F445076

General Info

Members Datasets Scaffolds Average Seq Length
443 245 442 205

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10072902|Ga0105238_100729022
Length 229
Sequence LTAAAAVPDKLVGWHPSHHRSIFMADLTLYHAAPSRSSIALWMLEEIGEPYDVKLIKLSAGDNMKPDYLAINPMGKVPALKHRDTVITEVAAICTYLADEFPAKKLNVPAGTPQRGVYLKWLFFGPSCVEPAVIDRAAPRKEEARRAMLGYGDFDTCMNVVAKAVDKGPWIMGEQFTAADVVIGSNIRFGTMFKLIPERPEFTAYAARIAARPAAQRAAAKDKELGAAA

Samples

Sample ID Description Type Environment
1 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.39
Nodule 0
Rhizoplane 6.09
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10006326 3300003215 Bacteria 6023
2 rootH1_10101462 3300003323 Bacteria 1314
3 Ga0065715_10306608 3300005293 Bacteria 1029
4 Ga0070658_10027978 3300005327 Bacteria 4525
5 Ga0070658_10028965 3300005327 Bacteria 4447
6 Ga0070658_10053409 3300005327 Bacteria 3280
7 Ga0070683_100432716 3300005329 Bacteria 1255
8 Ga0070670_100026882 3300005331 Bacteria 4949
9 Ga0070670_100755444 3300005331 Bacteria 876
10 Ga0070677_10014283 3300005333 Bacteria 2793
11 Ga0070677_10210344 3300005333 Bacteria 944
12 Ga0070666_10470145 3300005335 Bacteria 909
13 Ga0070680_100011452 3300005336 Bacteria 6862
14 Ga0070680_100025958 3300005336 Bacteria 4685
15 Ga0070680_100072903 3300005336 Bacteria 2823
16 Ga0070680_100135108 3300005336 Bacteria 2065
17 Ga0070680_100304071 3300005336 Bacteria 1353
18 Ga0070680_100631888 3300005336 Bacteria 920
19 Ga0070680_100697789 3300005336 Bacteria 873
20 Ga0070682_100006846 3300005337 Bacteria 6401
21 Ga0068868_100040237 3300005338 Bacteria 3637
22 Ga0068868_100591794 3300005338 Bacteria 982
23 Ga0070660_100053762 3300005339 Bacteria 3107
24 Ga0070660_100137014 3300005339 Bacteria 1961
25 Ga0070660_100205323 3300005339 Bacteria 1599
26 Ga0070689_100226481 3300005340 Bacteria 1536
27 Ga0070687_100145290 3300005343 Bacteria 1386
28 Ga0070692_10063626 3300005345 Bacteria 1949
29 Ga0070668_100953801 3300005347 Bacteria 769
30 Ga0070669_100085935 3300005353 Bacteria 2349
31 Ga0070669_100145869 3300005353 Bacteria 1829
32 Ga0070675_100234134 3300005354 Bacteria 1603
33 Ga0070671_100027802 3300005355 Bacteria 4656
34 Ga0070671_100193657 3300005355 Bacteria 1723
35 Ga0070671_100651949 3300005355 Bacteria 911
36 Ga0070674_100003096 3300005356 Bacteria 9255
37 Ga0070674_100650230 3300005356 Bacteria 896
38 Ga0070673_100055124 3300005364 Bacteria 3131
39 Ga0070673_100141661 3300005364 Bacteria 2028
40 Ga0070673_100796017 3300005364 Bacteria 873
41 Ga0070688_100044893 3300005365 Bacteria 2728
42 Ga0070659_100602794 3300005366 Bacteria 944
43 Ga0070667_100042921 3300005367 Bacteria 3794
44 Ga0070709_10120324 3300005434 Bacteria 1779
45 Ga0070714_100050148 3300005435 Bacteria 3554
46 Ga0070714_100097281 3300005435 Bacteria 2587
47 Ga0070714_100293796 3300005435 Bacteria 1513
48 Ga0070713_100443057 3300005436 Bacteria 1219
49 Ga0070713_100558013 3300005436 Bacteria 1085
50 Ga0070713_101114299 3300005436 Bacteria 763
51 Ga0070710_10076775 3300005437 Bacteria 1939
52 Ga0070710_10130329 3300005437 Bacteria 1533
53 Ga0070711_100099184 3300005439 Bacteria 2116
54 Ga0070711_100578612 3300005439 Bacteria 935
55 Ga0070705_100639354 3300005440 Bacteria 828
56 Ga0070700_100084241 3300005441 Bacteria 2060
57 Ga0070678_100010386 3300005456 Bacteria 5684
58 Ga0070678_100060497 3300005456 Bacteria 2788
59 Ga0070678_100750249 3300005456 Bacteria 883
60 Ga0070662_100008811 3300005457 Bacteria 6577
61 Ga0070662_100129303 3300005457 Bacteria 1945
62 Ga0070681_10045046 3300005458 Bacteria 4415
63 Ga0070681_10151203 3300005458 Bacteria 2247
64 Ga0070681_10159183 3300005458 Bacteria 2182
65 Ga0070681_10541998 3300005458 Bacteria 1077
66 Ga0070681_10683129 3300005458 Bacteria 942
67 Ga0068867_100044411 3300005459 Bacteria 3255
68 Ga0070685_10037442 3300005466 Bacteria 2747
69 Ga0070679_100013411 3300005530 Bacteria 7849
70 Ga0070679_100015163 3300005530 Bacteria 7406
71 Ga0070679_100037628 3300005530 Bacteria 4808
72 Ga0070679_100168539 3300005530 Bacteria 2163
73 Ga0070679_100265216 3300005530 Bacteria 1672
74 Ga0070679_100992613 3300005530 Bacteria 784
75 Ga0070684_100612743 3300005535 Bacteria 1012
76 Ga0068853_100001426 3300005539 Bacteria 17252
77 Ga0068853_100583891 3300005539 Bacteria 1060
78 Ga0070686_100347932 3300005544 Bacteria 1113
79 Ga0070693_100148426 3300005547 Bacteria 1482
80 Ga0070665_100347820 3300005548 Bacteria 1488
81 Ga0068855_100099382 3300005563 Bacteria 3351
82 Ga0068855_100154423 3300005563 Bacteria 2609
83 Ga0068855_100159580 3300005563 Bacteria 2560
84 Ga0068855_100211827 3300005563 Bacteria 2177
85 Ga0068855_100348875 3300005563 Bacteria 1631
86 Ga0068855_100714647 3300005563 Bacteria 1071
87 Ga0068857_101041402 3300005577 Bacteria 789
88 Ga0068854_100316435 3300005578 Bacteria 1267
89 Ga0068852_100507502 3300005616 Bacteria 1202
90 Ga0068859_100082811 3300005617 Bacteria 3251
91 Ga0068859_100331734 3300005617 Bacteria 1615
92 Ga0068864_100047112 3300005618 Bacteria 3701
93 Ga0068864_100165912 3300005618 Bacteria 2011
94 Ga0068858_100231102 3300005842 Bacteria 1753
95 Ga0070717_10467519 3300006028 Bacteria 1138
96 Ga0075365_10303844 3300006038 Bacteria 1123
97 Ga0075364_10002489 3300006051 Bacteria 10316
98 Ga0070715_10082691 3300006163 Bacteria 1461
99 Ga0070716_100566227 3300006173 Bacteria 849
100 Ga0070712_100602422 3300006175 Bacteria 930
101 Ga0070712_100670003 3300006175 Bacteria 883
102 Ga0075369_10045685 3300006186 Bacteria 1884
103 Ga0075366_10012522 3300006195 Bacteria 4812
104 Ga0075366_10072392 3300006195 Bacteria 2054
105 Ga0097621_100062007 3300006237 Bacteria 3068
106 Ga0097621_100194159 3300006237 Bacteria 1759
107 Ga0068871_100220762 3300006358 Bacteria 1642
108 Ga0068871_100229047 3300006358 Bacteria 1612
109 Ga0075428_100087097 3300006844 Bacteria 3407
110 Ga0075431_100113059 3300006847 Bacteria 2802
111 Ga0075431_100689335 3300006847 Bacteria 1000
112 Ga0075429_100305935 3300006880 Bacteria 1392
113 Ga0068865_100118105 3300006881 Bacteria 1967
114 Ga0068865_100310282 3300006881 Bacteria 1265
115 Ga0075436_100150834 3300006914 Bacteria 1636
116 Ga0075436_100201673 3300006914 Bacteria 1409
117 Ga0097620_100082809 3300006931 Bacteria 3251
118 Ga0097620_100331734 3300006931 Bacteria 1615
119 Ga0105240_10629531 3300009093 Bacteria 1178
120 Ga0111539_10474390 3300009094 Bacteria 1457
121 Ga0105245_10103263 3300009098 Bacteria 2641
122 Ga0105245_10207633 3300009098 Bacteria 1884
123 Ga0105245_10652656 3300009098 Bacteria 1082
124 Ga0105247_10180742 3300009101 Bacteria 1408
125 Ga0114129_10062316 3300009147 Bacteria 5210
126 Ga0114129_10205298 3300009147 Bacteria 2666
127 Ga0105241_10095451 3300009174 Bacteria 2354
128 Ga0105242_10069120 3300009176 Bacteria 2924
129 Ga0105242_10288095 3300009176 Bacteria 1494
130 Ga0105248_10134194 3300009177 Bacteria 2793
131 Ga0105237_11305053 3300009545 Bacteria 732
132 Ga0105238_10055204 3300009551 Bacteria 3988
133 Ga0105238_10072902 3300009551 Bacteria 3428
134 Ga0105238_10207457 3300009551 Bacteria 1935
135 Ga0105238_10362027 3300009551 Bacteria 1440
136 Ga0099796_10047985 3300010159 Bacteria 1471
137 Ga0105246_10163165 3300011119 Bacteria 1699
138 Ga0105246_10337325 3300011119 Bacteria 1231
139 Ga0105246_10937231 3300011119 Bacteria 779
140 Ga0157373_10057036 3300013100 Bacteria 2771
141 Ga0157373_10066546 3300013100 Bacteria 2549
142 Ga0157373_10215370 3300013100 Bacteria 1354
143 Ga0157371_10648364 3300013102 Bacteria 788
144 Ga0157370_10031902 3300013104 Bacteria 5149
145 Ga0157370_10059136 3300013104 Bacteria 3643
146 Ga0157370_10691840 3300013104 Bacteria 931
147 Ga0157369_10117851 3300013105 Bacteria 2818
148 Ga0157369_10487659 3300013105 Bacteria 1275
149 Ga0157369_10869880 3300013105 Bacteria 925
150 Ga0157378_10092192 3300013297 Bacteria 2756
151 Ga0163162_10171530 3300013306 Bacteria 2294
152 Ga0163162_11268225 3300013306 Bacteria 837
153 Ga0157372_10009232 3300013307 Bacteria 10485
154 Ga0157372_10203736 3300013307 Bacteria 2292
155 Ga0157372_10273816 3300013307 Bacteria 1962
156 Ga0157372_10844341 3300013307 Bacteria 1063
157 Ga0157372_11365261 3300013307 Unclassified 817
158 Ga0157375_10267602 3300013308 Bacteria 1871
159 Ga0157375_10843607 3300013308 Bacteria 1063
160 Ga0163163_10076912 3300014325 Bacteria 3333
161 Ga0163163_10091065 3300014325 Bacteria 3063
162 Ga0163163_10676842 3300014325 Bacteria 1095
163 Ga0157376_10192158 3300014969 Bacteria 1873
164 Ga0163161_10304630 3300017792 Bacteria 1256
165 Ga0163161_10536869 3300017792 Bacteria 957
166 Ga0206356_11190055 3300020070 Bacteria 831
167 Ga0209758_1000188 3300025297 Bacteria 138749
168 Ga0207682_10002841 3300025893 Bacteria 7639
169 Ga0207692_10040715 3300025898 Bacteria 2295
170 Ga0207642_10342059 3300025899 Bacteria 880
171 Ga0207710_10094888 3300025900 Bacteria 1401
172 Ga0207688_10069100 3300025901 Bacteria 2001
173 Ga0207680_10295193 3300025903 Bacteria 1129
174 Ga0207685_10087182 3300025905 Bacteria 1306
175 Ga0207699_10114611 3300025906 Bacteria 1733
176 Ga0207645_10057545 3300025907 Bacteria 2482
177 Ga0207645_10151314 3300025907 Bacteria 1515
178 Ga0207705_10103538 3300025909 Bacteria 2096
179 Ga0207654_10186923 3300025911 Bacteria 1355
180 Ga0207707_10052036 3300025912 Bacteria 3566
181 Ga0207707_10079086 3300025912 Bacteria 2871
182 Ga0207707_10282255 3300025912 Bacteria 1438
183 Ga0207707_10581380 3300025912 Bacteria 949
184 Ga0207695_10430013 3300025913 Bacteria 1204
185 Ga0207693_10007083 3300025915 Bacteria 9255
186 Ga0207693_10238549 3300025915 Bacteria 1427
187 Ga0207663_10448637 3300025916 Bacteria 994
188 Ga0207660_10045377 3300025917 Bacteria 3096
189 Ga0207660_10099786 3300025917 Bacteria 2167
190 Ga0207660_10187669 3300025917 Bacteria 1608
191 Ga0207660_10275843 3300025917 Bacteria 1333
192 Ga0207657_10012386 3300025919 Bacteria 8425
193 Ga0207657_10049996 3300025919 Bacteria 3640
194 Ga0207657_10283899 3300025919 Bacteria 1314
195 Ga0207657_10421105 3300025919 Bacteria 1049
196 Ga0207652_10017613 3300025921 Bacteria 5847
197 Ga0207652_10019752 3300025921 Bacteria 5544
198 Ga0207652_10055891 3300025921 Bacteria 3397
199 Ga0207681_10491712 3300025923 Bacteria 1003
200 Ga0207694_10070217 3300025924 Bacteria 2736
201 Ga0207694_10137170 3300025924 Bacteria 1966
202 Ga0207694_10475959 3300025924 Bacteria 1044
203 Ga0207650_10024914 3300025925 Bacteria 4259
204 Ga0207650_10814290 3300025925 Bacteria 792
205 Ga0207659_10040871 3300025926 Bacteria 3245
206 Ga0207659_10706590 3300025926 Bacteria 863
207 Ga0207687_10009265 3300025927 Bacteria 6440
208 Ga0207687_10043029 3300025927 Bacteria 3110
209 Ga0207687_10102474 3300025927 Bacteria 2109
210 Ga0207700_10313291 3300025928 Bacteria 1358
211 Ga0207700_10399954 3300025928 Bacteria 1204
212 Ga0207664_10196236 3300025929 Bacteria 1740
213 Ga0207664_10273736 3300025929 Bacteria 1480
214 Ga0207644_10606389 3300025931 Bacteria 909
215 Ga0207690_10014208 3300025932 Bacteria 4805
216 Ga0207706_10010248 3300025933 Bacteria 8571
217 Ga0207706_10309959 3300025933 Bacteria 1374
218 Ga0207686_10030953 3300025934 Bacteria 3174
219 Ga0207686_10078867 3300025934 Bacteria 2143
220 Ga0207670_10007258 3300025936 Bacteria 6174
221 Ga0207670_10520032 3300025936 Bacteria 969
222 Ga0207669_10001043 3300025937 Bacteria 11828
223 Ga0207669_10496780 3300025937 Bacteria 975
224 Ga0207704_10030194 3300025938 Bacteria 3035
225 Ga0207704_10422428 3300025938 Bacteria 1057
226 Ga0207691_10092454 3300025940 Bacteria 2709
227 Ga0207711_10086135 3300025941 Bacteria 2754
228 Ga0207711_10541530 3300025941 Bacteria 1086
229 Ga0207689_10063125 3300025942 Bacteria 3047
230 Ga0207661_10548612 3300025944 Bacteria 1059
231 Ga0207667_10030455 3300025949 Bacteria 5837
232 Ga0207667_10190017 3300025949 Bacteria 2107
233 Ga0207667_10292804 3300025949 Bacteria 1663
234 Ga0207667_10705131 3300025949 Bacteria 1011
235 Ga0207667_11147599 3300025949 Bacteria 758
236 Ga0207651_10089754 3300025960 Bacteria 2245
237 Ga0207651_10227414 3300025960 Bacteria 1512
238 Ga0207651_10398956 3300025960 Bacteria 1169
239 Ga0207640_10325650 3300025981 Bacteria 1225
240 Ga0207640_10336696 3300025981 Bacteria 1207
241 Ga0207640_10531983 3300025981 Bacteria 984
242 Ga0207658_10023653 3300025986 Bacteria 4291
243 Ga0207658_10211665 3300025986 Bacteria 1625
244 Ga0207703_10326529 3300026035 Bacteria 1406
245 Ga0207703_10470763 3300026035 Bacteria 1176
246 Ga0207703_10964992 3300026035 Bacteria 817
247 Ga0207678_10457693 3300026067 Bacteria 1110
248 Ga0207678_10526044 3300026067 Bacteria 1032
249 Ga0207702_11305873 3300026078 Bacteria 720
250 Ga0207641_10138528 3300026088 Bacteria 2193
251 Ga0207641_10368402 3300026088 Bacteria 1373
252 Ga0207648_10014584 3300026089 Bacteria 7258
253 Ga0207648_10229497 3300026089 Bacteria 1651
254 Ga0207676_10049134 3300026095 Bacteria 3279
255 Ga0207676_10588558 3300026095 Bacteria 1067
256 Ga0207674_10266986 3300026116 Bacteria 1659
257 Ga0207674_10322711 3300026116 Bacteria 1494
258 Ga0207674_10514805 3300026116 Bacteria 1156
259 Ga0207683_10037407 3300026121 Bacteria 4226
260 Ga0207683_10418701 3300026121 Bacteria 1234
261 Ga0207698_10129546 3300026142 Bacteria 2153
262 Ga0207698_10467885 3300026142 Bacteria 1220
263 Ga0207698_10487723 3300026142 Bacteria 1197
264 Ga0209971_1005141 3300027682 Bacteria 3106
265 Ga0268266_10179134 3300028379 Bacteria 1929
266 Ga0265334_10021465 3300028573 Bacteria 2636
267 Ga0265330_10000012 3300031235 Bacteria 180837
268 Ga0265332_10000012 3300031238 Bacteria 272641
269 Ga0265332_10205193 3300031238 Bacteria 818
270 Ga0265320_10110227 3300031240 Bacteria 1261
271 Ga0265325_10005643 3300031241 Bacteria 7697
272 Ga0265325_10009992 3300031241 Bacteria 5515
273 Ga0265325_10018970 3300031241 Bacteria 3809
274 Ga0265325_10096264 3300031241 Bacteria 1454
275 Ga0265340_10007315 3300031247 Bacteria 6001
276 Ga0265340_10108274 3300031247 Bacteria 1286
277 Ga0265331_10085416 3300031250 Bacteria 1462
278 Ga0316579_10062629 3300031691 Bacteria 1752
279 Ga0265314_10000029 3300031711 Bacteria 272506
280 Ga0265314_10020379 3300031711 Bacteria 5119
281 Ga0265314_10235677 3300031711 Bacteria 1059
282 Ga0265342_10000760 3300031712 Bacteria 32963
283 Ga0265342_10034133 3300031712 Bacteria 3123
284 Ga0265342_10072723 3300031712 Bacteria 2001
285 Ga0307412_10008676 3300031911 Bacteria 5812
286 Ga0373959_0061082 3300034820 Bacteria 834
287 Ga0373923_0278468 3300035111 Bacteria 788
288 Ga0373939_0132803 3300035114 Bacteria 890
289 Ga0373953_0110140 3300035117 Bacteria 1164
290 Ga0373956_0214473 3300035119 Bacteria 913
291 Ga0373943_0112769 3300035170 Bacteria 1436
292 Ga0373955_0034436 3300035172 Bacteria 2675
293 Ga0373961_0009298 3300035241 Bacteria 2403
294 Ga0373924_0065318 3300035410 Bacteria 1528
295 Ga0373931_0113074 3300035691 Bacteria 1543
296 Ga0373933_0325796 3300035724 Bacteria 996
297 Ga0373947_0164189 3300035725 Bacteria 1438
298 Ga0373947_0308899 3300035725 Bacteria 1056
299 Ga0373947_0459662 3300035725 Bacteria 863
300 Ga0373937_0132621 3300036401 Bacteria 2327
301 Ga0373937_0385290 3300036401 Bacteria 1330
302 Ga0373937_0813244 3300036401 Bacteria 883
303 Ga0373925_0206926 3300037068 Bacteria 1562
304 Ga0373925_0238971 3300037068 Bacteria 1454
305 Ga0395898_0002494 3300037466 Bacteria 21650
306 Ga0436364_0561925 3300037853 Bacteria 691
307 Ga0395901_0024020 3300038443 Bacteria 6253
308 Ga0395901_0036020 3300038443 Bacteria 5113
309 Ga0395901_0883286 3300038443 Bacteria 877
310 Ga0466963_0167707 3300044694 Bacteria 1530
311 Ga0495617_057462 3300046452 Bacteria 1290
312 Ga0495592_0045660 3300046454 Bacteria 3268
313 Ga0495651_0009837 3300046462 Bacteria 7352
314 Ga0495662_0130180 3300046476 Bacteria 1237
315 Ga0495640_0435737 3300046533 Bacteria 802
316 Ga0495645_0003148 3300046543 Bacteria 11187
317 Ga0495667_0012256 3300046559 Bacteria 5811
318 Ga0495635_0206737 3300046663 Bacteria 1330
319 Ga0495588_0272378 3300046674 Bacteria 892
320 Ga0495623_0264350 3300046679 Bacteria 962
321 Ga0495600_0665551 3300046809 Bacteria 628
322 Ga0495604_0035799 3300047317 Bacteria 3918
323 Ga0495604_0487726 3300047317 Bacteria 801
324 Ga0495674_0265214 3300047319 Bacteria 1410
325 Ga0495674_0371698 3300047319 Bacteria 1158
326 Ga0495680_0022570 3300047322 Bacteria 5242
327 Ga0495602_0036104 3300048088 Bacteria 4603
328 Ga0495602_0496574 3300048088 Bacteria 854
329 Ga0496100_0015279 3300048903 Bacteria 4480
330 Ga0496100_0110167 3300048903 Bacteria 1911
331 Ga0496100_0156699 3300048903 Bacteria 1629
332 Ga0496101_0018533 3300048904 Bacteria 4735
333 Ga0496101_0278277 3300048904 Bacteria 1307
334 Ga0496102_0210254 3300048905 Bacteria 1834
335 Ga0496104_0000090 3300048907 Bacteria 87877
336 Ga0496104_0083777 3300048907 Bacteria 3041
337 Ga0496105_0001810 3300048908 Bacteria 15299
338 Ga0496105_0007284 3300048908 Bacteria 8548
339 Ga0496105_0013103 3300048908 Bacteria 6575
340 Ga0496106_0010697 3300048909 Bacteria 6781
341 Ga0496106_0180963 3300048909 Bacteria 1673
342 Ga0496107_0013472 3300048910 Bacteria 5716
343 Ga0496108_0000805 3300048911 Bacteria 24339
344 Ga0496109_0003733 3300048912 Bacteria 12725
345 Ga0496110_0049050 3300048913 Bacteria 3702
346 Ga0496111_0018479 3300048914 Bacteria 4830
347 Ga0496112_0008356 3300048915 Bacteria 9269
348 Ga0496112_0929371 3300048915 Bacteria 791
349 Ga0496113_0049228 3300048916 Bacteria 3137
350 Ga0496113_0389935 3300048916 Bacteria 1118
351 Ga0496114_0020586 3300048917 Bacteria 5355
352 Ga0496114_0112851 3300048917 Bacteria 2330
353 Ga0496114_0128696 3300048917 Bacteria 2185
354 Ga0496115_0003400 3300048918 Bacteria 11426
355 Ga0496115_0088136 3300048918 Bacteria 2533
356 Ga0496126_0054845 3300048929 Bacteria 3608
357 Ga0501033_0063851 3300049570 Bacteria 2710
358 Ga0501033_0269399 3300049570 Bacteria 1204
359 Ga0501033_0280513 3300049570 Bacteria 1176
360 Ga0501034_0250723 3300049571 Bacteria 1715
361 Ga0501034_0301000 3300049571 Bacteria 1540
362 Ga0501034_0579232 3300049571 Bacteria 1029
363 Ga0501034_0773169 3300049571 Bacteria 854
364 Ga0501036_0700451 3300049572 Bacteria 837
365 Ga0501036_0831864 3300049572 Bacteria 759
366 Ga0501038_0061135 3300049574 Bacteria 3222
367 Ga0501038_0132294 3300049574 Bacteria 2046
368 Ga0501042_0046488 3300049578 Bacteria 3095
369 Ga0501043_0049543 3300049579 Bacteria 3302
370 Ga0501046_0018860 3300049580 Bacteria 5730
371 Ga0501047_0003616 3300049581 Bacteria 14572
372 Ga0501047_0106974 3300049581 Bacteria 2678
373 Ga0501047_0249308 3300049581 Bacteria 1624
374 Ga0501047_0254051 3300049581 Bacteria 1606
375 Ga0501047_0256750 3300049581 Bacteria 1596
376 Ga0501047_0409772 3300049581 Bacteria 1188
377 Ga0501047_0643834 3300049581 Unclassified 880
378 Ga0501048_0125891 3300049582 Bacteria 1811
379 Ga0501067_0121299 3300049583 Bacteria 1455
380 Ga0501068_0031650 3300049584 Bacteria 3142
381 Ga0501069_0009076 3300049585 Bacteria 5247
382 Ga0501070_0022563 3300049586 Bacteria 5272
383 Ga0501070_0054793 3300049586 Bacteria 3307
384 Ga0501070_0070699 3300049586 Bacteria 2890
385 Ga0501070_0248618 3300049586 Bacteria 1455
386 Ga0501070_0657079 3300049586 Bacteria 832
387 Ga0501071_0035873 3300049587 Bacteria 3534
388 Ga0501071_0109191 3300049587 Bacteria 2044
389 Ga0501072_0046760 3300049588 Bacteria 3407
390 Ga0501072_0322466 3300049588 Bacteria 1228
391 Ga0501073_0114450 3300049589 Bacteria 1870
392 Ga0501074_0027519 3300049590 Bacteria 4122
393 Ga0501076_0011971 3300049592 Bacteria 6481
394 Ga0501076_0259941 3300049592 Unclassified 1421
395 Ga0501077_0074705 3300049593 Bacteria 2147
396 Ga0501079_0079368 3300049741 Bacteria 2538
397 Ga0501079_0156720 3300049741 Bacteria 1775
398 Ga0501079_0613955 3300049741 Bacteria 856
399 Ga0501080_0099054 3300049742 Bacteria 2705
400 Ga0501080_0782977 3300049742 Bacteria 837
401 Ga0501080_0795717 3300049742 Bacteria 829
402 Ga0501081_0172298 3300049743 Bacteria 1563
403 Ga0501083_0031278 3300049744 Bacteria 3653
404 Ga0501083_0069615 3300049744 Bacteria 2341
405 Ga0501083_0246133 3300049744 Bacteria 1164
406 Ga0501035_0036273 3300049822 Bacteria 4470
407 Ga0501035_0085064 3300049822 Bacteria 2789
408 Ga0501044_0004547 3300049823 Bacteria 15509
409 Ga0501044_0116899 3300049823 Bacteria 2671
410 Ga0501044_0396838 3300049823 Bacteria 1292
411 Ga0501044_0403982 3300049823 Bacteria 1278
412 Ga0501044_0953247 3300049823 Bacteria 731
413 Ga0501044_1031910 3300049823 Bacteria 693
414 Ga0501045_0128521 3300049824 Bacteria 1883
415 nmdc:mga00v17_8078_c1 3300050491 Bacteria 5651
416 nmdc:mga0yw44_286280_c1 3300050492 Bacteria 1102
417 nmdc:mga0yw44_479609_c1 3300050492 Bacteria 843
418 nmdc:mga0k408_105091_c1 3300050493 Bacteria 1667
419 nmdc:mga05p37_238653_c1 3300050507 Bacteria 2187
420 nmdc:mga06r32_110014_c1 3300050510 Bacteria 2710
421 nmdc:mga06r32_616654_c1 3300050510 Bacteria 1055
422 nmdc:mga08y16_375701_c1 3300050511 Bacteria 1457
423 nmdc:mga0n895_434207_c1 3300050512 Unclassified 1327
424 Ga0495601_0024174 3300053077 Bacteria 3740
425 Ga0495601_0236637 3300053077 Bacteria 1192
426 Ga0495612_0012389 3300053078 Bacteria 3437
427 Ga0495612_0222948 3300053078 Bacteria 835
428 Ga0495595_0123623 3300053084 Bacteria 1261
429 Ga0495595_0155006 3300053084 Bacteria 1128
430 Ga0495619_0002497 3300053085 Bacteria 12041
431 Ga0500595_019074 3300053119 Bacteria 2495
432 Ga0500642_0060804 3300053130 Bacteria 1696
433 Ga0500652_000015 3300053131 Bacteria 131012
434 Ga0500636_0040792 3300053177 Bacteria 2745
435 Ga0501084_0060040 3300054114 Bacteria 3184
436 Ga0501084_0078137 3300054114 Bacteria 2774
437 Ga0501084_0177109 3300054114 Bacteria 1800
438 Ga0501084_0603385 3300054114 Bacteria 927
439 Ga0501082_0030553 3300060353 Bacteria 4642
440 Ga0501082_0200976 3300060353 Bacteria 1734
441 Ga0501082_0382211 3300060353 Bacteria 1229
442 Ga0501082_0386337 3300060353 Bacteria 1221

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0459662 Ga0373947_0459662_19_576 185
2 3300049572 Ga0501036_0831864 Ga0501036_0831864_57_614 185
3 3300049581 Ga0501047_0409772 Ga0501047_0409772_11_568 185
4 3300049742 Ga0501080_0782977 Ga0501080_0782977_47_604 185
5 3300049822 Ga0501035_0036273 Ga0501035_0036273_1010_1567 185
6 3300053084 Ga0495595_0155006 Ga0495595_0155006_537_1094 185
7 3300035172 Ga0373955_0034436 Ga0373955_0034436_2078_2644 186
8 3300036401 Ga0373937_0813244 Ga0373937_0813244_257_823 186
9 3300037853 Ga0436364_0561925 Ga0436364_0561925_92_658 186
10 3300046809 Ga0495600_0665551 Ga0495600_0665551_46_612 186
11 3300048088 Ga0495602_0496574 Ga0495602_0496574_21_587 186
12 3300048915 Ga0496112_0929371 Ga0496112_0929371_39_602 186
13 3300048929 Ga0496126_0054845 Ga0496126_0054845_35_595 186
14 3300049586 Ga0501070_0657079 Ga0501070_0657079_226_786 186
15 3300049823 Ga0501044_0953247 Ga0501044_0953247_17_586 186
16 3300054114 Ga0501084_0177109 Ga0501084_0177109_1209_1769 186
17 3300049571 Ga0501034_0773169 Ga0501034_0773169_155_799 188
18 3300049574 Ga0501038_0061135 Ga0501038_0061135_857_1501 188
19 3300049578 Ga0501042_0046488 Ga0501042_0046488_841_1485 188
20 3300049579 Ga0501043_0049543 Ga0501043_0049543_2421_3065 188
21 3300049580 Ga0501046_0018860 Ga0501046_0018860_1773_2417 188
22 3300049581 Ga0501047_0643834 Ga0501047_0643834_53_697 188
23 3300049582 Ga0501048_0125891 Ga0501048_0125891_231_875 188
24 3300049584 Ga0501068_0031650 Ga0501068_0031650_49_693 188
25 3300049585 Ga0501069_0009076 Ga0501069_0009076_3761_4405 188
26 3300049586 Ga0501070_0248618 Ga0501070_0248618_281_898 188
27 3300049587 Ga0501071_0109191 Ga0501071_0109191_671_1315 188
28 3300049588 Ga0501072_0322466 Ga0501072_0322466_46_690 188
29 3300049590 Ga0501074_0027519 Ga0501074_0027519_3018_3662 188
30 3300049592 Ga0501076_0259941 Ga0501076_0259941_292_936 188
31 3300049741 Ga0501079_0079368 Ga0501079_0079368_53_697 188
32 3300049742 Ga0501080_0795717 Ga0501080_0795717_136_780 188
33 3300049744 Ga0501083_0031278 Ga0501083_0031278_2314_2958 188
34 3300049823 Ga0501044_0396838 Ga0501044_0396838_198_842 188
35 3300049824 Ga0501045_0128521 Ga0501045_0128521_850_1494 188
36 3300053131 Ga0500652_000015 Ga0500652_000015_110932_111498 188
37 3300054114 Ga0501084_0603385 Ga0501084_0603385_12_656 188
38 3300037466 Ga0395898_0002494 Ga0395898_0002494_5349_6020 191
39 3300038443 Ga0395901_0036020 Ga0395901_0036020_2863_3534 191
40 3300005437 Ga0070710_10076775 Ga0070710_100767752 192
41 3300006175 Ga0070712_100670003 Ga0070712_1006700031 192
42 3300025915 Ga0207693_10238549 Ga0207693_102385491 192
43 3300025949 Ga0207667_11147599 Ga0207667_111475991 192
44 3300005327 Ga0070658_10053409 Ga0070658_100534095 193
45 3300005336 Ga0070680_100135108 Ga0070680_1001351082 193
46 3300005339 Ga0070660_100053762 Ga0070660_1000537623 193
47 3300005458 Ga0070681_10045046 Ga0070681_100450464 193
48 3300005530 Ga0070679_100013411 Ga0070679_1000134114 193
49 3300025912 Ga0207707_10052036 Ga0207707_100520362 193
50 3300025919 Ga0207657_10049996 Ga0207657_100499965 193
51 3300011119 Ga0105246_10937231 Ga0105246_109372312 196
52 iso_pu_bacteria 2751185897 2753767397 197
53 3300006186 Ga0075369_10045685 Ga0075369_100456851 200
54 3300025981 Ga0207640_10325650 Ga0207640_103256502 200
55 3300031911 Ga0307412_10008676 Ga0307412_100086764 200
56 3300006051 Ga0075364_10002489 Ga0075364_100024895 202
57 3300027682 Ga0209971_1005141 Ga0209971_10051413 202
58 3300028573 Ga0265334_10021465 Ga0265334_100214653 202
59 3300031235 Ga0265330_10000012 Ga0265330_1000001226 202
60 3300031238 Ga0265332_10000012 Ga0265332_1000001226 202
61 3300031241 Ga0265325_10009992 Ga0265325_100099925 202
62 3300031247 Ga0265340_10007315 Ga0265340_100073151 202
63 3300031711 Ga0265314_10000029 Ga0265314_10000029232 202
64 3300031712 Ga0265342_10034133 Ga0265342_100341335 202
65 3300005436 Ga0070713_101114299 Ga0070713_1011142991 203
66 3300049570 Ga0501033_0063851 Ga0501033_0063851_1145_1894 203
67 3300005353 Ga0070669_100145869 Ga0070669_1001458693 204
68 3300025936 Ga0207670_10520032 Ga0207670_105200321 204
69 3300026089 Ga0207648_10229497 Ga0207648_102294971 204
70 3300031241 Ga0265325_10005643 Ga0265325_100056436 204
71 3300031241 Ga0265325_10096264 Ga0265325_100962642 204
72 3300031250 Ga0265331_10085416 Ga0265331_100854162 204
73 3300031711 Ga0265314_10020379 Ga0265314_100203793 204
74 3300037068 Ga0373925_0238971 Ga0373925_0238971_754_1368 204
75 3300049570 Ga0501033_0280513 Ga0501033_0280513_519_1133 204
76 3300049571 Ga0501034_0250723 Ga0501034_0250723_585_1199 204
77 3300049581 Ga0501047_0003616 Ga0501047_0003616_2014_2628 204
78 3300049586 Ga0501070_0022563 Ga0501070_0022563_3283_3897 204
79 3300049742 Ga0501080_0099054 Ga0501080_0099054_983_1597 204
80 3300049744 Ga0501083_0246133 Ga0501083_0246133_140_754 204
81 3300049823 Ga0501044_0116899 Ga0501044_0116899_614_1228 204
82 3300054114 Ga0501084_0060040 Ga0501084_0060040_1514_2128 204
83 3300060353 Ga0501082_0030553 Ga0501082_0030553_2994_3608 204
84 3300060353 Ga0501082_0386337 Ga0501082_0386337_23_637 204
85 3300003215 JGI25153J46596_10006326 JGI25153J46596_100063265 205
86 3300003323 rootH1_10101462 rootH1_101014622 205
87 3300005293 Ga0065715_10306608 Ga0065715_103066082 205
88 3300005327 Ga0070658_10027978 Ga0070658_100279784 205
89 3300005327 Ga0070658_10028965 Ga0070658_100289654 205
90 3300005329 Ga0070683_100432716 Ga0070683_1004327162 205
91 3300005331 Ga0070670_100026882 Ga0070670_1000268826 205
92 3300005331 Ga0070670_100755444 Ga0070670_1007554442 205
93 3300005333 Ga0070677_10014283 Ga0070677_100142833 205
94 3300005333 Ga0070677_10210344 Ga0070677_102103441 205
95 3300005335 Ga0070666_10470145 Ga0070666_104701452 205
96 3300005336 Ga0070680_100011452 Ga0070680_10001145210 205
97 3300005336 Ga0070680_100025958 Ga0070680_1000259581 205
98 3300005336 Ga0070680_100072903 Ga0070680_1000729032 205
99 3300005336 Ga0070680_100304071 Ga0070680_1003040712 205
100 3300005336 Ga0070680_100631888 Ga0070680_1006318881 205
101 3300005336 Ga0070680_100697789 Ga0070680_1006977891 205
102 3300005337 Ga0070682_100006846 Ga0070682_1000068469 205
103 3300005338 Ga0068868_100040237 Ga0068868_1000402373 205
104 3300005338 Ga0068868_100591794 Ga0068868_1005917941 205
105 3300005339 Ga0070660_100137014 Ga0070660_1001370143 205
106 3300005339 Ga0070660_100205323 Ga0070660_1002053232 205
107 3300005340 Ga0070689_100226481 Ga0070689_1002264812 205
108 3300005343 Ga0070687_100145290 Ga0070687_1001452902 205
109 3300005345 Ga0070692_10063626 Ga0070692_100636263 205
110 3300005347 Ga0070668_100953801 Ga0070668_1009538011 205
111 3300005353 Ga0070669_100085935 Ga0070669_1000859354 205
112 3300005354 Ga0070675_100234134 Ga0070675_1002341342 205
113 3300005355 Ga0070671_100027802 Ga0070671_1000278027 205
114 3300005355 Ga0070671_100193657 Ga0070671_1001936572 205
115 3300005355 Ga0070671_100651949 Ga0070671_1006519491 205
116 3300005356 Ga0070674_100003096 Ga0070674_10000309610 205
117 3300005356 Ga0070674_100650230 Ga0070674_1006502301 205
118 3300005364 Ga0070673_100055124 Ga0070673_1000551243 205
119 3300005364 Ga0070673_100141661 Ga0070673_1001416612 205
120 3300005364 Ga0070673_100796017 Ga0070673_1007960171 205
121 3300005365 Ga0070688_100044893 Ga0070688_1000448933 205
122 3300005366 Ga0070659_100602794 Ga0070659_1006027942 205
123 3300005367 Ga0070667_100042921 Ga0070667_1000429212 205
124 3300005434 Ga0070709_10120324 Ga0070709_101203242 205
125 3300005435 Ga0070714_100050148 Ga0070714_1000501484 205
126 3300005435 Ga0070714_100097281 Ga0070714_1000972814 205
127 3300005435 Ga0070714_100293796 Ga0070714_1002937962 205
128 3300005436 Ga0070713_100443057 Ga0070713_1004430572 205
129 3300005436 Ga0070713_100558013 Ga0070713_1005580131 205
130 3300005437 Ga0070710_10130329 Ga0070710_101303291 205
131 3300005439 Ga0070711_100099184 Ga0070711_1000991843 205
132 3300005439 Ga0070711_100578612 Ga0070711_1005786121 205
133 3300005440 Ga0070705_100639354 Ga0070705_1006393541 205
134 3300005441 Ga0070700_100084241 Ga0070700_1000842414 205
135 3300005456 Ga0070678_100010386 Ga0070678_1000103866 205
136 3300005456 Ga0070678_100060497 Ga0070678_1000604972 205
137 3300005456 Ga0070678_100750249 Ga0070678_1007502492 205
138 3300005457 Ga0070662_100008811 Ga0070662_1000088114 205
139 3300005457 Ga0070662_100129303 Ga0070662_1001293032 205
140 3300005458 Ga0070681_10151203 Ga0070681_101512033 205
141 3300005458 Ga0070681_10159183 Ga0070681_101591832 205
142 3300005458 Ga0070681_10541998 Ga0070681_105419981 205
143 3300005458 Ga0070681_10683129 Ga0070681_106831292 205
144 3300005459 Ga0068867_100044411 Ga0068867_1000444112 205
145 3300005466 Ga0070685_10037442 Ga0070685_100374425 205
146 3300005530 Ga0070679_100015163 Ga0070679_1000151637 205
147 3300005530 Ga0070679_100037628 Ga0070679_1000376285 205
148 3300005530 Ga0070679_100168539 Ga0070679_1001685393 205
149 3300005530 Ga0070679_100265216 Ga0070679_1002652162 205
150 3300005530 Ga0070679_100992613 Ga0070679_1009926131 205
151 3300005535 Ga0070684_100612743 Ga0070684_1006127432 205
152 3300005539 Ga0068853_100001426 Ga0068853_10000142620 205
153 3300005539 Ga0068853_100583891 Ga0068853_1005838911 205
154 3300005544 Ga0070686_100347932 Ga0070686_1003479322 205
155 3300005547 Ga0070693_100148426 Ga0070693_1001484262 205
156 3300005548 Ga0070665_100347820 Ga0070665_1003478203 205
157 3300005563 Ga0068855_100099382 Ga0068855_1000993823 205
158 3300005563 Ga0068855_100154423 Ga0068855_1001544236 205
159 3300005563 Ga0068855_100159580 Ga0068855_1001595803 205
160 3300005563 Ga0068855_100211827 Ga0068855_1002118273 205
161 3300005563 Ga0068855_100348875 Ga0068855_1003488752 205
162 3300005563 Ga0068855_100714647 Ga0068855_1007146471 205
163 3300005577 Ga0068857_101041402 Ga0068857_1010414021 205
164 3300005578 Ga0068854_100316435 Ga0068854_1003164352 205
165 3300005616 Ga0068852_100507502 Ga0068852_1005075021 205
166 3300005617 Ga0068859_100082811 Ga0068859_1000828112 205
167 3300005617 Ga0068859_100331734 Ga0068859_1003317341 205
168 3300005618 Ga0068864_100047112 Ga0068864_1000471124 205
169 3300005618 Ga0068864_100165912 Ga0068864_1001659123 205
170 3300005842 Ga0068858_100231102 Ga0068858_1002311022 205
171 3300006028 Ga0070717_10467519 Ga0070717_104675192 205
172 3300006038 Ga0075365_10303844 Ga0075365_103038442 205
173 3300006163 Ga0070715_10082691 Ga0070715_100826913 205
174 3300006173 Ga0070716_100566227 Ga0070716_1005662272 205
175 3300006175 Ga0070712_100602422 Ga0070712_1006024221 205
176 3300006195 Ga0075366_10012522 Ga0075366_100125228 205
177 3300006195 Ga0075366_10072392 Ga0075366_100723923 205
178 3300006237 Ga0097621_100062007 Ga0097621_1000620073 205
179 3300006237 Ga0097621_100194159 Ga0097621_1001941592 205
180 3300006358 Ga0068871_100220762 Ga0068871_1002207622 205
181 3300006358 Ga0068871_100229047 Ga0068871_1002290473 205
182 3300006844 Ga0075428_100087097 Ga0075428_1000870973 205
183 3300006847 Ga0075431_100113059 Ga0075431_1001130592 205
184 3300006847 Ga0075431_100689335 Ga0075431_1006893352 205
185 3300006880 Ga0075429_100305935 Ga0075429_1003059352 205
186 3300006881 Ga0068865_100118105 Ga0068865_1001181051 205
187 3300006881 Ga0068865_100310282 Ga0068865_1003102822 205
188 3300006914 Ga0075436_100150834 Ga0075436_1001508342 205
189 3300006914 Ga0075436_100201673 Ga0075436_1002016733 205
190 3300006931 Ga0097620_100082809 Ga0097620_1000828092 205
191 3300006931 Ga0097620_100331734 Ga0097620_1003317341 205
192 3300009093 Ga0105240_10629531 Ga0105240_106295311 205
193 3300009094 Ga0111539_10474390 Ga0111539_104743902 205
194 3300009098 Ga0105245_10103263 Ga0105245_101032632 205
195 3300009098 Ga0105245_10207633 Ga0105245_102076332 205
196 3300009098 Ga0105245_10652656 Ga0105245_106526561 205
197 3300009101 Ga0105247_10180742 Ga0105247_101807422 205
198 3300009147 Ga0114129_10062316 Ga0114129_100623162 205
199 3300009147 Ga0114129_10205298 Ga0114129_102052982 205
200 3300009174 Ga0105241_10095451 Ga0105241_100954513 205
201 3300009176 Ga0105242_10069120 Ga0105242_100691203 205
202 3300009176 Ga0105242_10288095 Ga0105242_102880952 205
203 3300009177 Ga0105248_10134194 Ga0105248_101341942 205
204 3300009545 Ga0105237_11305053 Ga0105237_113050531 205
205 3300009551 Ga0105238_10055204 Ga0105238_100552044 205
206 3300009551 Ga0105238_10072902 Ga0105238_100729022 205
207 3300009551 Ga0105238_10207457 Ga0105238_102074574 205
208 3300009551 Ga0105238_10362027 Ga0105238_103620272 205
209 3300010159 Ga0099796_10047985 Ga0099796_100479852 205
210 3300011119 Ga0105246_10163165 Ga0105246_101631651 205
211 3300011119 Ga0105246_10337325 Ga0105246_103373253 205
212 3300013100 Ga0157373_10057036 Ga0157373_100570364 205
213 3300013100 Ga0157373_10066546 Ga0157373_100665462 205
214 3300013100 Ga0157373_10215370 Ga0157373_102153704 205
215 3300013102 Ga0157371_10648364 Ga0157371_106483642 205
216 3300013104 Ga0157370_10031902 Ga0157370_100319023 205
217 3300013104 Ga0157370_10059136 Ga0157370_100591363 205
218 3300013104 Ga0157370_10691840 Ga0157370_106918401 205
219 3300013105 Ga0157369_10117851 Ga0157369_101178512 205
220 3300013105 Ga0157369_10487659 Ga0157369_104876591 205
221 3300013105 Ga0157369_10869880 Ga0157369_108698801 205
222 3300013297 Ga0157378_10092192 Ga0157378_100921924 205
223 3300013306 Ga0163162_10171530 Ga0163162_101715302 205
224 3300013306 Ga0163162_11268225 Ga0163162_112682251 205
225 3300013307 Ga0157372_10009232 Ga0157372_1000923211 205
226 3300013307 Ga0157372_10203736 Ga0157372_102037363 205
227 3300013307 Ga0157372_10273816 Ga0157372_102738163 205
228 3300013307 Ga0157372_10844341 Ga0157372_108443412 205
229 3300013307 Ga0157372_11365261 Ga0157372_113652611 205
230 3300013308 Ga0157375_10267602 Ga0157375_102676022 205
231 3300013308 Ga0157375_10843607 Ga0157375_108436072 205
232 3300014325 Ga0163163_10076912 Ga0163163_100769123 205
233 3300014325 Ga0163163_10091065 Ga0163163_100910652 205
234 3300014325 Ga0163163_10676842 Ga0163163_106768421 205
235 3300014969 Ga0157376_10192158 Ga0157376_101921583 205
236 3300017792 Ga0163161_10304630 Ga0163161_103046302 205
237 3300017792 Ga0163161_10536869 Ga0163161_105368691 205
238 3300020070 Ga0206356_11190055 Ga0206356_111900551 205
239 3300025297 Ga0209758_1000188 Ga0209758_1000188110 205
240 3300025893 Ga0207682_10002841 Ga0207682_100028414 205
241 3300025898 Ga0207692_10040715 Ga0207692_100407153 205
242 3300025899 Ga0207642_10342059 Ga0207642_103420591 205
243 3300025900 Ga0207710_10094888 Ga0207710_100948881 205
244 3300025901 Ga0207688_10069100 Ga0207688_100691002 205
245 3300025903 Ga0207680_10295193 Ga0207680_102951932 205
246 3300025905 Ga0207685_10087182 Ga0207685_100871821 205
247 3300025906 Ga0207699_10114611 Ga0207699_101146112 205
248 3300025907 Ga0207645_10057545 Ga0207645_100575453 205
249 3300025907 Ga0207645_10151314 Ga0207645_101513141 205
250 3300025909 Ga0207705_10103538 Ga0207705_101035381 205
251 3300025911 Ga0207654_10186923 Ga0207654_101869232 205
252 3300025912 Ga0207707_10079086 Ga0207707_100790863 205
253 3300025912 Ga0207707_10282255 Ga0207707_102822552 205
254 3300025912 Ga0207707_10581380 Ga0207707_105813802 205
255 3300025913 Ga0207695_10430013 Ga0207695_104300132 205
256 3300025915 Ga0207693_10007083 Ga0207693_100070835 205
257 3300025916 Ga0207663_10448637 Ga0207663_104486371 205
258 3300025917 Ga0207660_10045377 Ga0207660_100453773 205
259 3300025917 Ga0207660_10099786 Ga0207660_100997862 205
260 3300025917 Ga0207660_10187669 Ga0207660_101876693 205
261 3300025917 Ga0207660_10275843 Ga0207660_102758433 205
262 3300025919 Ga0207657_10012386 Ga0207657_100123868 205
263 3300025919 Ga0207657_10283899 Ga0207657_102838992 205
264 3300025919 Ga0207657_10421105 Ga0207657_104211051 205
265 3300025921 Ga0207652_10017613 Ga0207652_100176133 205
266 3300025921 Ga0207652_10019752 Ga0207652_100197523 205
267 3300025921 Ga0207652_10055891 Ga0207652_100558912 205
268 3300025923 Ga0207681_10491712 Ga0207681_104917121 205
269 3300025924 Ga0207694_10070217 Ga0207694_100702172 205
270 3300025924 Ga0207694_10137170 Ga0207694_101371702 205
271 3300025924 Ga0207694_10475959 Ga0207694_104759591 205
272 3300025925 Ga0207650_10024914 Ga0207650_100249143 205
273 3300025925 Ga0207650_10814290 Ga0207650_108142901 205
274 3300025926 Ga0207659_10040871 Ga0207659_100408712 205
275 3300025926 Ga0207659_10706590 Ga0207659_107065902 205
276 3300025927 Ga0207687_10009265 Ga0207687_100092655 205
277 3300025927 Ga0207687_10043029 Ga0207687_100430294 205
278 3300025927 Ga0207687_10102474 Ga0207687_101024744 205
279 3300025928 Ga0207700_10313291 Ga0207700_103132911 205
280 3300025928 Ga0207700_10399954 Ga0207700_103999541 205
281 3300025929 Ga0207664_10196236 Ga0207664_101962361 205
282 3300025929 Ga0207664_10273736 Ga0207664_102737362 205
283 3300025931 Ga0207644_10606389 Ga0207644_106063892 205
284 3300025932 Ga0207690_10014208 Ga0207690_100142082 205
285 3300025933 Ga0207706_10010248 Ga0207706_100102485 205
286 3300025933 Ga0207706_10309959 Ga0207706_103099592 205
287 3300025934 Ga0207686_10030953 Ga0207686_100309533 205
288 3300025934 Ga0207686_10078867 Ga0207686_100788672 205
289 3300025936 Ga0207670_10007258 Ga0207670_100072585 205
290 3300025937 Ga0207669_10001043 Ga0207669_100010432 205
291 3300025937 Ga0207669_10496780 Ga0207669_104967802 205
292 3300025938 Ga0207704_10030194 Ga0207704_100301943 205
293 3300025938 Ga0207704_10422428 Ga0207704_104224281 205
294 3300025940 Ga0207691_10092454 Ga0207691_100924542 205
295 3300025941 Ga0207711_10086135 Ga0207711_100861354 205
296 3300025941 Ga0207711_10541530 Ga0207711_105415302 205
297 3300025942 Ga0207689_10063125 Ga0207689_100631251 205
298 3300025944 Ga0207661_10548612 Ga0207661_105486122 205
299 3300025949 Ga0207667_10030455 Ga0207667_100304555 205
300 3300025949 Ga0207667_10190017 Ga0207667_101900173 205
301 3300025949 Ga0207667_10292804 Ga0207667_102928041 205
302 3300025949 Ga0207667_10705131 Ga0207667_107051312 205
303 3300025960 Ga0207651_10089754 Ga0207651_100897541 205
304 3300025960 Ga0207651_10227414 Ga0207651_102274142 205
305 3300025960 Ga0207651_10398956 Ga0207651_103989561 205
306 3300025981 Ga0207640_10336696 Ga0207640_103366962 205
307 3300025981 Ga0207640_10531983 Ga0207640_105319831 205
308 3300025986 Ga0207658_10023653 Ga0207658_100236533 205
309 3300025986 Ga0207658_10211665 Ga0207658_102116652 205
310 3300026035 Ga0207703_10326529 Ga0207703_103265292 205
311 3300026035 Ga0207703_10470763 Ga0207703_104707631 205
312 3300026035 Ga0207703_10964992 Ga0207703_109649921 205
313 3300026067 Ga0207678_10457693 Ga0207678_104576932 205
314 3300026067 Ga0207678_10526044 Ga0207678_105260442 205
315 3300026078 Ga0207702_11305873 Ga0207702_113058731 205
316 3300026088 Ga0207641_10138528 Ga0207641_101385283 205
317 3300026088 Ga0207641_10368402 Ga0207641_103684022 205
318 3300026089 Ga0207648_10014584 Ga0207648_100145843 205
319 3300026095 Ga0207676_10049134 Ga0207676_100491345 205
320 3300026095 Ga0207676_10588558 Ga0207676_105885581 205
321 3300026116 Ga0207674_10266986 Ga0207674_102669861 205
322 3300026116 Ga0207674_10322711 Ga0207674_103227112 205
323 3300026116 Ga0207674_10514805 Ga0207674_105148051 205
324 3300026121 Ga0207683_10037407 Ga0207683_100374073 205
325 3300026121 Ga0207683_10418701 Ga0207683_104187012 205
326 3300026142 Ga0207698_10129546 Ga0207698_101295463 205
327 3300026142 Ga0207698_10467885 Ga0207698_104678852 205
328 3300026142 Ga0207698_10487723 Ga0207698_104877232 205
329 3300028379 Ga0268266_10179134 Ga0268266_101791343 205
330 3300031238 Ga0265332_10205193 Ga0265332_102051931 205
331 3300031240 Ga0265320_10110227 Ga0265320_101102273 205
332 3300031241 Ga0265325_10018970 Ga0265325_100189703 205
333 3300031247 Ga0265340_10108274 Ga0265340_101082742 205
334 3300031691 Ga0316579_10062629 Ga0316579_100626292 205
335 3300031711 Ga0265314_10235677 Ga0265314_102356771 205
336 3300031712 Ga0265342_10000760 Ga0265342_1000076031 205
337 3300031712 Ga0265342_10072723 Ga0265342_100727232 205
338 3300034820 Ga0373959_0061082 Ga0373959_0061082_159_782 205
339 3300035111 Ga0373923_0278468 Ga0373923_0278468_143_760 205
340 3300035114 Ga0373939_0132803 Ga0373939_0132803_22_639 205
341 3300035117 Ga0373953_0110140 Ga0373953_0110140_80_703 205
342 3300035119 Ga0373956_0214473 Ga0373956_0214473_97_720 205
343 3300035170 Ga0373943_0112769 Ga0373943_0112769_720_1337 205
344 3300035241 Ga0373961_0009298 Ga0373961_0009298_1306_1923 205
345 3300035410 Ga0373924_0065318 Ga0373924_0065318_47_670 205
346 3300035691 Ga0373931_0113074 Ga0373931_0113074_693_1310 205
347 3300035724 Ga0373933_0325796 Ga0373933_0325796_343_966 205
348 3300035725 Ga0373947_0164189 Ga0373947_0164189_56_673 205
349 3300035725 Ga0373947_0308899 Ga0373947_0308899_137_760 205
350 3300036401 Ga0373937_0132621 Ga0373937_0132621_1415_2038 205
351 3300036401 Ga0373937_0385290 Ga0373937_0385290_245_862 205
352 3300037068 Ga0373925_0206926 Ga0373925_0206926_437_1060 205
353 3300038443 Ga0395901_0024020 Ga0395901_0024020_4376_4993 205
354 3300038443 Ga0395901_0883286 Ga0395901_0883286_29_646 205
355 3300044694 Ga0466963_0167707 Ga0466963_0167707_835_1452 205
356 3300046452 Ga0495617_057462 Ga0495617_057462_229_852 205
357 3300046454 Ga0495592_0045660 Ga0495592_0045660_1027_1650 205
358 3300046462 Ga0495651_0009837 Ga0495651_0009837_1390_2013 205
359 3300046476 Ga0495662_0130180 Ga0495662_0130180_437_1054 205
360 3300046533 Ga0495640_0435737 Ga0495640_0435737_95_712 205
361 3300046543 Ga0495645_0003148 Ga0495645_0003148_3479_4102 205
362 3300046559 Ga0495667_0012256 Ga0495667_0012256_1818_2441 205
363 3300046663 Ga0495635_0206737 Ga0495635_0206737_434_1057 205
364 3300046674 Ga0495588_0272378 Ga0495588_0272378_253_882 205
365 3300046679 Ga0495623_0264350 Ga0495623_0264350_313_936 205
366 3300047317 Ga0495604_0035799 Ga0495604_0035799_3026_3649 205
367 3300047317 Ga0495604_0487726 Ga0495604_0487726_102_719 205
368 3300047319 Ga0495674_0265214 Ga0495674_0265214_129_752 205
369 3300047319 Ga0495674_0371698 Ga0495674_0371698_170_787 205
370 3300047322 Ga0495680_0022570 Ga0495680_0022570_1450_2073 205
371 3300048088 Ga0495602_0036104 Ga0495602_0036104_3412_4035 205
372 3300048903 Ga0496100_0015279 Ga0496100_0015279_124_747 205
373 3300048903 Ga0496100_0110167 Ga0496100_0110167_351_1151 205
374 3300048903 Ga0496100_0156699 Ga0496100_0156699_972_1589 205
375 3300048904 Ga0496101_0018533 Ga0496101_0018533_393_1016 205
376 3300048904 Ga0496101_0278277 Ga0496101_0278277_298_915 205
377 3300048905 Ga0496102_0210254 Ga0496102_0210254_948_1571 205
378 3300048907 Ga0496104_0000090 Ga0496104_0000090_17725_18348 205
379 3300048907 Ga0496104_0083777 Ga0496104_0083777_1953_2576 205
380 3300048908 Ga0496105_0001810 Ga0496105_0001810_3874_4497 205
381 3300048908 Ga0496105_0007284 Ga0496105_0007284_1499_2122 205
382 3300048908 Ga0496105_0013103 Ga0496105_0013103_5937_6554 205
383 3300048909 Ga0496106_0010697 Ga0496106_0010697_432_1055 205
384 3300048909 Ga0496106_0180963 Ga0496106_0180963_44_661 205
385 3300048910 Ga0496107_0013472 Ga0496107_0013472_2962_3585 205
386 3300048911 Ga0496108_0000805 Ga0496108_0000805_17673_18290 205
387 3300048912 Ga0496109_0003733 Ga0496109_0003733_7733_8350 205
388 3300048913 Ga0496110_0049050 Ga0496110_0049050_1070_1687 205
389 3300048914 Ga0496111_0018479 Ga0496111_0018479_1586_2203 205
390 3300048915 Ga0496112_0008356 Ga0496112_0008356_6637_7254 205
391 3300048916 Ga0496113_0049228 Ga0496113_0049228_397_1014 205
392 3300048916 Ga0496113_0389935 Ga0496113_0389935_253_870 205
393 3300048917 Ga0496114_0020586 Ga0496114_0020586_2403_3026 205
394 3300048917 Ga0496114_0112851 Ga0496114_0112851_1300_1917 205
395 3300048917 Ga0496114_0128696 Ga0496114_0128696_527_1150 205
396 3300048918 Ga0496115_0003400 Ga0496115_0003400_5734_6357 205
397 3300048918 Ga0496115_0088136 Ga0496115_0088136_532_1149 205
398 3300049570 Ga0501033_0269399 Ga0501033_0269399_470_1087 205
399 3300049571 Ga0501034_0301000 Ga0501034_0301000_83_700 205
400 3300049571 Ga0501034_0579232 Ga0501034_0579232_130_747 205
401 3300049572 Ga0501036_0700451 Ga0501036_0700451_156_773 205
402 3300049574 Ga0501038_0132294 Ga0501038_0132294_740_1357 205
403 3300049581 Ga0501047_0106974 Ga0501047_0106974_352_978 205
404 3300049581 Ga0501047_0249308 Ga0501047_0249308_175_792 205
405 3300049581 Ga0501047_0254051 Ga0501047_0254051_46_663 205
406 3300049581 Ga0501047_0256750 Ga0501047_0256750_419_1039 205
407 3300049583 Ga0501067_0121299 Ga0501067_0121299_814_1431 205
408 3300049586 Ga0501070_0054793 Ga0501070_0054793_325_948 205
409 3300049586 Ga0501070_0070699 Ga0501070_0070699_319_942 205
410 3300049587 Ga0501071_0035873 Ga0501071_0035873_1898_2521 205
411 3300049588 Ga0501072_0046760 Ga0501072_0046760_578_1201 205
412 3300049589 Ga0501073_0114450 Ga0501073_0114450_622_1248 205
413 3300049592 Ga0501076_0011971 Ga0501076_0011971_413_1036 205
414 3300049593 Ga0501077_0074705 Ga0501077_0074705_672_1295 205
415 3300049741 Ga0501079_0156720 Ga0501079_0156720_367_990 205
416 3300049741 Ga0501079_0613955 Ga0501079_0613955_94_711 205
417 3300049743 Ga0501081_0172298 Ga0501081_0172298_580_1203 205
418 3300049744 Ga0501083_0069615 Ga0501083_0069615_534_1160 205
419 3300049822 Ga0501035_0085064 Ga0501035_0085064_638_1261 205
420 3300049823 Ga0501044_0004547 Ga0501044_0004547_12848_13465 205
421 3300049823 Ga0501044_0403982 Ga0501044_0403982_311_934 205
422 3300049823 Ga0501044_1031910 Ga0501044_1031910_32_652 205
423 3300050491 nmdc:mga00v17_8078_c1 nmdc:mga00v17_8078_c1_920_1537 205
424 3300050492 nmdc:mga0yw44_286280_c1 nmdc:mga0yw44_286280_c1_204_821 205
425 3300050492 nmdc:mga0yw44_479609_c1 nmdc:mga0yw44_479609_c1_161_787 205
426 3300050493 nmdc:mga0k408_105091_c1 nmdc:mga0k408_105091_c1_939_1556 205
427 3300050507 nmdc:mga05p37_238653_c1 nmdc:mga05p37_238653_c1_85_702 205
428 3300050510 nmdc:mga06r32_110014_c1 nmdc:mga06r32_110014_c1_260_892 205
429 3300050510 nmdc:mga06r32_616654_c1 nmdc:mga06r32_616654_c1_172_789 205
430 3300050511 nmdc:mga08y16_375701_c1 nmdc:mga08y16_375701_c1_346_972 205
431 3300050512 nmdc:mga0n895_434207_c1 nmdc:mga0n895_434207_c1_106_759 205
432 3300053077 Ga0495601_0024174 Ga0495601_0024174_2707_3330 205
433 3300053077 Ga0495601_0236637 Ga0495601_0236637_287_904 205
434 3300053078 Ga0495612_0012389 Ga0495612_0012389_411_1034 205
435 3300053078 Ga0495612_0222948 Ga0495612_0222948_129_752 205
436 3300053084 Ga0495595_0123623 Ga0495595_0123623_117_740 205
437 3300053085 Ga0495619_0002497 Ga0495619_0002497_284_907 205
438 3300053119 Ga0500595_019074 Ga0500595_019074_1307_1924 205
439 3300053130 Ga0500642_0060804 Ga0500642_0060804_820_1437 205
440 3300053177 Ga0500636_0040792 Ga0500636_0040792_684_1301 205
441 3300054114 Ga0501084_0078137 Ga0501084_0078137_986_1609 205
442 3300060353 Ga0501082_0200976 Ga0501082_0200976_699_1325 205
443 3300060353 Ga0501082_0382211 Ga0501082_0382211_587_1210 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

25

99

0.97

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

35

100

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

29

105

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ai8-assembly1.cif.gz_B crystal structure of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.8574 4 194
8ai9-assembly1.cif.gz_B s10t variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.857 4 194
8aib-assembly1.cif.gz_B r11a variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione 0.8464 4 194
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.8452 4 199
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.8355 4 191
ID Description Score Start End Superfamily
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9636 7 79 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9599 7 70 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9524 7 79 3.40.30.10
af_K7TUZ4_3_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9498 4 66 3.40.30.10
af_Q9C6C8_6_89_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9479 5 80 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0Q7TLL8-F1-model_v4 Glutathione S-transferase 0.9985 1 205 GO:0016740
AF-A0A3C0BT16-F1-model_v4 Glutathione S-transferase 0.996 58 202 GO:0016740
AF-X0UBQ8-F1-model_v4 GST N-terminal domain-containing protein 0.9889 1 194
AF-V4TF02-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9806 4 202 GO:0004364
AF-X0UBQ8-F1-model_v4 GST N-terminal domain-containing protein 0.9789 1 194

Feature Viewer

pLDDT pTM Quality
95.08 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map