F445076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 443 | 245 | 442 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10072902|Ga0105238_100729022 |
| Length | 229 |
| Sequence | LTAAAAVPDKLVGWHPSHHRSIFMADLTLYHAAPSRSSIALWMLEEIGEPYDVKLIKLSAGDNMKPDYLAINPMGKVPALKHRDTVITEVAAICTYLADEFPAKKLNVPAGTPQRGVYLKWLFFGPSCVEPAVIDRAAPRKEEARRAMLGYGDFDTCMNVVAKAVDKGPWIMGEQFTAADVVIGSNIRFGTMFKLIPERPEFTAYAARIAARPAAQRAAAKDKELGAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 203 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 230 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 241 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 242 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 243 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 244 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.39 |
| Nodule | 0 |
| Rhizoplane | 6.09 |
| Rhizosphere | 89.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10006326 | 3300003215 | Bacteria | 6023 |
| 2 | rootH1_10101462 | 3300003323 | Bacteria | 1314 |
| 3 | Ga0065715_10306608 | 3300005293 | Bacteria | 1029 |
| 4 | Ga0070658_10027978 | 3300005327 | Bacteria | 4525 |
| 5 | Ga0070658_10028965 | 3300005327 | Bacteria | 4447 |
| 6 | Ga0070658_10053409 | 3300005327 | Bacteria | 3280 |
| 7 | Ga0070683_100432716 | 3300005329 | Bacteria | 1255 |
| 8 | Ga0070670_100026882 | 3300005331 | Bacteria | 4949 |
| 9 | Ga0070670_100755444 | 3300005331 | Bacteria | 876 |
| 10 | Ga0070677_10014283 | 3300005333 | Bacteria | 2793 |
| 11 | Ga0070677_10210344 | 3300005333 | Bacteria | 944 |
| 12 | Ga0070666_10470145 | 3300005335 | Bacteria | 909 |
| 13 | Ga0070680_100011452 | 3300005336 | Bacteria | 6862 |
| 14 | Ga0070680_100025958 | 3300005336 | Bacteria | 4685 |
| 15 | Ga0070680_100072903 | 3300005336 | Bacteria | 2823 |
| 16 | Ga0070680_100135108 | 3300005336 | Bacteria | 2065 |
| 17 | Ga0070680_100304071 | 3300005336 | Bacteria | 1353 |
| 18 | Ga0070680_100631888 | 3300005336 | Bacteria | 920 |
| 19 | Ga0070680_100697789 | 3300005336 | Bacteria | 873 |
| 20 | Ga0070682_100006846 | 3300005337 | Bacteria | 6401 |
| 21 | Ga0068868_100040237 | 3300005338 | Bacteria | 3637 |
| 22 | Ga0068868_100591794 | 3300005338 | Bacteria | 982 |
| 23 | Ga0070660_100053762 | 3300005339 | Bacteria | 3107 |
| 24 | Ga0070660_100137014 | 3300005339 | Bacteria | 1961 |
| 25 | Ga0070660_100205323 | 3300005339 | Bacteria | 1599 |
| 26 | Ga0070689_100226481 | 3300005340 | Bacteria | 1536 |
| 27 | Ga0070687_100145290 | 3300005343 | Bacteria | 1386 |
| 28 | Ga0070692_10063626 | 3300005345 | Bacteria | 1949 |
| 29 | Ga0070668_100953801 | 3300005347 | Bacteria | 769 |
| 30 | Ga0070669_100085935 | 3300005353 | Bacteria | 2349 |
| 31 | Ga0070669_100145869 | 3300005353 | Bacteria | 1829 |
| 32 | Ga0070675_100234134 | 3300005354 | Bacteria | 1603 |
| 33 | Ga0070671_100027802 | 3300005355 | Bacteria | 4656 |
| 34 | Ga0070671_100193657 | 3300005355 | Bacteria | 1723 |
| 35 | Ga0070671_100651949 | 3300005355 | Bacteria | 911 |
| 36 | Ga0070674_100003096 | 3300005356 | Bacteria | 9255 |
| 37 | Ga0070674_100650230 | 3300005356 | Bacteria | 896 |
| 38 | Ga0070673_100055124 | 3300005364 | Bacteria | 3131 |
| 39 | Ga0070673_100141661 | 3300005364 | Bacteria | 2028 |
| 40 | Ga0070673_100796017 | 3300005364 | Bacteria | 873 |
| 41 | Ga0070688_100044893 | 3300005365 | Bacteria | 2728 |
| 42 | Ga0070659_100602794 | 3300005366 | Bacteria | 944 |
| 43 | Ga0070667_100042921 | 3300005367 | Bacteria | 3794 |
| 44 | Ga0070709_10120324 | 3300005434 | Bacteria | 1779 |
| 45 | Ga0070714_100050148 | 3300005435 | Bacteria | 3554 |
| 46 | Ga0070714_100097281 | 3300005435 | Bacteria | 2587 |
| 47 | Ga0070714_100293796 | 3300005435 | Bacteria | 1513 |
| 48 | Ga0070713_100443057 | 3300005436 | Bacteria | 1219 |
| 49 | Ga0070713_100558013 | 3300005436 | Bacteria | 1085 |
| 50 | Ga0070713_101114299 | 3300005436 | Bacteria | 763 |
| 51 | Ga0070710_10076775 | 3300005437 | Bacteria | 1939 |
| 52 | Ga0070710_10130329 | 3300005437 | Bacteria | 1533 |
| 53 | Ga0070711_100099184 | 3300005439 | Bacteria | 2116 |
| 54 | Ga0070711_100578612 | 3300005439 | Bacteria | 935 |
| 55 | Ga0070705_100639354 | 3300005440 | Bacteria | 828 |
| 56 | Ga0070700_100084241 | 3300005441 | Bacteria | 2060 |
| 57 | Ga0070678_100010386 | 3300005456 | Bacteria | 5684 |
| 58 | Ga0070678_100060497 | 3300005456 | Bacteria | 2788 |
| 59 | Ga0070678_100750249 | 3300005456 | Bacteria | 883 |
| 60 | Ga0070662_100008811 | 3300005457 | Bacteria | 6577 |
| 61 | Ga0070662_100129303 | 3300005457 | Bacteria | 1945 |
| 62 | Ga0070681_10045046 | 3300005458 | Bacteria | 4415 |
| 63 | Ga0070681_10151203 | 3300005458 | Bacteria | 2247 |
| 64 | Ga0070681_10159183 | 3300005458 | Bacteria | 2182 |
| 65 | Ga0070681_10541998 | 3300005458 | Bacteria | 1077 |
| 66 | Ga0070681_10683129 | 3300005458 | Bacteria | 942 |
| 67 | Ga0068867_100044411 | 3300005459 | Bacteria | 3255 |
| 68 | Ga0070685_10037442 | 3300005466 | Bacteria | 2747 |
| 69 | Ga0070679_100013411 | 3300005530 | Bacteria | 7849 |
| 70 | Ga0070679_100015163 | 3300005530 | Bacteria | 7406 |
| 71 | Ga0070679_100037628 | 3300005530 | Bacteria | 4808 |
| 72 | Ga0070679_100168539 | 3300005530 | Bacteria | 2163 |
| 73 | Ga0070679_100265216 | 3300005530 | Bacteria | 1672 |
| 74 | Ga0070679_100992613 | 3300005530 | Bacteria | 784 |
| 75 | Ga0070684_100612743 | 3300005535 | Bacteria | 1012 |
| 76 | Ga0068853_100001426 | 3300005539 | Bacteria | 17252 |
| 77 | Ga0068853_100583891 | 3300005539 | Bacteria | 1060 |
| 78 | Ga0070686_100347932 | 3300005544 | Bacteria | 1113 |
| 79 | Ga0070693_100148426 | 3300005547 | Bacteria | 1482 |
| 80 | Ga0070665_100347820 | 3300005548 | Bacteria | 1488 |
| 81 | Ga0068855_100099382 | 3300005563 | Bacteria | 3351 |
| 82 | Ga0068855_100154423 | 3300005563 | Bacteria | 2609 |
| 83 | Ga0068855_100159580 | 3300005563 | Bacteria | 2560 |
| 84 | Ga0068855_100211827 | 3300005563 | Bacteria | 2177 |
| 85 | Ga0068855_100348875 | 3300005563 | Bacteria | 1631 |
| 86 | Ga0068855_100714647 | 3300005563 | Bacteria | 1071 |
| 87 | Ga0068857_101041402 | 3300005577 | Bacteria | 789 |
| 88 | Ga0068854_100316435 | 3300005578 | Bacteria | 1267 |
| 89 | Ga0068852_100507502 | 3300005616 | Bacteria | 1202 |
| 90 | Ga0068859_100082811 | 3300005617 | Bacteria | 3251 |
| 91 | Ga0068859_100331734 | 3300005617 | Bacteria | 1615 |
| 92 | Ga0068864_100047112 | 3300005618 | Bacteria | 3701 |
| 93 | Ga0068864_100165912 | 3300005618 | Bacteria | 2011 |
| 94 | Ga0068858_100231102 | 3300005842 | Bacteria | 1753 |
| 95 | Ga0070717_10467519 | 3300006028 | Bacteria | 1138 |
| 96 | Ga0075365_10303844 | 3300006038 | Bacteria | 1123 |
| 97 | Ga0075364_10002489 | 3300006051 | Bacteria | 10316 |
| 98 | Ga0070715_10082691 | 3300006163 | Bacteria | 1461 |
| 99 | Ga0070716_100566227 | 3300006173 | Bacteria | 849 |
| 100 | Ga0070712_100602422 | 3300006175 | Bacteria | 930 |
| 101 | Ga0070712_100670003 | 3300006175 | Bacteria | 883 |
| 102 | Ga0075369_10045685 | 3300006186 | Bacteria | 1884 |
| 103 | Ga0075366_10012522 | 3300006195 | Bacteria | 4812 |
| 104 | Ga0075366_10072392 | 3300006195 | Bacteria | 2054 |
| 105 | Ga0097621_100062007 | 3300006237 | Bacteria | 3068 |
| 106 | Ga0097621_100194159 | 3300006237 | Bacteria | 1759 |
| 107 | Ga0068871_100220762 | 3300006358 | Bacteria | 1642 |
| 108 | Ga0068871_100229047 | 3300006358 | Bacteria | 1612 |
| 109 | Ga0075428_100087097 | 3300006844 | Bacteria | 3407 |
| 110 | Ga0075431_100113059 | 3300006847 | Bacteria | 2802 |
| 111 | Ga0075431_100689335 | 3300006847 | Bacteria | 1000 |
| 112 | Ga0075429_100305935 | 3300006880 | Bacteria | 1392 |
| 113 | Ga0068865_100118105 | 3300006881 | Bacteria | 1967 |
| 114 | Ga0068865_100310282 | 3300006881 | Bacteria | 1265 |
| 115 | Ga0075436_100150834 | 3300006914 | Bacteria | 1636 |
| 116 | Ga0075436_100201673 | 3300006914 | Bacteria | 1409 |
| 117 | Ga0097620_100082809 | 3300006931 | Bacteria | 3251 |
| 118 | Ga0097620_100331734 | 3300006931 | Bacteria | 1615 |
| 119 | Ga0105240_10629531 | 3300009093 | Bacteria | 1178 |
| 120 | Ga0111539_10474390 | 3300009094 | Bacteria | 1457 |
| 121 | Ga0105245_10103263 | 3300009098 | Bacteria | 2641 |
| 122 | Ga0105245_10207633 | 3300009098 | Bacteria | 1884 |
| 123 | Ga0105245_10652656 | 3300009098 | Bacteria | 1082 |
| 124 | Ga0105247_10180742 | 3300009101 | Bacteria | 1408 |
| 125 | Ga0114129_10062316 | 3300009147 | Bacteria | 5210 |
| 126 | Ga0114129_10205298 | 3300009147 | Bacteria | 2666 |
| 127 | Ga0105241_10095451 | 3300009174 | Bacteria | 2354 |
| 128 | Ga0105242_10069120 | 3300009176 | Bacteria | 2924 |
| 129 | Ga0105242_10288095 | 3300009176 | Bacteria | 1494 |
| 130 | Ga0105248_10134194 | 3300009177 | Bacteria | 2793 |
| 131 | Ga0105237_11305053 | 3300009545 | Bacteria | 732 |
| 132 | Ga0105238_10055204 | 3300009551 | Bacteria | 3988 |
| 133 | Ga0105238_10072902 | 3300009551 | Bacteria | 3428 |
| 134 | Ga0105238_10207457 | 3300009551 | Bacteria | 1935 |
| 135 | Ga0105238_10362027 | 3300009551 | Bacteria | 1440 |
| 136 | Ga0099796_10047985 | 3300010159 | Bacteria | 1471 |
| 137 | Ga0105246_10163165 | 3300011119 | Bacteria | 1699 |
| 138 | Ga0105246_10337325 | 3300011119 | Bacteria | 1231 |
| 139 | Ga0105246_10937231 | 3300011119 | Bacteria | 779 |
| 140 | Ga0157373_10057036 | 3300013100 | Bacteria | 2771 |
| 141 | Ga0157373_10066546 | 3300013100 | Bacteria | 2549 |
| 142 | Ga0157373_10215370 | 3300013100 | Bacteria | 1354 |
| 143 | Ga0157371_10648364 | 3300013102 | Bacteria | 788 |
| 144 | Ga0157370_10031902 | 3300013104 | Bacteria | 5149 |
| 145 | Ga0157370_10059136 | 3300013104 | Bacteria | 3643 |
| 146 | Ga0157370_10691840 | 3300013104 | Bacteria | 931 |
| 147 | Ga0157369_10117851 | 3300013105 | Bacteria | 2818 |
| 148 | Ga0157369_10487659 | 3300013105 | Bacteria | 1275 |
| 149 | Ga0157369_10869880 | 3300013105 | Bacteria | 925 |
| 150 | Ga0157378_10092192 | 3300013297 | Bacteria | 2756 |
| 151 | Ga0163162_10171530 | 3300013306 | Bacteria | 2294 |
| 152 | Ga0163162_11268225 | 3300013306 | Bacteria | 837 |
| 153 | Ga0157372_10009232 | 3300013307 | Bacteria | 10485 |
| 154 | Ga0157372_10203736 | 3300013307 | Bacteria | 2292 |
| 155 | Ga0157372_10273816 | 3300013307 | Bacteria | 1962 |
| 156 | Ga0157372_10844341 | 3300013307 | Bacteria | 1063 |
| 157 | Ga0157372_11365261 | 3300013307 | Unclassified | 817 |
| 158 | Ga0157375_10267602 | 3300013308 | Bacteria | 1871 |
| 159 | Ga0157375_10843607 | 3300013308 | Bacteria | 1063 |
| 160 | Ga0163163_10076912 | 3300014325 | Bacteria | 3333 |
| 161 | Ga0163163_10091065 | 3300014325 | Bacteria | 3063 |
| 162 | Ga0163163_10676842 | 3300014325 | Bacteria | 1095 |
| 163 | Ga0157376_10192158 | 3300014969 | Bacteria | 1873 |
| 164 | Ga0163161_10304630 | 3300017792 | Bacteria | 1256 |
| 165 | Ga0163161_10536869 | 3300017792 | Bacteria | 957 |
| 166 | Ga0206356_11190055 | 3300020070 | Bacteria | 831 |
| 167 | Ga0209758_1000188 | 3300025297 | Bacteria | 138749 |
| 168 | Ga0207682_10002841 | 3300025893 | Bacteria | 7639 |
| 169 | Ga0207692_10040715 | 3300025898 | Bacteria | 2295 |
| 170 | Ga0207642_10342059 | 3300025899 | Bacteria | 880 |
| 171 | Ga0207710_10094888 | 3300025900 | Bacteria | 1401 |
| 172 | Ga0207688_10069100 | 3300025901 | Bacteria | 2001 |
| 173 | Ga0207680_10295193 | 3300025903 | Bacteria | 1129 |
| 174 | Ga0207685_10087182 | 3300025905 | Bacteria | 1306 |
| 175 | Ga0207699_10114611 | 3300025906 | Bacteria | 1733 |
| 176 | Ga0207645_10057545 | 3300025907 | Bacteria | 2482 |
| 177 | Ga0207645_10151314 | 3300025907 | Bacteria | 1515 |
| 178 | Ga0207705_10103538 | 3300025909 | Bacteria | 2096 |
| 179 | Ga0207654_10186923 | 3300025911 | Bacteria | 1355 |
| 180 | Ga0207707_10052036 | 3300025912 | Bacteria | 3566 |
| 181 | Ga0207707_10079086 | 3300025912 | Bacteria | 2871 |
| 182 | Ga0207707_10282255 | 3300025912 | Bacteria | 1438 |
| 183 | Ga0207707_10581380 | 3300025912 | Bacteria | 949 |
| 184 | Ga0207695_10430013 | 3300025913 | Bacteria | 1204 |
| 185 | Ga0207693_10007083 | 3300025915 | Bacteria | 9255 |
| 186 | Ga0207693_10238549 | 3300025915 | Bacteria | 1427 |
| 187 | Ga0207663_10448637 | 3300025916 | Bacteria | 994 |
| 188 | Ga0207660_10045377 | 3300025917 | Bacteria | 3096 |
| 189 | Ga0207660_10099786 | 3300025917 | Bacteria | 2167 |
| 190 | Ga0207660_10187669 | 3300025917 | Bacteria | 1608 |
| 191 | Ga0207660_10275843 | 3300025917 | Bacteria | 1333 |
| 192 | Ga0207657_10012386 | 3300025919 | Bacteria | 8425 |
| 193 | Ga0207657_10049996 | 3300025919 | Bacteria | 3640 |
| 194 | Ga0207657_10283899 | 3300025919 | Bacteria | 1314 |
| 195 | Ga0207657_10421105 | 3300025919 | Bacteria | 1049 |
| 196 | Ga0207652_10017613 | 3300025921 | Bacteria | 5847 |
| 197 | Ga0207652_10019752 | 3300025921 | Bacteria | 5544 |
| 198 | Ga0207652_10055891 | 3300025921 | Bacteria | 3397 |
| 199 | Ga0207681_10491712 | 3300025923 | Bacteria | 1003 |
| 200 | Ga0207694_10070217 | 3300025924 | Bacteria | 2736 |
| 201 | Ga0207694_10137170 | 3300025924 | Bacteria | 1966 |
| 202 | Ga0207694_10475959 | 3300025924 | Bacteria | 1044 |
| 203 | Ga0207650_10024914 | 3300025925 | Bacteria | 4259 |
| 204 | Ga0207650_10814290 | 3300025925 | Bacteria | 792 |
| 205 | Ga0207659_10040871 | 3300025926 | Bacteria | 3245 |
| 206 | Ga0207659_10706590 | 3300025926 | Bacteria | 863 |
| 207 | Ga0207687_10009265 | 3300025927 | Bacteria | 6440 |
| 208 | Ga0207687_10043029 | 3300025927 | Bacteria | 3110 |
| 209 | Ga0207687_10102474 | 3300025927 | Bacteria | 2109 |
| 210 | Ga0207700_10313291 | 3300025928 | Bacteria | 1358 |
| 211 | Ga0207700_10399954 | 3300025928 | Bacteria | 1204 |
| 212 | Ga0207664_10196236 | 3300025929 | Bacteria | 1740 |
| 213 | Ga0207664_10273736 | 3300025929 | Bacteria | 1480 |
| 214 | Ga0207644_10606389 | 3300025931 | Bacteria | 909 |
| 215 | Ga0207690_10014208 | 3300025932 | Bacteria | 4805 |
| 216 | Ga0207706_10010248 | 3300025933 | Bacteria | 8571 |
| 217 | Ga0207706_10309959 | 3300025933 | Bacteria | 1374 |
| 218 | Ga0207686_10030953 | 3300025934 | Bacteria | 3174 |
| 219 | Ga0207686_10078867 | 3300025934 | Bacteria | 2143 |
| 220 | Ga0207670_10007258 | 3300025936 | Bacteria | 6174 |
| 221 | Ga0207670_10520032 | 3300025936 | Bacteria | 969 |
| 222 | Ga0207669_10001043 | 3300025937 | Bacteria | 11828 |
| 223 | Ga0207669_10496780 | 3300025937 | Bacteria | 975 |
| 224 | Ga0207704_10030194 | 3300025938 | Bacteria | 3035 |
| 225 | Ga0207704_10422428 | 3300025938 | Bacteria | 1057 |
| 226 | Ga0207691_10092454 | 3300025940 | Bacteria | 2709 |
| 227 | Ga0207711_10086135 | 3300025941 | Bacteria | 2754 |
| 228 | Ga0207711_10541530 | 3300025941 | Bacteria | 1086 |
| 229 | Ga0207689_10063125 | 3300025942 | Bacteria | 3047 |
| 230 | Ga0207661_10548612 | 3300025944 | Bacteria | 1059 |
| 231 | Ga0207667_10030455 | 3300025949 | Bacteria | 5837 |
| 232 | Ga0207667_10190017 | 3300025949 | Bacteria | 2107 |
| 233 | Ga0207667_10292804 | 3300025949 | Bacteria | 1663 |
| 234 | Ga0207667_10705131 | 3300025949 | Bacteria | 1011 |
| 235 | Ga0207667_11147599 | 3300025949 | Bacteria | 758 |
| 236 | Ga0207651_10089754 | 3300025960 | Bacteria | 2245 |
| 237 | Ga0207651_10227414 | 3300025960 | Bacteria | 1512 |
| 238 | Ga0207651_10398956 | 3300025960 | Bacteria | 1169 |
| 239 | Ga0207640_10325650 | 3300025981 | Bacteria | 1225 |
| 240 | Ga0207640_10336696 | 3300025981 | Bacteria | 1207 |
| 241 | Ga0207640_10531983 | 3300025981 | Bacteria | 984 |
| 242 | Ga0207658_10023653 | 3300025986 | Bacteria | 4291 |
| 243 | Ga0207658_10211665 | 3300025986 | Bacteria | 1625 |
| 244 | Ga0207703_10326529 | 3300026035 | Bacteria | 1406 |
| 245 | Ga0207703_10470763 | 3300026035 | Bacteria | 1176 |
| 246 | Ga0207703_10964992 | 3300026035 | Bacteria | 817 |
| 247 | Ga0207678_10457693 | 3300026067 | Bacteria | 1110 |
| 248 | Ga0207678_10526044 | 3300026067 | Bacteria | 1032 |
| 249 | Ga0207702_11305873 | 3300026078 | Bacteria | 720 |
| 250 | Ga0207641_10138528 | 3300026088 | Bacteria | 2193 |
| 251 | Ga0207641_10368402 | 3300026088 | Bacteria | 1373 |
| 252 | Ga0207648_10014584 | 3300026089 | Bacteria | 7258 |
| 253 | Ga0207648_10229497 | 3300026089 | Bacteria | 1651 |
| 254 | Ga0207676_10049134 | 3300026095 | Bacteria | 3279 |
| 255 | Ga0207676_10588558 | 3300026095 | Bacteria | 1067 |
| 256 | Ga0207674_10266986 | 3300026116 | Bacteria | 1659 |
| 257 | Ga0207674_10322711 | 3300026116 | Bacteria | 1494 |
| 258 | Ga0207674_10514805 | 3300026116 | Bacteria | 1156 |
| 259 | Ga0207683_10037407 | 3300026121 | Bacteria | 4226 |
| 260 | Ga0207683_10418701 | 3300026121 | Bacteria | 1234 |
| 261 | Ga0207698_10129546 | 3300026142 | Bacteria | 2153 |
| 262 | Ga0207698_10467885 | 3300026142 | Bacteria | 1220 |
| 263 | Ga0207698_10487723 | 3300026142 | Bacteria | 1197 |
| 264 | Ga0209971_1005141 | 3300027682 | Bacteria | 3106 |
| 265 | Ga0268266_10179134 | 3300028379 | Bacteria | 1929 |
| 266 | Ga0265334_10021465 | 3300028573 | Bacteria | 2636 |
| 267 | Ga0265330_10000012 | 3300031235 | Bacteria | 180837 |
| 268 | Ga0265332_10000012 | 3300031238 | Bacteria | 272641 |
| 269 | Ga0265332_10205193 | 3300031238 | Bacteria | 818 |
| 270 | Ga0265320_10110227 | 3300031240 | Bacteria | 1261 |
| 271 | Ga0265325_10005643 | 3300031241 | Bacteria | 7697 |
| 272 | Ga0265325_10009992 | 3300031241 | Bacteria | 5515 |
| 273 | Ga0265325_10018970 | 3300031241 | Bacteria | 3809 |
| 274 | Ga0265325_10096264 | 3300031241 | Bacteria | 1454 |
| 275 | Ga0265340_10007315 | 3300031247 | Bacteria | 6001 |
| 276 | Ga0265340_10108274 | 3300031247 | Bacteria | 1286 |
| 277 | Ga0265331_10085416 | 3300031250 | Bacteria | 1462 |
| 278 | Ga0316579_10062629 | 3300031691 | Bacteria | 1752 |
| 279 | Ga0265314_10000029 | 3300031711 | Bacteria | 272506 |
| 280 | Ga0265314_10020379 | 3300031711 | Bacteria | 5119 |
| 281 | Ga0265314_10235677 | 3300031711 | Bacteria | 1059 |
| 282 | Ga0265342_10000760 | 3300031712 | Bacteria | 32963 |
| 283 | Ga0265342_10034133 | 3300031712 | Bacteria | 3123 |
| 284 | Ga0265342_10072723 | 3300031712 | Bacteria | 2001 |
| 285 | Ga0307412_10008676 | 3300031911 | Bacteria | 5812 |
| 286 | Ga0373959_0061082 | 3300034820 | Bacteria | 834 |
| 287 | Ga0373923_0278468 | 3300035111 | Bacteria | 788 |
| 288 | Ga0373939_0132803 | 3300035114 | Bacteria | 890 |
| 289 | Ga0373953_0110140 | 3300035117 | Bacteria | 1164 |
| 290 | Ga0373956_0214473 | 3300035119 | Bacteria | 913 |
| 291 | Ga0373943_0112769 | 3300035170 | Bacteria | 1436 |
| 292 | Ga0373955_0034436 | 3300035172 | Bacteria | 2675 |
| 293 | Ga0373961_0009298 | 3300035241 | Bacteria | 2403 |
| 294 | Ga0373924_0065318 | 3300035410 | Bacteria | 1528 |
| 295 | Ga0373931_0113074 | 3300035691 | Bacteria | 1543 |
| 296 | Ga0373933_0325796 | 3300035724 | Bacteria | 996 |
| 297 | Ga0373947_0164189 | 3300035725 | Bacteria | 1438 |
| 298 | Ga0373947_0308899 | 3300035725 | Bacteria | 1056 |
| 299 | Ga0373947_0459662 | 3300035725 | Bacteria | 863 |
| 300 | Ga0373937_0132621 | 3300036401 | Bacteria | 2327 |
| 301 | Ga0373937_0385290 | 3300036401 | Bacteria | 1330 |
| 302 | Ga0373937_0813244 | 3300036401 | Bacteria | 883 |
| 303 | Ga0373925_0206926 | 3300037068 | Bacteria | 1562 |
| 304 | Ga0373925_0238971 | 3300037068 | Bacteria | 1454 |
| 305 | Ga0395898_0002494 | 3300037466 | Bacteria | 21650 |
| 306 | Ga0436364_0561925 | 3300037853 | Bacteria | 691 |
| 307 | Ga0395901_0024020 | 3300038443 | Bacteria | 6253 |
| 308 | Ga0395901_0036020 | 3300038443 | Bacteria | 5113 |
| 309 | Ga0395901_0883286 | 3300038443 | Bacteria | 877 |
| 310 | Ga0466963_0167707 | 3300044694 | Bacteria | 1530 |
| 311 | Ga0495617_057462 | 3300046452 | Bacteria | 1290 |
| 312 | Ga0495592_0045660 | 3300046454 | Bacteria | 3268 |
| 313 | Ga0495651_0009837 | 3300046462 | Bacteria | 7352 |
| 314 | Ga0495662_0130180 | 3300046476 | Bacteria | 1237 |
| 315 | Ga0495640_0435737 | 3300046533 | Bacteria | 802 |
| 316 | Ga0495645_0003148 | 3300046543 | Bacteria | 11187 |
| 317 | Ga0495667_0012256 | 3300046559 | Bacteria | 5811 |
| 318 | Ga0495635_0206737 | 3300046663 | Bacteria | 1330 |
| 319 | Ga0495588_0272378 | 3300046674 | Bacteria | 892 |
| 320 | Ga0495623_0264350 | 3300046679 | Bacteria | 962 |
| 321 | Ga0495600_0665551 | 3300046809 | Bacteria | 628 |
| 322 | Ga0495604_0035799 | 3300047317 | Bacteria | 3918 |
| 323 | Ga0495604_0487726 | 3300047317 | Bacteria | 801 |
| 324 | Ga0495674_0265214 | 3300047319 | Bacteria | 1410 |
| 325 | Ga0495674_0371698 | 3300047319 | Bacteria | 1158 |
| 326 | Ga0495680_0022570 | 3300047322 | Bacteria | 5242 |
| 327 | Ga0495602_0036104 | 3300048088 | Bacteria | 4603 |
| 328 | Ga0495602_0496574 | 3300048088 | Bacteria | 854 |
| 329 | Ga0496100_0015279 | 3300048903 | Bacteria | 4480 |
| 330 | Ga0496100_0110167 | 3300048903 | Bacteria | 1911 |
| 331 | Ga0496100_0156699 | 3300048903 | Bacteria | 1629 |
| 332 | Ga0496101_0018533 | 3300048904 | Bacteria | 4735 |
| 333 | Ga0496101_0278277 | 3300048904 | Bacteria | 1307 |
| 334 | Ga0496102_0210254 | 3300048905 | Bacteria | 1834 |
| 335 | Ga0496104_0000090 | 3300048907 | Bacteria | 87877 |
| 336 | Ga0496104_0083777 | 3300048907 | Bacteria | 3041 |
| 337 | Ga0496105_0001810 | 3300048908 | Bacteria | 15299 |
| 338 | Ga0496105_0007284 | 3300048908 | Bacteria | 8548 |
| 339 | Ga0496105_0013103 | 3300048908 | Bacteria | 6575 |
| 340 | Ga0496106_0010697 | 3300048909 | Bacteria | 6781 |
| 341 | Ga0496106_0180963 | 3300048909 | Bacteria | 1673 |
| 342 | Ga0496107_0013472 | 3300048910 | Bacteria | 5716 |
| 343 | Ga0496108_0000805 | 3300048911 | Bacteria | 24339 |
| 344 | Ga0496109_0003733 | 3300048912 | Bacteria | 12725 |
| 345 | Ga0496110_0049050 | 3300048913 | Bacteria | 3702 |
| 346 | Ga0496111_0018479 | 3300048914 | Bacteria | 4830 |
| 347 | Ga0496112_0008356 | 3300048915 | Bacteria | 9269 |
| 348 | Ga0496112_0929371 | 3300048915 | Bacteria | 791 |
| 349 | Ga0496113_0049228 | 3300048916 | Bacteria | 3137 |
| 350 | Ga0496113_0389935 | 3300048916 | Bacteria | 1118 |
| 351 | Ga0496114_0020586 | 3300048917 | Bacteria | 5355 |
| 352 | Ga0496114_0112851 | 3300048917 | Bacteria | 2330 |
| 353 | Ga0496114_0128696 | 3300048917 | Bacteria | 2185 |
| 354 | Ga0496115_0003400 | 3300048918 | Bacteria | 11426 |
| 355 | Ga0496115_0088136 | 3300048918 | Bacteria | 2533 |
| 356 | Ga0496126_0054845 | 3300048929 | Bacteria | 3608 |
| 357 | Ga0501033_0063851 | 3300049570 | Bacteria | 2710 |
| 358 | Ga0501033_0269399 | 3300049570 | Bacteria | 1204 |
| 359 | Ga0501033_0280513 | 3300049570 | Bacteria | 1176 |
| 360 | Ga0501034_0250723 | 3300049571 | Bacteria | 1715 |
| 361 | Ga0501034_0301000 | 3300049571 | Bacteria | 1540 |
| 362 | Ga0501034_0579232 | 3300049571 | Bacteria | 1029 |
| 363 | Ga0501034_0773169 | 3300049571 | Bacteria | 854 |
| 364 | Ga0501036_0700451 | 3300049572 | Bacteria | 837 |
| 365 | Ga0501036_0831864 | 3300049572 | Bacteria | 759 |
| 366 | Ga0501038_0061135 | 3300049574 | Bacteria | 3222 |
| 367 | Ga0501038_0132294 | 3300049574 | Bacteria | 2046 |
| 368 | Ga0501042_0046488 | 3300049578 | Bacteria | 3095 |
| 369 | Ga0501043_0049543 | 3300049579 | Bacteria | 3302 |
| 370 | Ga0501046_0018860 | 3300049580 | Bacteria | 5730 |
| 371 | Ga0501047_0003616 | 3300049581 | Bacteria | 14572 |
| 372 | Ga0501047_0106974 | 3300049581 | Bacteria | 2678 |
| 373 | Ga0501047_0249308 | 3300049581 | Bacteria | 1624 |
| 374 | Ga0501047_0254051 | 3300049581 | Bacteria | 1606 |
| 375 | Ga0501047_0256750 | 3300049581 | Bacteria | 1596 |
| 376 | Ga0501047_0409772 | 3300049581 | Bacteria | 1188 |
| 377 | Ga0501047_0643834 | 3300049581 | Unclassified | 880 |
| 378 | Ga0501048_0125891 | 3300049582 | Bacteria | 1811 |
| 379 | Ga0501067_0121299 | 3300049583 | Bacteria | 1455 |
| 380 | Ga0501068_0031650 | 3300049584 | Bacteria | 3142 |
| 381 | Ga0501069_0009076 | 3300049585 | Bacteria | 5247 |
| 382 | Ga0501070_0022563 | 3300049586 | Bacteria | 5272 |
| 383 | Ga0501070_0054793 | 3300049586 | Bacteria | 3307 |
| 384 | Ga0501070_0070699 | 3300049586 | Bacteria | 2890 |
| 385 | Ga0501070_0248618 | 3300049586 | Bacteria | 1455 |
| 386 | Ga0501070_0657079 | 3300049586 | Bacteria | 832 |
| 387 | Ga0501071_0035873 | 3300049587 | Bacteria | 3534 |
| 388 | Ga0501071_0109191 | 3300049587 | Bacteria | 2044 |
| 389 | Ga0501072_0046760 | 3300049588 | Bacteria | 3407 |
| 390 | Ga0501072_0322466 | 3300049588 | Bacteria | 1228 |
| 391 | Ga0501073_0114450 | 3300049589 | Bacteria | 1870 |
| 392 | Ga0501074_0027519 | 3300049590 | Bacteria | 4122 |
| 393 | Ga0501076_0011971 | 3300049592 | Bacteria | 6481 |
| 394 | Ga0501076_0259941 | 3300049592 | Unclassified | 1421 |
| 395 | Ga0501077_0074705 | 3300049593 | Bacteria | 2147 |
| 396 | Ga0501079_0079368 | 3300049741 | Bacteria | 2538 |
| 397 | Ga0501079_0156720 | 3300049741 | Bacteria | 1775 |
| 398 | Ga0501079_0613955 | 3300049741 | Bacteria | 856 |
| 399 | Ga0501080_0099054 | 3300049742 | Bacteria | 2705 |
| 400 | Ga0501080_0782977 | 3300049742 | Bacteria | 837 |
| 401 | Ga0501080_0795717 | 3300049742 | Bacteria | 829 |
| 402 | Ga0501081_0172298 | 3300049743 | Bacteria | 1563 |
| 403 | Ga0501083_0031278 | 3300049744 | Bacteria | 3653 |
| 404 | Ga0501083_0069615 | 3300049744 | Bacteria | 2341 |
| 405 | Ga0501083_0246133 | 3300049744 | Bacteria | 1164 |
| 406 | Ga0501035_0036273 | 3300049822 | Bacteria | 4470 |
| 407 | Ga0501035_0085064 | 3300049822 | Bacteria | 2789 |
| 408 | Ga0501044_0004547 | 3300049823 | Bacteria | 15509 |
| 409 | Ga0501044_0116899 | 3300049823 | Bacteria | 2671 |
| 410 | Ga0501044_0396838 | 3300049823 | Bacteria | 1292 |
| 411 | Ga0501044_0403982 | 3300049823 | Bacteria | 1278 |
| 412 | Ga0501044_0953247 | 3300049823 | Bacteria | 731 |
| 413 | Ga0501044_1031910 | 3300049823 | Bacteria | 693 |
| 414 | Ga0501045_0128521 | 3300049824 | Bacteria | 1883 |
| 415 | nmdc:mga00v17_8078_c1 | 3300050491 | Bacteria | 5651 |
| 416 | nmdc:mga0yw44_286280_c1 | 3300050492 | Bacteria | 1102 |
| 417 | nmdc:mga0yw44_479609_c1 | 3300050492 | Bacteria | 843 |
| 418 | nmdc:mga0k408_105091_c1 | 3300050493 | Bacteria | 1667 |
| 419 | nmdc:mga05p37_238653_c1 | 3300050507 | Bacteria | 2187 |
| 420 | nmdc:mga06r32_110014_c1 | 3300050510 | Bacteria | 2710 |
| 421 | nmdc:mga06r32_616654_c1 | 3300050510 | Bacteria | 1055 |
| 422 | nmdc:mga08y16_375701_c1 | 3300050511 | Bacteria | 1457 |
| 423 | nmdc:mga0n895_434207_c1 | 3300050512 | Unclassified | 1327 |
| 424 | Ga0495601_0024174 | 3300053077 | Bacteria | 3740 |
| 425 | Ga0495601_0236637 | 3300053077 | Bacteria | 1192 |
| 426 | Ga0495612_0012389 | 3300053078 | Bacteria | 3437 |
| 427 | Ga0495612_0222948 | 3300053078 | Bacteria | 835 |
| 428 | Ga0495595_0123623 | 3300053084 | Bacteria | 1261 |
| 429 | Ga0495595_0155006 | 3300053084 | Bacteria | 1128 |
| 430 | Ga0495619_0002497 | 3300053085 | Bacteria | 12041 |
| 431 | Ga0500595_019074 | 3300053119 | Bacteria | 2495 |
| 432 | Ga0500642_0060804 | 3300053130 | Bacteria | 1696 |
| 433 | Ga0500652_000015 | 3300053131 | Bacteria | 131012 |
| 434 | Ga0500636_0040792 | 3300053177 | Bacteria | 2745 |
| 435 | Ga0501084_0060040 | 3300054114 | Bacteria | 3184 |
| 436 | Ga0501084_0078137 | 3300054114 | Bacteria | 2774 |
| 437 | Ga0501084_0177109 | 3300054114 | Bacteria | 1800 |
| 438 | Ga0501084_0603385 | 3300054114 | Bacteria | 927 |
| 439 | Ga0501082_0030553 | 3300060353 | Bacteria | 4642 |
| 440 | Ga0501082_0200976 | 3300060353 | Bacteria | 1734 |
| 441 | Ga0501082_0382211 | 3300060353 | Bacteria | 1229 |
| 442 | Ga0501082_0386337 | 3300060353 | Bacteria | 1221 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035725 | Ga0373947_0459662 | Ga0373947_0459662_19_576 | 185 |
| 2 | 3300049572 | Ga0501036_0831864 | Ga0501036_0831864_57_614 | 185 |
| 3 | 3300049581 | Ga0501047_0409772 | Ga0501047_0409772_11_568 | 185 |
| 4 | 3300049742 | Ga0501080_0782977 | Ga0501080_0782977_47_604 | 185 |
| 5 | 3300049822 | Ga0501035_0036273 | Ga0501035_0036273_1010_1567 | 185 |
| 6 | 3300053084 | Ga0495595_0155006 | Ga0495595_0155006_537_1094 | 185 |
| 7 | 3300035172 | Ga0373955_0034436 | Ga0373955_0034436_2078_2644 | 186 |
| 8 | 3300036401 | Ga0373937_0813244 | Ga0373937_0813244_257_823 | 186 |
| 9 | 3300037853 | Ga0436364_0561925 | Ga0436364_0561925_92_658 | 186 |
| 10 | 3300046809 | Ga0495600_0665551 | Ga0495600_0665551_46_612 | 186 |
| 11 | 3300048088 | Ga0495602_0496574 | Ga0495602_0496574_21_587 | 186 |
| 12 | 3300048915 | Ga0496112_0929371 | Ga0496112_0929371_39_602 | 186 |
| 13 | 3300048929 | Ga0496126_0054845 | Ga0496126_0054845_35_595 | 186 |
| 14 | 3300049586 | Ga0501070_0657079 | Ga0501070_0657079_226_786 | 186 |
| 15 | 3300049823 | Ga0501044_0953247 | Ga0501044_0953247_17_586 | 186 |
| 16 | 3300054114 | Ga0501084_0177109 | Ga0501084_0177109_1209_1769 | 186 |
| 17 | 3300049571 | Ga0501034_0773169 | Ga0501034_0773169_155_799 | 188 |
| 18 | 3300049574 | Ga0501038_0061135 | Ga0501038_0061135_857_1501 | 188 |
| 19 | 3300049578 | Ga0501042_0046488 | Ga0501042_0046488_841_1485 | 188 |
| 20 | 3300049579 | Ga0501043_0049543 | Ga0501043_0049543_2421_3065 | 188 |
| 21 | 3300049580 | Ga0501046_0018860 | Ga0501046_0018860_1773_2417 | 188 |
| 22 | 3300049581 | Ga0501047_0643834 | Ga0501047_0643834_53_697 | 188 |
| 23 | 3300049582 | Ga0501048_0125891 | Ga0501048_0125891_231_875 | 188 |
| 24 | 3300049584 | Ga0501068_0031650 | Ga0501068_0031650_49_693 | 188 |
| 25 | 3300049585 | Ga0501069_0009076 | Ga0501069_0009076_3761_4405 | 188 |
| 26 | 3300049586 | Ga0501070_0248618 | Ga0501070_0248618_281_898 | 188 |
| 27 | 3300049587 | Ga0501071_0109191 | Ga0501071_0109191_671_1315 | 188 |
| 28 | 3300049588 | Ga0501072_0322466 | Ga0501072_0322466_46_690 | 188 |
| 29 | 3300049590 | Ga0501074_0027519 | Ga0501074_0027519_3018_3662 | 188 |
| 30 | 3300049592 | Ga0501076_0259941 | Ga0501076_0259941_292_936 | 188 |
| 31 | 3300049741 | Ga0501079_0079368 | Ga0501079_0079368_53_697 | 188 |
| 32 | 3300049742 | Ga0501080_0795717 | Ga0501080_0795717_136_780 | 188 |
| 33 | 3300049744 | Ga0501083_0031278 | Ga0501083_0031278_2314_2958 | 188 |
| 34 | 3300049823 | Ga0501044_0396838 | Ga0501044_0396838_198_842 | 188 |
| 35 | 3300049824 | Ga0501045_0128521 | Ga0501045_0128521_850_1494 | 188 |
| 36 | 3300053131 | Ga0500652_000015 | Ga0500652_000015_110932_111498 | 188 |
| 37 | 3300054114 | Ga0501084_0603385 | Ga0501084_0603385_12_656 | 188 |
| 38 | 3300037466 | Ga0395898_0002494 | Ga0395898_0002494_5349_6020 | 191 |
| 39 | 3300038443 | Ga0395901_0036020 | Ga0395901_0036020_2863_3534 | 191 |
| 40 | 3300005437 | Ga0070710_10076775 | Ga0070710_100767752 | 192 |
| 41 | 3300006175 | Ga0070712_100670003 | Ga0070712_1006700031 | 192 |
| 42 | 3300025915 | Ga0207693_10238549 | Ga0207693_102385491 | 192 |
| 43 | 3300025949 | Ga0207667_11147599 | Ga0207667_111475991 | 192 |
| 44 | 3300005327 | Ga0070658_10053409 | Ga0070658_100534095 | 193 |
| 45 | 3300005336 | Ga0070680_100135108 | Ga0070680_1001351082 | 193 |
| 46 | 3300005339 | Ga0070660_100053762 | Ga0070660_1000537623 | 193 |
| 47 | 3300005458 | Ga0070681_10045046 | Ga0070681_100450464 | 193 |
| 48 | 3300005530 | Ga0070679_100013411 | Ga0070679_1000134114 | 193 |
| 49 | 3300025912 | Ga0207707_10052036 | Ga0207707_100520362 | 193 |
| 50 | 3300025919 | Ga0207657_10049996 | Ga0207657_100499965 | 193 |
| 51 | 3300011119 | Ga0105246_10937231 | Ga0105246_109372312 | 196 |
| 52 | iso_pu_bacteria | 2751185897 | 2753767397 | 197 |
| 53 | 3300006186 | Ga0075369_10045685 | Ga0075369_100456851 | 200 |
| 54 | 3300025981 | Ga0207640_10325650 | Ga0207640_103256502 | 200 |
| 55 | 3300031911 | Ga0307412_10008676 | Ga0307412_100086764 | 200 |
| 56 | 3300006051 | Ga0075364_10002489 | Ga0075364_100024895 | 202 |
| 57 | 3300027682 | Ga0209971_1005141 | Ga0209971_10051413 | 202 |
| 58 | 3300028573 | Ga0265334_10021465 | Ga0265334_100214653 | 202 |
| 59 | 3300031235 | Ga0265330_10000012 | Ga0265330_1000001226 | 202 |
| 60 | 3300031238 | Ga0265332_10000012 | Ga0265332_1000001226 | 202 |
| 61 | 3300031241 | Ga0265325_10009992 | Ga0265325_100099925 | 202 |
| 62 | 3300031247 | Ga0265340_10007315 | Ga0265340_100073151 | 202 |
| 63 | 3300031711 | Ga0265314_10000029 | Ga0265314_10000029232 | 202 |
| 64 | 3300031712 | Ga0265342_10034133 | Ga0265342_100341335 | 202 |
| 65 | 3300005436 | Ga0070713_101114299 | Ga0070713_1011142991 | 203 |
| 66 | 3300049570 | Ga0501033_0063851 | Ga0501033_0063851_1145_1894 | 203 |
| 67 | 3300005353 | Ga0070669_100145869 | Ga0070669_1001458693 | 204 |
| 68 | 3300025936 | Ga0207670_10520032 | Ga0207670_105200321 | 204 |
| 69 | 3300026089 | Ga0207648_10229497 | Ga0207648_102294971 | 204 |
| 70 | 3300031241 | Ga0265325_10005643 | Ga0265325_100056436 | 204 |
| 71 | 3300031241 | Ga0265325_10096264 | Ga0265325_100962642 | 204 |
| 72 | 3300031250 | Ga0265331_10085416 | Ga0265331_100854162 | 204 |
| 73 | 3300031711 | Ga0265314_10020379 | Ga0265314_100203793 | 204 |
| 74 | 3300037068 | Ga0373925_0238971 | Ga0373925_0238971_754_1368 | 204 |
| 75 | 3300049570 | Ga0501033_0280513 | Ga0501033_0280513_519_1133 | 204 |
| 76 | 3300049571 | Ga0501034_0250723 | Ga0501034_0250723_585_1199 | 204 |
| 77 | 3300049581 | Ga0501047_0003616 | Ga0501047_0003616_2014_2628 | 204 |
| 78 | 3300049586 | Ga0501070_0022563 | Ga0501070_0022563_3283_3897 | 204 |
| 79 | 3300049742 | Ga0501080_0099054 | Ga0501080_0099054_983_1597 | 204 |
| 80 | 3300049744 | Ga0501083_0246133 | Ga0501083_0246133_140_754 | 204 |
| 81 | 3300049823 | Ga0501044_0116899 | Ga0501044_0116899_614_1228 | 204 |
| 82 | 3300054114 | Ga0501084_0060040 | Ga0501084_0060040_1514_2128 | 204 |
| 83 | 3300060353 | Ga0501082_0030553 | Ga0501082_0030553_2994_3608 | 204 |
| 84 | 3300060353 | Ga0501082_0386337 | Ga0501082_0386337_23_637 | 204 |
| 85 | 3300003215 | JGI25153J46596_10006326 | JGI25153J46596_100063265 | 205 |
| 86 | 3300003323 | rootH1_10101462 | rootH1_101014622 | 205 |
| 87 | 3300005293 | Ga0065715_10306608 | Ga0065715_103066082 | 205 |
| 88 | 3300005327 | Ga0070658_10027978 | Ga0070658_100279784 | 205 |
| 89 | 3300005327 | Ga0070658_10028965 | Ga0070658_100289654 | 205 |
| 90 | 3300005329 | Ga0070683_100432716 | Ga0070683_1004327162 | 205 |
| 91 | 3300005331 | Ga0070670_100026882 | Ga0070670_1000268826 | 205 |
| 92 | 3300005331 | Ga0070670_100755444 | Ga0070670_1007554442 | 205 |
| 93 | 3300005333 | Ga0070677_10014283 | Ga0070677_100142833 | 205 |
| 94 | 3300005333 | Ga0070677_10210344 | Ga0070677_102103441 | 205 |
| 95 | 3300005335 | Ga0070666_10470145 | Ga0070666_104701452 | 205 |
| 96 | 3300005336 | Ga0070680_100011452 | Ga0070680_10001145210 | 205 |
| 97 | 3300005336 | Ga0070680_100025958 | Ga0070680_1000259581 | 205 |
| 98 | 3300005336 | Ga0070680_100072903 | Ga0070680_1000729032 | 205 |
| 99 | 3300005336 | Ga0070680_100304071 | Ga0070680_1003040712 | 205 |
| 100 | 3300005336 | Ga0070680_100631888 | Ga0070680_1006318881 | 205 |
| 101 | 3300005336 | Ga0070680_100697789 | Ga0070680_1006977891 | 205 |
| 102 | 3300005337 | Ga0070682_100006846 | Ga0070682_1000068469 | 205 |
| 103 | 3300005338 | Ga0068868_100040237 | Ga0068868_1000402373 | 205 |
| 104 | 3300005338 | Ga0068868_100591794 | Ga0068868_1005917941 | 205 |
| 105 | 3300005339 | Ga0070660_100137014 | Ga0070660_1001370143 | 205 |
| 106 | 3300005339 | Ga0070660_100205323 | Ga0070660_1002053232 | 205 |
| 107 | 3300005340 | Ga0070689_100226481 | Ga0070689_1002264812 | 205 |
| 108 | 3300005343 | Ga0070687_100145290 | Ga0070687_1001452902 | 205 |
| 109 | 3300005345 | Ga0070692_10063626 | Ga0070692_100636263 | 205 |
| 110 | 3300005347 | Ga0070668_100953801 | Ga0070668_1009538011 | 205 |
| 111 | 3300005353 | Ga0070669_100085935 | Ga0070669_1000859354 | 205 |
| 112 | 3300005354 | Ga0070675_100234134 | Ga0070675_1002341342 | 205 |
| 113 | 3300005355 | Ga0070671_100027802 | Ga0070671_1000278027 | 205 |
| 114 | 3300005355 | Ga0070671_100193657 | Ga0070671_1001936572 | 205 |
| 115 | 3300005355 | Ga0070671_100651949 | Ga0070671_1006519491 | 205 |
| 116 | 3300005356 | Ga0070674_100003096 | Ga0070674_10000309610 | 205 |
| 117 | 3300005356 | Ga0070674_100650230 | Ga0070674_1006502301 | 205 |
| 118 | 3300005364 | Ga0070673_100055124 | Ga0070673_1000551243 | 205 |
| 119 | 3300005364 | Ga0070673_100141661 | Ga0070673_1001416612 | 205 |
| 120 | 3300005364 | Ga0070673_100796017 | Ga0070673_1007960171 | 205 |
| 121 | 3300005365 | Ga0070688_100044893 | Ga0070688_1000448933 | 205 |
| 122 | 3300005366 | Ga0070659_100602794 | Ga0070659_1006027942 | 205 |
| 123 | 3300005367 | Ga0070667_100042921 | Ga0070667_1000429212 | 205 |
| 124 | 3300005434 | Ga0070709_10120324 | Ga0070709_101203242 | 205 |
| 125 | 3300005435 | Ga0070714_100050148 | Ga0070714_1000501484 | 205 |
| 126 | 3300005435 | Ga0070714_100097281 | Ga0070714_1000972814 | 205 |
| 127 | 3300005435 | Ga0070714_100293796 | Ga0070714_1002937962 | 205 |
| 128 | 3300005436 | Ga0070713_100443057 | Ga0070713_1004430572 | 205 |
| 129 | 3300005436 | Ga0070713_100558013 | Ga0070713_1005580131 | 205 |
| 130 | 3300005437 | Ga0070710_10130329 | Ga0070710_101303291 | 205 |
| 131 | 3300005439 | Ga0070711_100099184 | Ga0070711_1000991843 | 205 |
| 132 | 3300005439 | Ga0070711_100578612 | Ga0070711_1005786121 | 205 |
| 133 | 3300005440 | Ga0070705_100639354 | Ga0070705_1006393541 | 205 |
| 134 | 3300005441 | Ga0070700_100084241 | Ga0070700_1000842414 | 205 |
| 135 | 3300005456 | Ga0070678_100010386 | Ga0070678_1000103866 | 205 |
| 136 | 3300005456 | Ga0070678_100060497 | Ga0070678_1000604972 | 205 |
| 137 | 3300005456 | Ga0070678_100750249 | Ga0070678_1007502492 | 205 |
| 138 | 3300005457 | Ga0070662_100008811 | Ga0070662_1000088114 | 205 |
| 139 | 3300005457 | Ga0070662_100129303 | Ga0070662_1001293032 | 205 |
| 140 | 3300005458 | Ga0070681_10151203 | Ga0070681_101512033 | 205 |
| 141 | 3300005458 | Ga0070681_10159183 | Ga0070681_101591832 | 205 |
| 142 | 3300005458 | Ga0070681_10541998 | Ga0070681_105419981 | 205 |
| 143 | 3300005458 | Ga0070681_10683129 | Ga0070681_106831292 | 205 |
| 144 | 3300005459 | Ga0068867_100044411 | Ga0068867_1000444112 | 205 |
| 145 | 3300005466 | Ga0070685_10037442 | Ga0070685_100374425 | 205 |
| 146 | 3300005530 | Ga0070679_100015163 | Ga0070679_1000151637 | 205 |
| 147 | 3300005530 | Ga0070679_100037628 | Ga0070679_1000376285 | 205 |
| 148 | 3300005530 | Ga0070679_100168539 | Ga0070679_1001685393 | 205 |
| 149 | 3300005530 | Ga0070679_100265216 | Ga0070679_1002652162 | 205 |
| 150 | 3300005530 | Ga0070679_100992613 | Ga0070679_1009926131 | 205 |
| 151 | 3300005535 | Ga0070684_100612743 | Ga0070684_1006127432 | 205 |
| 152 | 3300005539 | Ga0068853_100001426 | Ga0068853_10000142620 | 205 |
| 153 | 3300005539 | Ga0068853_100583891 | Ga0068853_1005838911 | 205 |
| 154 | 3300005544 | Ga0070686_100347932 | Ga0070686_1003479322 | 205 |
| 155 | 3300005547 | Ga0070693_100148426 | Ga0070693_1001484262 | 205 |
| 156 | 3300005548 | Ga0070665_100347820 | Ga0070665_1003478203 | 205 |
| 157 | 3300005563 | Ga0068855_100099382 | Ga0068855_1000993823 | 205 |
| 158 | 3300005563 | Ga0068855_100154423 | Ga0068855_1001544236 | 205 |
| 159 | 3300005563 | Ga0068855_100159580 | Ga0068855_1001595803 | 205 |
| 160 | 3300005563 | Ga0068855_100211827 | Ga0068855_1002118273 | 205 |
| 161 | 3300005563 | Ga0068855_100348875 | Ga0068855_1003488752 | 205 |
| 162 | 3300005563 | Ga0068855_100714647 | Ga0068855_1007146471 | 205 |
| 163 | 3300005577 | Ga0068857_101041402 | Ga0068857_1010414021 | 205 |
| 164 | 3300005578 | Ga0068854_100316435 | Ga0068854_1003164352 | 205 |
| 165 | 3300005616 | Ga0068852_100507502 | Ga0068852_1005075021 | 205 |
| 166 | 3300005617 | Ga0068859_100082811 | Ga0068859_1000828112 | 205 |
| 167 | 3300005617 | Ga0068859_100331734 | Ga0068859_1003317341 | 205 |
| 168 | 3300005618 | Ga0068864_100047112 | Ga0068864_1000471124 | 205 |
| 169 | 3300005618 | Ga0068864_100165912 | Ga0068864_1001659123 | 205 |
| 170 | 3300005842 | Ga0068858_100231102 | Ga0068858_1002311022 | 205 |
| 171 | 3300006028 | Ga0070717_10467519 | Ga0070717_104675192 | 205 |
| 172 | 3300006038 | Ga0075365_10303844 | Ga0075365_103038442 | 205 |
| 173 | 3300006163 | Ga0070715_10082691 | Ga0070715_100826913 | 205 |
| 174 | 3300006173 | Ga0070716_100566227 | Ga0070716_1005662272 | 205 |
| 175 | 3300006175 | Ga0070712_100602422 | Ga0070712_1006024221 | 205 |
| 176 | 3300006195 | Ga0075366_10012522 | Ga0075366_100125228 | 205 |
| 177 | 3300006195 | Ga0075366_10072392 | Ga0075366_100723923 | 205 |
| 178 | 3300006237 | Ga0097621_100062007 | Ga0097621_1000620073 | 205 |
| 179 | 3300006237 | Ga0097621_100194159 | Ga0097621_1001941592 | 205 |
| 180 | 3300006358 | Ga0068871_100220762 | Ga0068871_1002207622 | 205 |
| 181 | 3300006358 | Ga0068871_100229047 | Ga0068871_1002290473 | 205 |
| 182 | 3300006844 | Ga0075428_100087097 | Ga0075428_1000870973 | 205 |
| 183 | 3300006847 | Ga0075431_100113059 | Ga0075431_1001130592 | 205 |
| 184 | 3300006847 | Ga0075431_100689335 | Ga0075431_1006893352 | 205 |
| 185 | 3300006880 | Ga0075429_100305935 | Ga0075429_1003059352 | 205 |
| 186 | 3300006881 | Ga0068865_100118105 | Ga0068865_1001181051 | 205 |
| 187 | 3300006881 | Ga0068865_100310282 | Ga0068865_1003102822 | 205 |
| 188 | 3300006914 | Ga0075436_100150834 | Ga0075436_1001508342 | 205 |
| 189 | 3300006914 | Ga0075436_100201673 | Ga0075436_1002016733 | 205 |
| 190 | 3300006931 | Ga0097620_100082809 | Ga0097620_1000828092 | 205 |
| 191 | 3300006931 | Ga0097620_100331734 | Ga0097620_1003317341 | 205 |
| 192 | 3300009093 | Ga0105240_10629531 | Ga0105240_106295311 | 205 |
| 193 | 3300009094 | Ga0111539_10474390 | Ga0111539_104743902 | 205 |
| 194 | 3300009098 | Ga0105245_10103263 | Ga0105245_101032632 | 205 |
| 195 | 3300009098 | Ga0105245_10207633 | Ga0105245_102076332 | 205 |
| 196 | 3300009098 | Ga0105245_10652656 | Ga0105245_106526561 | 205 |
| 197 | 3300009101 | Ga0105247_10180742 | Ga0105247_101807422 | 205 |
| 198 | 3300009147 | Ga0114129_10062316 | Ga0114129_100623162 | 205 |
| 199 | 3300009147 | Ga0114129_10205298 | Ga0114129_102052982 | 205 |
| 200 | 3300009174 | Ga0105241_10095451 | Ga0105241_100954513 | 205 |
| 201 | 3300009176 | Ga0105242_10069120 | Ga0105242_100691203 | 205 |
| 202 | 3300009176 | Ga0105242_10288095 | Ga0105242_102880952 | 205 |
| 203 | 3300009177 | Ga0105248_10134194 | Ga0105248_101341942 | 205 |
| 204 | 3300009545 | Ga0105237_11305053 | Ga0105237_113050531 | 205 |
| 205 | 3300009551 | Ga0105238_10055204 | Ga0105238_100552044 | 205 |
| 206 | 3300009551 | Ga0105238_10072902 | Ga0105238_100729022 | 205 |
| 207 | 3300009551 | Ga0105238_10207457 | Ga0105238_102074574 | 205 |
| 208 | 3300009551 | Ga0105238_10362027 | Ga0105238_103620272 | 205 |
| 209 | 3300010159 | Ga0099796_10047985 | Ga0099796_100479852 | 205 |
| 210 | 3300011119 | Ga0105246_10163165 | Ga0105246_101631651 | 205 |
| 211 | 3300011119 | Ga0105246_10337325 | Ga0105246_103373253 | 205 |
| 212 | 3300013100 | Ga0157373_10057036 | Ga0157373_100570364 | 205 |
| 213 | 3300013100 | Ga0157373_10066546 | Ga0157373_100665462 | 205 |
| 214 | 3300013100 | Ga0157373_10215370 | Ga0157373_102153704 | 205 |
| 215 | 3300013102 | Ga0157371_10648364 | Ga0157371_106483642 | 205 |
| 216 | 3300013104 | Ga0157370_10031902 | Ga0157370_100319023 | 205 |
| 217 | 3300013104 | Ga0157370_10059136 | Ga0157370_100591363 | 205 |
| 218 | 3300013104 | Ga0157370_10691840 | Ga0157370_106918401 | 205 |
| 219 | 3300013105 | Ga0157369_10117851 | Ga0157369_101178512 | 205 |
| 220 | 3300013105 | Ga0157369_10487659 | Ga0157369_104876591 | 205 |
| 221 | 3300013105 | Ga0157369_10869880 | Ga0157369_108698801 | 205 |
| 222 | 3300013297 | Ga0157378_10092192 | Ga0157378_100921924 | 205 |
| 223 | 3300013306 | Ga0163162_10171530 | Ga0163162_101715302 | 205 |
| 224 | 3300013306 | Ga0163162_11268225 | Ga0163162_112682251 | 205 |
| 225 | 3300013307 | Ga0157372_10009232 | Ga0157372_1000923211 | 205 |
| 226 | 3300013307 | Ga0157372_10203736 | Ga0157372_102037363 | 205 |
| 227 | 3300013307 | Ga0157372_10273816 | Ga0157372_102738163 | 205 |
| 228 | 3300013307 | Ga0157372_10844341 | Ga0157372_108443412 | 205 |
| 229 | 3300013307 | Ga0157372_11365261 | Ga0157372_113652611 | 205 |
| 230 | 3300013308 | Ga0157375_10267602 | Ga0157375_102676022 | 205 |
| 231 | 3300013308 | Ga0157375_10843607 | Ga0157375_108436072 | 205 |
| 232 | 3300014325 | Ga0163163_10076912 | Ga0163163_100769123 | 205 |
| 233 | 3300014325 | Ga0163163_10091065 | Ga0163163_100910652 | 205 |
| 234 | 3300014325 | Ga0163163_10676842 | Ga0163163_106768421 | 205 |
| 235 | 3300014969 | Ga0157376_10192158 | Ga0157376_101921583 | 205 |
| 236 | 3300017792 | Ga0163161_10304630 | Ga0163161_103046302 | 205 |
| 237 | 3300017792 | Ga0163161_10536869 | Ga0163161_105368691 | 205 |
| 238 | 3300020070 | Ga0206356_11190055 | Ga0206356_111900551 | 205 |
| 239 | 3300025297 | Ga0209758_1000188 | Ga0209758_1000188110 | 205 |
| 240 | 3300025893 | Ga0207682_10002841 | Ga0207682_100028414 | 205 |
| 241 | 3300025898 | Ga0207692_10040715 | Ga0207692_100407153 | 205 |
| 242 | 3300025899 | Ga0207642_10342059 | Ga0207642_103420591 | 205 |
| 243 | 3300025900 | Ga0207710_10094888 | Ga0207710_100948881 | 205 |
| 244 | 3300025901 | Ga0207688_10069100 | Ga0207688_100691002 | 205 |
| 245 | 3300025903 | Ga0207680_10295193 | Ga0207680_102951932 | 205 |
| 246 | 3300025905 | Ga0207685_10087182 | Ga0207685_100871821 | 205 |
| 247 | 3300025906 | Ga0207699_10114611 | Ga0207699_101146112 | 205 |
| 248 | 3300025907 | Ga0207645_10057545 | Ga0207645_100575453 | 205 |
| 249 | 3300025907 | Ga0207645_10151314 | Ga0207645_101513141 | 205 |
| 250 | 3300025909 | Ga0207705_10103538 | Ga0207705_101035381 | 205 |
| 251 | 3300025911 | Ga0207654_10186923 | Ga0207654_101869232 | 205 |
| 252 | 3300025912 | Ga0207707_10079086 | Ga0207707_100790863 | 205 |
| 253 | 3300025912 | Ga0207707_10282255 | Ga0207707_102822552 | 205 |
| 254 | 3300025912 | Ga0207707_10581380 | Ga0207707_105813802 | 205 |
| 255 | 3300025913 | Ga0207695_10430013 | Ga0207695_104300132 | 205 |
| 256 | 3300025915 | Ga0207693_10007083 | Ga0207693_100070835 | 205 |
| 257 | 3300025916 | Ga0207663_10448637 | Ga0207663_104486371 | 205 |
| 258 | 3300025917 | Ga0207660_10045377 | Ga0207660_100453773 | 205 |
| 259 | 3300025917 | Ga0207660_10099786 | Ga0207660_100997862 | 205 |
| 260 | 3300025917 | Ga0207660_10187669 | Ga0207660_101876693 | 205 |
| 261 | 3300025917 | Ga0207660_10275843 | Ga0207660_102758433 | 205 |
| 262 | 3300025919 | Ga0207657_10012386 | Ga0207657_100123868 | 205 |
| 263 | 3300025919 | Ga0207657_10283899 | Ga0207657_102838992 | 205 |
| 264 | 3300025919 | Ga0207657_10421105 | Ga0207657_104211051 | 205 |
| 265 | 3300025921 | Ga0207652_10017613 | Ga0207652_100176133 | 205 |
| 266 | 3300025921 | Ga0207652_10019752 | Ga0207652_100197523 | 205 |
| 267 | 3300025921 | Ga0207652_10055891 | Ga0207652_100558912 | 205 |
| 268 | 3300025923 | Ga0207681_10491712 | Ga0207681_104917121 | 205 |
| 269 | 3300025924 | Ga0207694_10070217 | Ga0207694_100702172 | 205 |
| 270 | 3300025924 | Ga0207694_10137170 | Ga0207694_101371702 | 205 |
| 271 | 3300025924 | Ga0207694_10475959 | Ga0207694_104759591 | 205 |
| 272 | 3300025925 | Ga0207650_10024914 | Ga0207650_100249143 | 205 |
| 273 | 3300025925 | Ga0207650_10814290 | Ga0207650_108142901 | 205 |
| 274 | 3300025926 | Ga0207659_10040871 | Ga0207659_100408712 | 205 |
| 275 | 3300025926 | Ga0207659_10706590 | Ga0207659_107065902 | 205 |
| 276 | 3300025927 | Ga0207687_10009265 | Ga0207687_100092655 | 205 |
| 277 | 3300025927 | Ga0207687_10043029 | Ga0207687_100430294 | 205 |
| 278 | 3300025927 | Ga0207687_10102474 | Ga0207687_101024744 | 205 |
| 279 | 3300025928 | Ga0207700_10313291 | Ga0207700_103132911 | 205 |
| 280 | 3300025928 | Ga0207700_10399954 | Ga0207700_103999541 | 205 |
| 281 | 3300025929 | Ga0207664_10196236 | Ga0207664_101962361 | 205 |
| 282 | 3300025929 | Ga0207664_10273736 | Ga0207664_102737362 | 205 |
| 283 | 3300025931 | Ga0207644_10606389 | Ga0207644_106063892 | 205 |
| 284 | 3300025932 | Ga0207690_10014208 | Ga0207690_100142082 | 205 |
| 285 | 3300025933 | Ga0207706_10010248 | Ga0207706_100102485 | 205 |
| 286 | 3300025933 | Ga0207706_10309959 | Ga0207706_103099592 | 205 |
| 287 | 3300025934 | Ga0207686_10030953 | Ga0207686_100309533 | 205 |
| 288 | 3300025934 | Ga0207686_10078867 | Ga0207686_100788672 | 205 |
| 289 | 3300025936 | Ga0207670_10007258 | Ga0207670_100072585 | 205 |
| 290 | 3300025937 | Ga0207669_10001043 | Ga0207669_100010432 | 205 |
| 291 | 3300025937 | Ga0207669_10496780 | Ga0207669_104967802 | 205 |
| 292 | 3300025938 | Ga0207704_10030194 | Ga0207704_100301943 | 205 |
| 293 | 3300025938 | Ga0207704_10422428 | Ga0207704_104224281 | 205 |
| 294 | 3300025940 | Ga0207691_10092454 | Ga0207691_100924542 | 205 |
| 295 | 3300025941 | Ga0207711_10086135 | Ga0207711_100861354 | 205 |
| 296 | 3300025941 | Ga0207711_10541530 | Ga0207711_105415302 | 205 |
| 297 | 3300025942 | Ga0207689_10063125 | Ga0207689_100631251 | 205 |
| 298 | 3300025944 | Ga0207661_10548612 | Ga0207661_105486122 | 205 |
| 299 | 3300025949 | Ga0207667_10030455 | Ga0207667_100304555 | 205 |
| 300 | 3300025949 | Ga0207667_10190017 | Ga0207667_101900173 | 205 |
| 301 | 3300025949 | Ga0207667_10292804 | Ga0207667_102928041 | 205 |
| 302 | 3300025949 | Ga0207667_10705131 | Ga0207667_107051312 | 205 |
| 303 | 3300025960 | Ga0207651_10089754 | Ga0207651_100897541 | 205 |
| 304 | 3300025960 | Ga0207651_10227414 | Ga0207651_102274142 | 205 |
| 305 | 3300025960 | Ga0207651_10398956 | Ga0207651_103989561 | 205 |
| 306 | 3300025981 | Ga0207640_10336696 | Ga0207640_103366962 | 205 |
| 307 | 3300025981 | Ga0207640_10531983 | Ga0207640_105319831 | 205 |
| 308 | 3300025986 | Ga0207658_10023653 | Ga0207658_100236533 | 205 |
| 309 | 3300025986 | Ga0207658_10211665 | Ga0207658_102116652 | 205 |
| 310 | 3300026035 | Ga0207703_10326529 | Ga0207703_103265292 | 205 |
| 311 | 3300026035 | Ga0207703_10470763 | Ga0207703_104707631 | 205 |
| 312 | 3300026035 | Ga0207703_10964992 | Ga0207703_109649921 | 205 |
| 313 | 3300026067 | Ga0207678_10457693 | Ga0207678_104576932 | 205 |
| 314 | 3300026067 | Ga0207678_10526044 | Ga0207678_105260442 | 205 |
| 315 | 3300026078 | Ga0207702_11305873 | Ga0207702_113058731 | 205 |
| 316 | 3300026088 | Ga0207641_10138528 | Ga0207641_101385283 | 205 |
| 317 | 3300026088 | Ga0207641_10368402 | Ga0207641_103684022 | 205 |
| 318 | 3300026089 | Ga0207648_10014584 | Ga0207648_100145843 | 205 |
| 319 | 3300026095 | Ga0207676_10049134 | Ga0207676_100491345 | 205 |
| 320 | 3300026095 | Ga0207676_10588558 | Ga0207676_105885581 | 205 |
| 321 | 3300026116 | Ga0207674_10266986 | Ga0207674_102669861 | 205 |
| 322 | 3300026116 | Ga0207674_10322711 | Ga0207674_103227112 | 205 |
| 323 | 3300026116 | Ga0207674_10514805 | Ga0207674_105148051 | 205 |
| 324 | 3300026121 | Ga0207683_10037407 | Ga0207683_100374073 | 205 |
| 325 | 3300026121 | Ga0207683_10418701 | Ga0207683_104187012 | 205 |
| 326 | 3300026142 | Ga0207698_10129546 | Ga0207698_101295463 | 205 |
| 327 | 3300026142 | Ga0207698_10467885 | Ga0207698_104678852 | 205 |
| 328 | 3300026142 | Ga0207698_10487723 | Ga0207698_104877232 | 205 |
| 329 | 3300028379 | Ga0268266_10179134 | Ga0268266_101791343 | 205 |
| 330 | 3300031238 | Ga0265332_10205193 | Ga0265332_102051931 | 205 |
| 331 | 3300031240 | Ga0265320_10110227 | Ga0265320_101102273 | 205 |
| 332 | 3300031241 | Ga0265325_10018970 | Ga0265325_100189703 | 205 |
| 333 | 3300031247 | Ga0265340_10108274 | Ga0265340_101082742 | 205 |
| 334 | 3300031691 | Ga0316579_10062629 | Ga0316579_100626292 | 205 |
| 335 | 3300031711 | Ga0265314_10235677 | Ga0265314_102356771 | 205 |
| 336 | 3300031712 | Ga0265342_10000760 | Ga0265342_1000076031 | 205 |
| 337 | 3300031712 | Ga0265342_10072723 | Ga0265342_100727232 | 205 |
| 338 | 3300034820 | Ga0373959_0061082 | Ga0373959_0061082_159_782 | 205 |
| 339 | 3300035111 | Ga0373923_0278468 | Ga0373923_0278468_143_760 | 205 |
| 340 | 3300035114 | Ga0373939_0132803 | Ga0373939_0132803_22_639 | 205 |
| 341 | 3300035117 | Ga0373953_0110140 | Ga0373953_0110140_80_703 | 205 |
| 342 | 3300035119 | Ga0373956_0214473 | Ga0373956_0214473_97_720 | 205 |
| 343 | 3300035170 | Ga0373943_0112769 | Ga0373943_0112769_720_1337 | 205 |
| 344 | 3300035241 | Ga0373961_0009298 | Ga0373961_0009298_1306_1923 | 205 |
| 345 | 3300035410 | Ga0373924_0065318 | Ga0373924_0065318_47_670 | 205 |
| 346 | 3300035691 | Ga0373931_0113074 | Ga0373931_0113074_693_1310 | 205 |
| 347 | 3300035724 | Ga0373933_0325796 | Ga0373933_0325796_343_966 | 205 |
| 348 | 3300035725 | Ga0373947_0164189 | Ga0373947_0164189_56_673 | 205 |
| 349 | 3300035725 | Ga0373947_0308899 | Ga0373947_0308899_137_760 | 205 |
| 350 | 3300036401 | Ga0373937_0132621 | Ga0373937_0132621_1415_2038 | 205 |
| 351 | 3300036401 | Ga0373937_0385290 | Ga0373937_0385290_245_862 | 205 |
| 352 | 3300037068 | Ga0373925_0206926 | Ga0373925_0206926_437_1060 | 205 |
| 353 | 3300038443 | Ga0395901_0024020 | Ga0395901_0024020_4376_4993 | 205 |
| 354 | 3300038443 | Ga0395901_0883286 | Ga0395901_0883286_29_646 | 205 |
| 355 | 3300044694 | Ga0466963_0167707 | Ga0466963_0167707_835_1452 | 205 |
| 356 | 3300046452 | Ga0495617_057462 | Ga0495617_057462_229_852 | 205 |
| 357 | 3300046454 | Ga0495592_0045660 | Ga0495592_0045660_1027_1650 | 205 |
| 358 | 3300046462 | Ga0495651_0009837 | Ga0495651_0009837_1390_2013 | 205 |
| 359 | 3300046476 | Ga0495662_0130180 | Ga0495662_0130180_437_1054 | 205 |
| 360 | 3300046533 | Ga0495640_0435737 | Ga0495640_0435737_95_712 | 205 |
| 361 | 3300046543 | Ga0495645_0003148 | Ga0495645_0003148_3479_4102 | 205 |
| 362 | 3300046559 | Ga0495667_0012256 | Ga0495667_0012256_1818_2441 | 205 |
| 363 | 3300046663 | Ga0495635_0206737 | Ga0495635_0206737_434_1057 | 205 |
| 364 | 3300046674 | Ga0495588_0272378 | Ga0495588_0272378_253_882 | 205 |
| 365 | 3300046679 | Ga0495623_0264350 | Ga0495623_0264350_313_936 | 205 |
| 366 | 3300047317 | Ga0495604_0035799 | Ga0495604_0035799_3026_3649 | 205 |
| 367 | 3300047317 | Ga0495604_0487726 | Ga0495604_0487726_102_719 | 205 |
| 368 | 3300047319 | Ga0495674_0265214 | Ga0495674_0265214_129_752 | 205 |
| 369 | 3300047319 | Ga0495674_0371698 | Ga0495674_0371698_170_787 | 205 |
| 370 | 3300047322 | Ga0495680_0022570 | Ga0495680_0022570_1450_2073 | 205 |
| 371 | 3300048088 | Ga0495602_0036104 | Ga0495602_0036104_3412_4035 | 205 |
| 372 | 3300048903 | Ga0496100_0015279 | Ga0496100_0015279_124_747 | 205 |
| 373 | 3300048903 | Ga0496100_0110167 | Ga0496100_0110167_351_1151 | 205 |
| 374 | 3300048903 | Ga0496100_0156699 | Ga0496100_0156699_972_1589 | 205 |
| 375 | 3300048904 | Ga0496101_0018533 | Ga0496101_0018533_393_1016 | 205 |
| 376 | 3300048904 | Ga0496101_0278277 | Ga0496101_0278277_298_915 | 205 |
| 377 | 3300048905 | Ga0496102_0210254 | Ga0496102_0210254_948_1571 | 205 |
| 378 | 3300048907 | Ga0496104_0000090 | Ga0496104_0000090_17725_18348 | 205 |
| 379 | 3300048907 | Ga0496104_0083777 | Ga0496104_0083777_1953_2576 | 205 |
| 380 | 3300048908 | Ga0496105_0001810 | Ga0496105_0001810_3874_4497 | 205 |
| 381 | 3300048908 | Ga0496105_0007284 | Ga0496105_0007284_1499_2122 | 205 |
| 382 | 3300048908 | Ga0496105_0013103 | Ga0496105_0013103_5937_6554 | 205 |
| 383 | 3300048909 | Ga0496106_0010697 | Ga0496106_0010697_432_1055 | 205 |
| 384 | 3300048909 | Ga0496106_0180963 | Ga0496106_0180963_44_661 | 205 |
| 385 | 3300048910 | Ga0496107_0013472 | Ga0496107_0013472_2962_3585 | 205 |
| 386 | 3300048911 | Ga0496108_0000805 | Ga0496108_0000805_17673_18290 | 205 |
| 387 | 3300048912 | Ga0496109_0003733 | Ga0496109_0003733_7733_8350 | 205 |
| 388 | 3300048913 | Ga0496110_0049050 | Ga0496110_0049050_1070_1687 | 205 |
| 389 | 3300048914 | Ga0496111_0018479 | Ga0496111_0018479_1586_2203 | 205 |
| 390 | 3300048915 | Ga0496112_0008356 | Ga0496112_0008356_6637_7254 | 205 |
| 391 | 3300048916 | Ga0496113_0049228 | Ga0496113_0049228_397_1014 | 205 |
| 392 | 3300048916 | Ga0496113_0389935 | Ga0496113_0389935_253_870 | 205 |
| 393 | 3300048917 | Ga0496114_0020586 | Ga0496114_0020586_2403_3026 | 205 |
| 394 | 3300048917 | Ga0496114_0112851 | Ga0496114_0112851_1300_1917 | 205 |
| 395 | 3300048917 | Ga0496114_0128696 | Ga0496114_0128696_527_1150 | 205 |
| 396 | 3300048918 | Ga0496115_0003400 | Ga0496115_0003400_5734_6357 | 205 |
| 397 | 3300048918 | Ga0496115_0088136 | Ga0496115_0088136_532_1149 | 205 |
| 398 | 3300049570 | Ga0501033_0269399 | Ga0501033_0269399_470_1087 | 205 |
| 399 | 3300049571 | Ga0501034_0301000 | Ga0501034_0301000_83_700 | 205 |
| 400 | 3300049571 | Ga0501034_0579232 | Ga0501034_0579232_130_747 | 205 |
| 401 | 3300049572 | Ga0501036_0700451 | Ga0501036_0700451_156_773 | 205 |
| 402 | 3300049574 | Ga0501038_0132294 | Ga0501038_0132294_740_1357 | 205 |
| 403 | 3300049581 | Ga0501047_0106974 | Ga0501047_0106974_352_978 | 205 |
| 404 | 3300049581 | Ga0501047_0249308 | Ga0501047_0249308_175_792 | 205 |
| 405 | 3300049581 | Ga0501047_0254051 | Ga0501047_0254051_46_663 | 205 |
| 406 | 3300049581 | Ga0501047_0256750 | Ga0501047_0256750_419_1039 | 205 |
| 407 | 3300049583 | Ga0501067_0121299 | Ga0501067_0121299_814_1431 | 205 |
| 408 | 3300049586 | Ga0501070_0054793 | Ga0501070_0054793_325_948 | 205 |
| 409 | 3300049586 | Ga0501070_0070699 | Ga0501070_0070699_319_942 | 205 |
| 410 | 3300049587 | Ga0501071_0035873 | Ga0501071_0035873_1898_2521 | 205 |
| 411 | 3300049588 | Ga0501072_0046760 | Ga0501072_0046760_578_1201 | 205 |
| 412 | 3300049589 | Ga0501073_0114450 | Ga0501073_0114450_622_1248 | 205 |
| 413 | 3300049592 | Ga0501076_0011971 | Ga0501076_0011971_413_1036 | 205 |
| 414 | 3300049593 | Ga0501077_0074705 | Ga0501077_0074705_672_1295 | 205 |
| 415 | 3300049741 | Ga0501079_0156720 | Ga0501079_0156720_367_990 | 205 |
| 416 | 3300049741 | Ga0501079_0613955 | Ga0501079_0613955_94_711 | 205 |
| 417 | 3300049743 | Ga0501081_0172298 | Ga0501081_0172298_580_1203 | 205 |
| 418 | 3300049744 | Ga0501083_0069615 | Ga0501083_0069615_534_1160 | 205 |
| 419 | 3300049822 | Ga0501035_0085064 | Ga0501035_0085064_638_1261 | 205 |
| 420 | 3300049823 | Ga0501044_0004547 | Ga0501044_0004547_12848_13465 | 205 |
| 421 | 3300049823 | Ga0501044_0403982 | Ga0501044_0403982_311_934 | 205 |
| 422 | 3300049823 | Ga0501044_1031910 | Ga0501044_1031910_32_652 | 205 |
| 423 | 3300050491 | nmdc:mga00v17_8078_c1 | nmdc:mga00v17_8078_c1_920_1537 | 205 |
| 424 | 3300050492 | nmdc:mga0yw44_286280_c1 | nmdc:mga0yw44_286280_c1_204_821 | 205 |
| 425 | 3300050492 | nmdc:mga0yw44_479609_c1 | nmdc:mga0yw44_479609_c1_161_787 | 205 |
| 426 | 3300050493 | nmdc:mga0k408_105091_c1 | nmdc:mga0k408_105091_c1_939_1556 | 205 |
| 427 | 3300050507 | nmdc:mga05p37_238653_c1 | nmdc:mga05p37_238653_c1_85_702 | 205 |
| 428 | 3300050510 | nmdc:mga06r32_110014_c1 | nmdc:mga06r32_110014_c1_260_892 | 205 |
| 429 | 3300050510 | nmdc:mga06r32_616654_c1 | nmdc:mga06r32_616654_c1_172_789 | 205 |
| 430 | 3300050511 | nmdc:mga08y16_375701_c1 | nmdc:mga08y16_375701_c1_346_972 | 205 |
| 431 | 3300050512 | nmdc:mga0n895_434207_c1 | nmdc:mga0n895_434207_c1_106_759 | 205 |
| 432 | 3300053077 | Ga0495601_0024174 | Ga0495601_0024174_2707_3330 | 205 |
| 433 | 3300053077 | Ga0495601_0236637 | Ga0495601_0236637_287_904 | 205 |
| 434 | 3300053078 | Ga0495612_0012389 | Ga0495612_0012389_411_1034 | 205 |
| 435 | 3300053078 | Ga0495612_0222948 | Ga0495612_0222948_129_752 | 205 |
| 436 | 3300053084 | Ga0495595_0123623 | Ga0495595_0123623_117_740 | 205 |
| 437 | 3300053085 | Ga0495619_0002497 | Ga0495619_0002497_284_907 | 205 |
| 438 | 3300053119 | Ga0500595_019074 | Ga0500595_019074_1307_1924 | 205 |
| 439 | 3300053130 | Ga0500642_0060804 | Ga0500642_0060804_820_1437 | 205 |
| 440 | 3300053177 | Ga0500636_0040792 | Ga0500636_0040792_684_1301 | 205 |
| 441 | 3300054114 | Ga0501084_0078137 | Ga0501084_0078137_986_1609 | 205 |
| 442 | 3300060353 | Ga0501082_0200976 | Ga0501082_0200976_699_1325 | 205 |
| 443 | 3300060353 | Ga0501082_0382211 | Ga0501082_0382211_587_1210 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ai8-assembly1.cif.gz_B | crystal structure of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione | 0.8574 | 4 | 194 |
| 8ai9-assembly1.cif.gz_B | s10t variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione | 0.857 | 4 | 194 |
| 8aib-assembly1.cif.gz_B | r11a variant of glutathione transferase chi 1 from synechocystis sp. pcc 6803 in complex with glutathione | 0.8464 | 4 | 194 |
| 3uap-assembly1.cif.gz_A | crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath | 0.8452 | 4 | 199 |
| 3m8n-assembly1.cif.gz_B | crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris | 0.8355 | 4 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0B5EC52_24_99_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9636 | 7 | 79 | 3.40.30.10 |
| af_A0A1D6HAW8_13_80_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9599 | 7 | 70 | 3.40.30.10 |
| af_Q9VHD2_18_96_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9524 | 7 | 79 | 3.40.30.10 |
| af_K7TUZ4_3_77_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9498 | 4 | 66 | 3.40.30.10 |
| af_Q9C6C8_6_89_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9479 | 5 | 80 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q7TLL8-F1-model_v4 | Glutathione S-transferase | 0.9985 | 1 | 205 |
GO:0016740
|
| AF-A0A3C0BT16-F1-model_v4 | Glutathione S-transferase | 0.996 | 58 | 202 |
GO:0016740
|
| AF-X0UBQ8-F1-model_v4 | GST N-terminal domain-containing protein | 0.9889 | 1 | 194 |
|
| AF-V4TF02-F1-model_v4 | Glutathione S-transferase (EC 2.5.1.18) | 0.9806 | 4 | 202 |
GO:0004364
|
| AF-X0UBQ8-F1-model_v4 | GST N-terminal domain-containing protein | 0.9789 | 1 | 194 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar