451	319
139	3300005356	Ga0070674_100161080	Ga0070674_1001610802	319
140	3300005364	Ga0070673_100021523	Ga0070673_1000215236	319
141	3300005364	Ga0070673_100120449	Ga0070673_1001204492	319
142	3300005364	Ga0070673_100134468	Ga0070673_1001344682	319
143	3300005364	Ga0070673_100244625	Ga0070673_1002446252	319
144	3300005364	Ga0070673_100307762	Ga0070673_1003077622	319
145	3300005365	Ga0070688_100039703	Ga0070688_1000397033	319
146	3300005366	Ga0070659_100114632	Ga0070659_1001146321	319
147	3300005366	Ga0070659_100191214	Ga0070659_1001912142	319
148	3300005441	Ga0070700_100019558	Ga0070700_1000195581	319
149	3300005456	Ga0070678_100004443	Ga0070678_1000044438	319
150	3300005456	Ga0070678_100051340	Ga0070678_1000513402	319
151	3300005456	Ga0070678_100193923	Ga0070678_1001939231	319
152	3300005457	Ga0070662_100048100	Ga0070662_1000481003	319
153	3300005459	Ga0068867_100001397	Ga0068867_1000013974	319
154	3300005536	Ga0070697_100210740	Ga0070697_1002107402	319
155	3300005543	Ga0070672_100062251	Ga0070672_1000622512	319
156	3300005543	Ga0070672_100099925	Ga0070672_1000999251	319
157	3300005543	Ga0070672_100212029	Ga0070672_1002120292	319
158	3300005543	Ga0070672_100233336	Ga0070672_1002333362	319
159	3300005564	Ga0070664_100023364	Ga0070664_1000233641	319
160	3300005617	Ga0068859_100163220	Ga0068859_1001632202	319
161	3300005617	Ga0068859_100235903	Ga0068859_1002359033	319
162	3300005617	Ga0068859_100431769	Ga0068859_1004317691	319
163	3300005618	Ga0068864_100118802	Ga0068864_1001188024	319
164	3300005718	Ga0068866_10028676	Ga0068866_100286763	319
165	3300005719	Ga0068861_100122209	Ga0068861_1001222091	319
166	3300005834	Ga0068851_10006118	Ga0068851_100061186	319
167	3300005841	Ga0068863_100048745	Ga0068863_1000487453	319
168	3300005842	Ga0068858_100117584	Ga0068858_1001175842	319
169	3300005843	Ga0068860_100011410	Ga0068860_1000114103	319
170	3300005843	Ga0068860_100027542	Ga0068860_1000275426	319
171	3300005844	Ga0068862_100047760	Ga0068862_1000477604	319
172	3300006844	Ga0075428_100004391	Ga0075428_1000043913	319
173	3300006844	Ga0075428_100265149	Ga0075428_1002651492	319
174	3300006846	Ga0075430_100000572	Ga0075430_10000057217	319
175	3300006846	Ga0075430_100005451	Ga0075430_1000054515	319
176	3300006847	Ga0075431_100000551	Ga0075431_10000055113	319
177	3300006847	Ga0075431_100025073	Ga0075431_1000250735	319
178	3300006852	Ga0075433_10000555	Ga0075433_1000055518	319
179	3300006871	Ga0075434_100001213	Ga0075434_1000012132	319
180	3300006880	Ga0075429_100024270	Ga0075429_1000242703	319
181	3300006880	Ga0075429_100115735	Ga0075429_1001157352	319
182	3300006881	Ga0068865_100007639	Ga0068865_1000076395	319
183	3300006931	Ga0097620_100163216	Ga0097620_1001632162	319
184	3300006931	Ga0097620_100235899	Ga0097620_1002358993	319
185	3300006931	Ga0097620_100431742	Ga0097620_1004317421	319
186	3300007076	Ga0075435_100045079	Ga0075435_1000450794	319
187	3300009094	Ga0111539_10000057	Ga0111539_1000005780	319
188	3300009094	Ga0111539_10000716	Ga0111539_1000071630	319
189	3300009094	Ga0111539_10002452	Ga0111539_1000245219	319
190	3300009147	Ga0114129_10022531	Ga0114129_100225318	319
191	3300009147	Ga0114129_10046468	Ga0114129_100464684	319
192	3300009147	Ga0114129_10384155	Ga0114129_103841552	319
193	3300009148	Ga0105243_10565669	Ga0105243_105656691	319
194	3300009176	Ga0105242_10003459	Ga0105242_100034595	319
195	3300009177	Ga0105248_10069117	Ga0105248_100691176	319
196	3300009177	Ga0105248_10260479	Ga0105248_102604792	319
197	3300009177	Ga0105248_10532695	Ga0105248_105326951	319
198	3300009177	Ga0105248_10597649	Ga0105248_105976491	319
199	3300009553	Ga0105249_10273574	Ga0105249_102735742	319
200	3300013308	Ga0157375_10037739	Ga0157375_100377391	319
201	3300013308	Ga0157375_10155329	Ga0157375_101553292	319
202	3300013308	Ga0157375_10300046	Ga0157375_103000462	319
203	3300014325	Ga0163163_10059109	Ga0163163_100591093	319
204	3300014325	Ga0163163_10088087	Ga0163163_100880873	319
205	3300014326	Ga0157380_10004321	Ga0157380_100043215	319
206	3300014326	Ga0157380_10048247	Ga0157380_100482473	319
207	3300014326	Ga0157380_10087554	Ga0157380_100875544	319
208	3300014326	Ga0157380_10129190	Ga0157380_101291901	319
209	3300014326	Ga0157380_10160733	Ga0157380_101607332	319
210	3300014745	Ga0157377_10016027	Ga0157377_100160273	319
211	3300014968	Ga0157379_10385655	Ga0157379_103856551	319
212	3300014969	Ga0157376_10600303	Ga0157376_106003031	319
213	3300017792	Ga0163161_10322253	Ga0163161_103222532	319
214	3300025321	Ga0207656_10064428	Ga0207656_100644282	319
215	3300025893	Ga0207682_10016070	Ga0207682_100160702	319
216	3300025899	Ga0207642_10017769	Ga0207642_100177693	319
217	3300025901	Ga0207688_10229700	Ga0207688_102297001	319
218	3300025903	Ga0207680_10150661	Ga0207680_101506612	319
219	3300025907	Ga0207645_10001086	Ga0207645_100010869	319
220	3300025907	Ga0207645_10004581	Ga0207645_100045813	319
221	3300025908	Ga0207643_10013434	Ga0207643_100134342	319
222	3300025908	Ga0207643_10070961	Ga0207643_100709612	319
223	3300025918	Ga0207662_10192333	Ga0207662_101923332	319
224	3300025922	Ga0207646_10409944	Ga0207646_104099441	319
225	3300025923	Ga0207681_10023167	Ga0207681_100231674	319
226	3300025923	Ga0207681_10107628	Ga0207681_101076282	319
227	3300025923	Ga0207681_10135142	Ga0207681_101351422	319
228	3300025923	Ga0207681_10145850	Ga0207681_101458501	319
229	3300025923	Ga0207681_10155555	Ga0207681_101555553	319
230	3300025923	Ga0207681_10238288	Ga0207681_102382881	319
231	3300025925	Ga0207650_10015383	Ga0207650_100153833	319
232	3300025925	Ga0207650_10444767	Ga0207650_104447671	319
233	3300025926	Ga0207659_10004480	Ga0207659_100044806	319
234	3300025926	Ga0207659_10032413	Ga0207659_100324132	319
235	3300025926	Ga0207659_10033754	Ga0207659_100337542	319
236	3300025926	Ga0207659_10068423	Ga0207659_100684232	319
237	3300025926	Ga0207659_10100456	Ga0207659_101004561	319
238	3300025926	Ga0207659_10263107	Ga0207659_102631072	319
239	3300025927	Ga0207687_10146876	Ga0207687_101468762	319
240	3300025931	Ga0207644_10039370	Ga0207644_100393703	319
241	3300025931	Ga0207644_10068007	Ga0207644_100680072	319
242	3300025932	Ga0207690_10129186	Ga0207690_101291862	319
243	3300025937	Ga0207669_10000432	Ga0207669_100004325	319
244	3300025940	Ga0207691_10060158	Ga0207691_100601584	319
245	3300025940	Ga0207691_10074796	Ga0207691_100747962	319
246	3300025941	Ga0207711_10133942	Ga0207711_101339421	319
247	3300025941	Ga0207711_10318494	Ga0207711_103184942	319
248	3300025942	Ga0207689_10002683	Ga0207689_100026837	319
249	3300025942	Ga0207689_10076559	Ga0207689_100765592	319
250	3300025945	Ga0207679_10440011	Ga0207679_104400111	319
251	3300025960	Ga0207651_10005627	Ga0207651_100056276	319
252	3300025960	Ga0207651_10355388	Ga0207651_103553882	319
253	3300025986	Ga0207658_10080222	Ga0207658_100802222	319
254	3300026035	Ga0207703_10073578	Ga0207703_100735781	319
255	3300026075	Ga0207708_10004413	Ga0207708_100044135	319
256	3300026075	Ga0207708_10148067	Ga0207708_101480672	319
257	3300026075	Ga0207708_10188029	Ga0207708_101880292	319
258	3300026089	Ga0207648_10000163	Ga0207648_1000016322	319
259	3300026089	Ga0207648_10037583	Ga0207648_100375833	319
260	3300026089	Ga0207648_10075304	Ga0207648_100753041	319
261	3300026095	Ga0207676_10224891	Ga0207676_102248911	319
262	3300026116	Ga0207674_10395709	Ga0207674_103957092	319
263	3300026118	Ga0207675_100013916	Ga0207675_1000139163	319
264	3300026118	Ga0207675_100036898	Ga0207675_1000368983	319
265	3300026118	Ga0207675_100131835	Ga0207675_1001318353	319
266	3300026118	Ga0207675_100147640	Ga0207675_1001476403	319
267	3300026118	Ga0207675_100151204	Ga0207675_1001512042	319
268	3300026121	Ga0207683_10071858	Ga0207683_100718582	319
269	3300026121	Ga0207683_10083626	Ga0207683_100836263	319
270	3300026121	Ga0207683_10122196	Ga0207683_101221962	319
271	3300026121	Ga0207683_10253522	Ga0207683_102535222	319
272	3300027876	Ga0209974_10011637	Ga0209974_100116371	319
273	3300027907	Ga0207428_10001289	Ga0207428_100012899	319
274	3300027907	Ga0207428_10008732	Ga0207428_100087323	319
275	3300027907	Ga0207428_10160393	Ga0207428_101603932	319
276	3300028380	Ga0268265_10019075	Ga0268265_100190753	319
277	3300028380	Ga0268265_10452669	Ga0268265_104526691	319
278	3300028381	Ga0268264_10065174	Ga0268264_100651742	319
279	3300028381	Ga0268264_10331598	Ga0268264_103315981	319
280	3300031731	Ga0307405_10002964	Ga0307405_100029645	319
281	3300031911	Ga0307412_10024732	Ga0307412_100247322	319
282	3300031995	Ga0307409_100008021	Ga0307409_1000080214	319
283	3300032004	Ga0307414_10219674	Ga0307414_102196742	319
284	3300032005	Ga0307411_10005070	Ga0307411_100050704	319
285	3300032126	Ga0307415_100008036	Ga0307415_1000080364	319
286	3300041408	Ga0439453_0014953	Ga0439453_0014953_203_1165	319
287	3300041999	Ga0439433_0013096	Ga0439433_0013096_49_1008	319
288	3300042436	Ga0439435_0034556	Ga0439435_0034556_395_1354	319
289	3300042436	Ga0439435_0055373	Ga0439435_0055373_144_1106	319
290	3300042530	Ga0450916_002418	Ga0450916_002418_129_1091	319
291	3300045051	Ga0451576_0462669	Ga0451576_0462669_289_1251	319
292	3300046459	Ga0495629_0002252	Ga0495629_0002252_5195_6154	319
293	3300046522	Ga0495643_0006435	Ga0495643_0006435_1203_2162	319
294	3300046539	Ga0495621_0035073	Ga0495621_0035073_358_1317	319
295	3300046539	Ga0495621_0057468	Ga0495621_0057468_44_1006	319
296	3300046615	Ga0495656_0011886	Ga0495656_0011886_2228_3190	319
297	3300046683	Ga0495658_0007615	Ga0495658_0007615_73_1035	319
298	3300048907	Ga0496104_0341668	Ga0496104_0341668_42_1001	319
299	3300048911	Ga0496108_0166850	Ga0496108_0166850_120_1079	319
300	3300048916	Ga0496113_0081798	Ga0496113_0081798_384_1343	319
301	3300049590	Ga0501074_0234652	Ga0501074_0234652_191_1150	319
302	3300049590	Ga0501074_0394344	Ga0501074_0394344_13_972	319
303	3300049743	Ga0501081_0016787	Ga0501081_0016787_2723_3682	319
304	3300050507	nmdc:mga05p37_16849_c1	nmdc:mga05p37_16849_c1_4369_5331	319
305	3300050507	nmdc:mga05p37_312251_c1	nmdc:mga05p37_312251_c1_418_1377	319
306	3300050507	nmdc:mga05p37_55453_c1	nmdc:mga05p37_55453_c1_352_1314	319
307	3300050508	nmdc:mga09592_108065_c1	nmdc:mga09592_108065_c1_723_1682	319
308	3300050508	nmdc:mga09592_2762_c2	nmdc:mga09592_2762_c2_973_1932	319
309	3300050508	nmdc:mga09592_69501_c1	nmdc:mga09592_69501_c1_1775_2734	319
310	3300050509	nmdc:mga0qj67_4492_c1	nmdc:mga0qj67_4492_c1_2532_3491	319
311	3300050510	nmdc:mga06r32_109628_c1	nmdc:mga06r32_109628_c1_1446_2405	319
312	3300050510	nmdc:mga06r32_153957_c1	nmdc:mga06r32_153957_c1_123_1082	319
313	3300050510	nmdc:mga06r32_23352_c1	nmdc:mga06r32_23352_c1_3859_4818	319
314	3300050511	nmdc:mga08y16_117367_c1	nmdc:mga08y16_117367_c1_1326_2285	319
315	3300050511	nmdc:mga08y16_1831_c1	nmdc:mga08y16_1831_c1_12413_13372	319
316	3300050511	nmdc:mga08y16_3411_c1	nmdc:mga08y16_3411_c1_13520_14479	319
317	3300050511	nmdc:mga08y16_55090_c1	nmdc:mga08y16_55090_c1_1193_2152	319
318	3300050511	nmdc:mga08y16_8801_c1	nmdc:mga08y16_8801_c1_5354_6316	319
319	3300050512	nmdc:mga0n895_116477_c1	nmdc:mga0n895_116477_c1_642_1601	319
320	3300050513	nmdc:mga0rr50_25334_c1	nmdc:mga0rr50_25334_c1_1090_2049	319
321	3300050515	nmdc:mga0a205_121405_c1	nmdc:mga0a205_121405_c1_1124_2083	319
322	3300050515	nmdc:mga0a205_7033_c1	nmdc:mga0a205_7033_c1_323_1282	319
323	3300009094	Ga0111539_10375623	Ga0111539_103756232	320
324	3300049584	Ga0501068_0088766	Ga0501068_0088766_322_1293	321
325	3300006844	Ga0075428_100004797	Ga0075428_1000047976	322
326	3300006852	Ga0075433_10273461	Ga0075433_102734612	322
327	3300006871	Ga0075434_100247578	Ga0075434_1002475782	322
328	3300006880	Ga0075429_100148825	Ga0075429_1001488251	322
329	3300009147	Ga0114129_10000428	Ga0114129_1000042843	322
330	3300050507	nmdc:mga05p37_4324_c1	nmdc:mga05p37_4324_c1_3401_4369	322
331	3300050508	nmdc:mga09592_64612_c1	nmdc:mga09592_64612_c1_1163_2131	322
332	3300050512	nmdc:mga0n895_78576_c1	nmdc:mga0n895_78576_c1_1024_1992	322
333	3300050515	nmdc:mga0a205_35723_c1	nmdc:mga0a205_35723_c1_3243_4211	322
334	2162886012	MBSR1b_contig_8841003	MBSR1b_0588.00007530	323
335	3300005289	Ga0065704_10002104	Ga0065704_100021047	323
336	3300005295	Ga0065707_10000779	Ga0065707_1000077912	323
337	3300005329	Ga0070683_100088364	Ga0070683_1000883642	323
338	3300005330	Ga0070690_100126866	Ga0070690_1001268661	323
339	3300005331	Ga0070670_100012346	Ga0070670_1000123465	323
340	3300005341	Ga0070691_10022824	Ga0070691_100228245	323
341	3300005343	Ga0070687_100006068	Ga0070687_1000060687	323
342	3300005344	Ga0070661_100401995	Ga0070661_1004019951	323
343	3300005353	Ga0070669_100025328	Ga0070669_1000253283	323
344	3300005354	Ga0070675_100000179	Ga0070675_10000017917	323
345	3300005354	Ga0070675_100036995	Ga0070675_1000369955	323
346	3300005364	Ga0070673_100053029	Ga0070673_1000530292	323
347	3300005364	Ga0070673_100076425	Ga0070673_1000764254	323
348	3300005438	Ga0070701_10003444	Ga0070701_100034446	323
349	3300005438	Ga0070701_10038060	Ga0070701_100380602	323
350	3300005441	Ga0070700_100024984	Ga0070700_1000249841	323
351	3300005444	Ga0070694_100147739	Ga0070694_1001477392	323
352	3300005457	Ga0070662_100029392	Ga0070662_1000293924	323
353	3300005459	Ga0068867_100000594	Ga0068867_10000059412	323
354	3300005468	Ga0070707_100028450	Ga0070707_1000284501	323
355	3300005471	Ga0070698_100099792	Ga0070698_1000997922	323
356	3300005518	Ga0070699_100023998	Ga0070699_1000239985	323
357	3300005536	Ga0070697_100076187	Ga0070697_1000761875	323
358	3300005546	Ga0070696_100003087	Ga0070696_1000030879	323
359	3300005549	Ga0070704_100136503	Ga0070704_1001365032	323
360	3300005549	Ga0070704_100533577	Ga0070704_1005335771	323
361	3300005564	Ga0070664_100005188	Ga0070664_1000051885	323
362	3300005577	Ga0068857_100017351	Ga0068857_1000173512	323
363	3300005577	Ga0068857_100113709	Ga0068857_1001137092	323
364	3300005578	Ga0068854_100057869	Ga0068854_1000578693	323
365	3300005615	Ga0070702_100030793	Ga0070702_1000307932	323
366	3300005615	Ga0070702_100081717	Ga0070702_1000817171	323
367	3300005617	Ga0068859_100001202	Ga0068859_1000012023	323
368	3300005617	Ga0068859_100068116	Ga0068859_1000681162	323
369	3300005618	Ga0068864_100050135	Ga0068864_1000501352	323
370	3300005618	Ga0068864_100157996	Ga0068864_1001579962	323
371	3300005719	Ga0068861_100017638	Ga0068861_1000176384	323
372	3300005840	Ga0068870_10016718	Ga0068870_100167182	323
373	3300005840	Ga0068870_10023570	Ga0068870_100235703	323
374	3300005841	Ga0068863_100025032	Ga0068863_1000250327	323
375	3300005842	Ga0068858_100020312	Ga0068858_1000203124	323
376	3300005843	Ga0068860_100008479	Ga0068860_10000847913	323
377	3300005843	Ga0068860_100112637	Ga0068860_1001126372	323
378	3300005844	Ga0068862_100000554	Ga0068862_10000055431	323
379	3300006358	Ga0068871_100220053	Ga0068871_1002200532	323
380	3300006852	Ga0075433_10297723	Ga0075433_102977231	323
381	3300006871	Ga0075434_100070794	Ga0075434_1000707941	323
382	3300006931	Ga0097620_100001202	Ga0097620_10000120233	323
383	3300006931	Ga0097620_100068116	Ga0097620_1000681162	323
384	3300007076	Ga0075435_100007149	Ga0075435_1000071496	323
385	3300009094	Ga0111539_10069812	Ga0111539_100698123	323
386	3300009094	Ga0111539_10542636	Ga0111539_105426362	323
387	3300009147	Ga0114129_10003809	Ga0114129_1000380912	323
388	3300009147	Ga0114129_10054833	Ga0114129_100548333	323
389	3300013308	Ga0157375_10077240	Ga0157375_100772402	323
390	3300013308	Ga0157375_10204091	Ga0157375_102040912	323
391	3300013308	Ga0157375_10282054	Ga0157375_102820542	323
392	3300014745	Ga0157377_10026770	Ga0157377_100267704	323
393	3300014745	Ga0157377_10119062	Ga0157377_101190622	323
394	3300014968	Ga0157379_10146180	Ga0157379_101461802	323
395	3300014969	Ga0157376_10137984	Ga0157376_101379842	323
396	3300025907	Ga0207645_10053886	Ga0207645_100538864	323
397	3300025908	Ga0207643_10101488	Ga0207643_101014882	323
398	3300025918	Ga0207662_10004389	Ga0207662_100043897	323
399	3300025925	Ga0207650_10229959	Ga0207650_102299592	323
400	3300025926	Ga0207659_10000228	Ga0207659_1000022812	323
401	3300025926	Ga0207659_10016978	Ga0207659_100169785	323
402	3300025933	Ga0207706_10003779	Ga0207706_1000377912	323
403	3300025933	Ga0207706_10092010	Ga0207706_100920102	323
404	3300025938	Ga0207704_10081427	Ga0207704_100814272	323
405	3300025940	Ga0207691_10008762	Ga0207691_100087624	323
406	3300025944	Ga0207661_10096085	Ga0207661_100960853	323
407	3300025945	Ga0207679_10019254	Ga0207679_100192542	323
408	3300026035	Ga0207703_10024969	Ga0207703_100249696	323
409	3300026075	Ga0207708_10020511	Ga0207708_100205119	323
410	3300026075	Ga0207708_10210426	Ga0207708_102104262	323
411	3300026088	Ga0207641_10104087	Ga0207641_101040872	323
412	3300026089	Ga0207648_10000600	Ga0207648_1000060020	323
413	3300026095	Ga0207676_10057118	Ga0207676_100571185	323
414	3300026095	Ga0207676_10124521	Ga0207676_101245212	323
415	3300026116	Ga0207674_10091661	Ga0207674_100916613	323
416	3300026118	Ga0207675_100006784	Ga0207675_1000067848	323
417	3300027907	Ga0207428_10000520	Ga0207428_1000052015	323
418	3300028381	Ga0268264_10172074	Ga0268264_101720742	323
419	3300028381	Ga0268264_10194192	Ga0268264_101941922	323
420	3300045051	Ga0451576_0017464	Ga0451576_0017464_1798_2769	323
421	3300045051	Ga0451576_0033893	Ga0451576_0033893_1210_2181	323
422	3300045051	Ga0451576_0083459	Ga0451576_0083459_257_1228	323
423	3300045051	Ga0451576_0370661	Ga0451576_0370661_86_1084	323
424	3300046455	Ga0495603_0034110	Ga0495603_0034110_742_1713	323
425	3300046472	Ga0495580_0195542	Ga0495580_0195542_160_1131	323
426	3300046491	Ga0495584_0199266	Ga0495584_0199266_23_994	323
427	3300046499	Ga0495594_0012130	Ga0495594_0012130_988_1959	323
428	3300046537	Ga0495598_0010671	Ga0495598_0010671_379_1350	323
429	3300046539	Ga0495621_0001751	Ga0495621_0001751_569_1555	323
430	3300046539	Ga0495621_0013956	Ga0495621_0013956_1410_2381	323
431	3300046664	Ga0495659_0006671	Ga0495659_0006671_1114_2088	323
432	3300046664	Ga0495659_0044306	Ga0495659_0044306_381_1352	323
433	3300046674	Ga0495588_0023061	Ga0495588_0023061_1662_2633	323
434	3300046679	Ga0495623_0043593	Ga0495623_0043593_279_1253	323
435	3300046684	Ga0495669_0137313	Ga0495669_0137313_18_995	323
436	3300046691	Ga0495670_0025598	Ga0495670_0025598_1224_2195	323
437	3300047447	Ga0495685_049437	Ga0495685_049437_430_1401	323
438	3300050511	nmdc:mga08y16_495406_c1	nmdc:mga08y16_495406_c1_142_1113	323
439	3300050511	nmdc:mga08y16_5024_c1	nmdc:mga08y16_5024_c1_1175_2146	323
440	3300050512	nmdc:mga0n895_25092_c1	nmdc:mga0n895_25092_c1_1261_2232	323
441	3300050513	nmdc:mga0rr50_322456_c1	nmdc:mga0rr50_322456_c1_256_1227	323
442	3300050515	nmdc:mga0a205_277455_c1	nmdc:mga0a205_277455_c1_413_1384	323
443	3300050515	nmdc:mga0a205_44307_c1	nmdc:mga0a205_44307_c1_2907_3878	323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

74

200

0.85 PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

75

197

0.74 PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

113

199

0.7 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7ypu-assembly4.cif.gz_G	orfe-coa-glycylthricin complex	0.8179	48	139
7ypu-assembly4.cif.gz_H	orfe-coa-glycylthricin complex	0.8172	47	139
7ypu-assembly2.cif.gz_D	orfe-coa-glycylthricin complex	0.8161	47	139
1z4e-assembly1.cif.gz_B	crystal structure of transcriptional regulator from bacillus halodurans c-125	0.8145	2	134
7byy-assembly1.cif.gz_B	crystal structure of bacterial toxin	0.8097	48	135

ID	Description	Score	Start	End	Superfamily
af_O13738_1_94_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8376	47	132	3.40.630.30
af_A0A0P0WGU7_189_301_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8375	47	136	3.40.630.30
af_I1MRQ6_38_162_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8362	47	131	3.40.630.30
af_I1KMR4_18_159_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8358	47	131	3.40.630.30
af_A4HVJ0_163_269_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.8348	61	136	3.40.630.30

ID	Description	Score	Start	End	GO Terms
AF-A0A2V8EIP6-F1-model_v4	N-acetyltransferase domain-containing protein	0.9481	2	323	GO:0016747
AF-A0A2V8EIP6-F1-model_v4	N-acetyltransferase domain-containing protein	0.9395	2	323	GO:0016747
AF-A0A3N5Z1R9-F1-model_v4	GNAT family N-acetyltransferase	0.9284	2	305	GO:0016740
AF-A0A3N5Z1R9-F1-model_v4	GNAT family N-acetyltransferase	0.9138	2	305	GO:0016740
AF-A0A7T2CT83-F1-model_v4	deleted	0.8872	49	137

Feature Viewer

pLDDT	pTM	Quality
93.56	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F445059

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

74

200

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

75

197

0.74

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

113

199

0.7

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map